{ "uniprot_canonical_ac": "A0A0C4DHA5-1", "uniprot_ac": "A0A0C4DHA5", "uniprot_id": "A0A0C4DHA5_DROME", "mass": { "chemical_mass": 49581.0, "monoisotopic_mass": 49581.0 }, "refseq": { "ac": "NP_730894", "name": "uncharacterized protein, isoform D", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_730894" }, "gene_names": [ { "name": "Dmel\\CG1116", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0C4DHA5", "id": "A0A0C4DHA5" }, { "name": "Rgp1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0C4DHA5", "id": "A0A0C4DHA5" }, { "name": "CG1116-RB", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0C4DHA5", "id": "A0A0C4DHA5" }, { "name": "CG1116", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_730894", "id": "NP_730894" }, { "name": "CG1116", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0C4DHA5", "id": "A0A0C4DHA5" }, { "name": "Dmel\\CG1116", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0C4DHA5", "id": "A0A0C4DHA5" }, { "name": "Dmel_CG1116", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0C4DHA5", "id": "A0A0C4DHA5" }, { "name": "Rgp1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0C4DHA5", "id": "A0A0C4DHA5" }, { "name": "anon-WO0118547.337; cg1116; Dmel\\CG1116; Rgp1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_730894", "id": "NP_730894" }, { "name": "anon-WO0118547.337", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0C4DHA5", "id": "A0A0C4DHA5" }, { "name": "cg1116", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0C4DHA5", "id": "A0A0C4DHA5" } ], "protein_names": [ { "name": "CG1116-PD", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_730894", "id": "NP_730894" }, { "name": "Uncharacterized protein, isoform D", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0C4DHA5/entry#names_and_taxonomy", "id": "A0A0C4DHA5" }, { "name": "uncharacterized protein, isoform D", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_730894", "id": "NP_730894" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "A0A0C4DHA5", "url": "https://www.uniprot.org/uniprot/A0A0C4DHA5" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "gene": [ { "name": "Rgp1", "url": "https://www.uniprot.org/uniprot/A0A0C4DHA5", "locus": { "chromosome": "3R", "start_pos": 5221548, "end_pos": 5219657, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0037297", "url": "https://www.ensemblgenomes.org/id/FBgn0037297" } ] } } ], "crossref": [ { "id": "A0A0C4DHA5", "url": "https://alphafold.ebi.ac.uk/entry/A0A0C4DHA5", "database": "AlphaFoldDB", "categories": [] }, { "id": "FBgn0037297", "url": "https://bgee.org/?page=gene&gene_id=FBgn0037297", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "FBgn0037297", "url": "https://flybase.org/reports/FBgn0037297", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "40622", "url": "https://www.ncbi.nlm.nih.gov/gene/40622", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q8IPP2", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q8IPP2*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR014848", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014848", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG1116", "url": "https://www.genome.jp/dbget-bin/www_bget?dme:Dmel_CG1116", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "CQVRCVQ", "url": "https://omabrowser.org/oma/group/CQVRCVQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0C4DHA5", "url": "https://www.orthodb.org/?gene=A0A0C4DHA5", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "Q8IPP2", "url": "https://www.orthodb.org/?gene=Q8IPP2", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "Q9VN84", "url": "https://www.orthodb.org/?gene=Q9VN84", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12507", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12507", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12507:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12507:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF08737", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF08737", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-DME-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-6811440", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-8876198", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_730894", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_730894", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0C4DHA5", "url": "https://www.uniprot.org/uniprot/A0A0C4DHA5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0C4DHA5-1", "url": "https://www.uniprot.org/uniprot/A0A0C4DHA5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8IPP2", "url": "https://www.uniprot.org/uniprot/Q8IPP2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8IPP2-1", "url": "https://www.uniprot.org/uniprot/Q8IPP2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9VN84", "url": "https://www.uniprot.org/uniprot/Q9VN84", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9VN84-1", "url": "https://www.uniprot.org/uniprot/Q9VN84-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MIEIKAKLLRADSAIYATGERVQCLIEFTHKVFSDEPAASQAVHNANEARSQENLAWASAQLHCYRKTSYSTSAGDRAAELTEMIGRTALDAVTQAPGEVIVATKPKILFCDLRLQPGETKMYFFNEFIPRDGPPTYRGHNIRYFYKITIATQRVKSKVQTLAVPIRVLPIPIISRPDELPVTVETNEELAPTNPFLEKREISELEISWHHLKNVTARRAPKFYRISNKRGFVGRFCLFKPAYKLGEDIVGSLDFDPGVNPRKVRCVQFSVKLQQQELSIRPQPVQNHQLQSQSSTGDDVSSMNSFDMASIASGVLADNLHKSATSASSKVKEAPEPTGKLSTISTSHQVCYATLQTQVVVPIPLHVTPTFRTDLVDVRWRLHFEFVTTTLIDFGIPNPESGELKAPSEMPVETMVWNLPVTVYAANPLQIYAPNQTFNLLIK", "length": 443, "header": "tr|A0A0C4DHA5-1|A0A0C4DHA5_DROME Isoform 1 of Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Rgp1 PE=1 SV=1 CANONICAL=A0A0C4DHA5-1" }, "isoforms": [ { "isoform_ac": "A0A0C4DHA5-1", "url": "https://www.uniprot.org/uniprotkb/A0A0C4DHA5/entry#A0A0C4DHA5-1", "sequence": { "sequence": "MIEIKAKLLRADSAIYATGERVQCLIEFTHKVFSDEPAASQAVHNANEARSQENLAWASAQLHCYRKTSYSTSAGDRAAELTEMIGRTALDAVTQAPGEVIVATKPKILFCDLRLQPGETKMYFFNEFIPRDGPPTYRGHNIRYFYKITIATQRVKSKVQTLAVPIRVLPIPIISRPDELPVTVETNEELAPTNPFLEKREISELEISWHHLKNVTARRAPKFYRISNKRGFVGRFCLFKPAYKLGEDIVGSLDFDPGVNPRKVRCVQFSVKLQQQELSIRPQPVQNHQLQSQSSTGDDVSSMNSFDMASIASGVLADNLHKSATSASSKVKEAPEPTGKLSTISTSHQVCYATLQTQVVVPIPLHVTPTFRTDLVDVRWRLHFEFVTTTLIDFGIPNPESGELKAPSEMPVETMVWNLPVTVYAANPLQIYAPNQTFNLLIK", "length": 443, "header": "tr|A0A0C4DHA5-1|A0A0C4DHA5_DROME Isoform 1 of Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Rgp1 PE=1 SV=1 CANONICAL=A0A0C4DHA5-1" }, "locus": { "chromosome": "3R", "start_pos": 5221288, "end_pos": 5219707, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0334907", "url": "https://www.ensemblgenomes.org/id/FBtr0334907" }, { "database": "Ensembl Peptide", "id": "FBpp0306928", "url": "https://www.ensemblgenomes.org/id/FBpp0306928" } ] } }, { "isoform_ac": "Q8IPP2-1", "url": "https://www.uniprot.org/uniprotkb/A0A0C4DHA5/entry#Q8IPP2-1", "sequence": { "sequence": "MIGRTALDAVTQAPGEVIVATKPKILFCDLRLQPGETKMYFFNEFIPRDGPPTYRGHNIRYFYKITIATQRVKSKVQTLAVPIRVLPIPIISRPDELPVTVETNEELAPTNPFLEKREISELEISWHHLKNVTARRAPKFYRISNKRGFVGRFCLFKPAYKLGEDIVGSLDFDPGVNPRKVRCVQFSVKLQQQELSIRPQPVQNHQLQSQSSTGDDVSSMNSFDMASIASGVLADNLHKSATSASSKVKEAPEPTGKLSTISTSHQVCYATLQTQVVVPIPLHVTPTFRTDLVDVRWRLHFEFVTTTLIDFGIPNPESGELKAPSEMPVETMVWNLPVTVYAANPLQIYAPNQTFNLLIK", "length": 360, "header": "tr|Q8IPP2-1|A0A0C4DHA5_DROME Computationally mapped isoform of Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Rgp1 PE=1 SV=1 CANONICAL=A0A0C4DHA5-1" }, "locus": { "chromosome": "3R", "start_pos": 5221288, "end_pos": 5220016, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0078774", "url": "https://www.ensemblgenomes.org/id/FBtr0078774" }, { "database": "Ensembl Peptide", "id": "FBpp0078421", "url": "https://www.ensemblgenomes.org/id/FBpp0078421" } ] } }, { "isoform_ac": "Q9VN84-1", "url": "https://www.uniprot.org/uniprotkb/A0A0C4DHA5/entry#Q9VN84-1", "sequence": { "sequence": "MIEIKAKLLRADSAIYATGERVQCLIEFTHKVFSDEPAASQAVHNANEASQENLAWASAQLHCYRKTSYSTSAGDRAAELTEMIGRTALDAVTQAPGEVIVATKPKILFCDLRLQPGETKMYFFNEFIPRDGPPTYRGHNIRYFYKITIATQRVKSKVQTLAVPIRVLPIPIISRPDELPVTVETNEELAPTNPFLEKREISELEISWHHLKNVTARRAPKFYRISNKRGFVGRFCLFKPAYKLGEDIVGSLDFDPGVNPRKVRCVQFSVKLQQQELSIRPQPVQNHQLQSQSSTGDDVSSMNSFDMASIASGVLADNLHKSATSASSKVKEAPEPTGKLSTISTSHQVCYATLQTQVVVPIPLHVTPTFRTDLVDVRWRLHFEFVTTTLIDFGIPNPESGELKAPSEMPVETMVWNLPVTVYAANPLQIYAPNQTFNLLIK", "length": 442, "header": "tr|Q9VN84-1|Q9VN84_DROME Computationally mapped isoform of Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\\CG1116 PE=1 SV=2 CANONICAL=A0A0C4DHA5-1" }, "locus": { "chromosome": "3R", "start_pos": 5221288, "end_pos": 5219707, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0078775", "url": "https://www.ensemblgenomes.org/id/FBtr0078775" }, { "database": "Ensembl Peptide", "id": "FBpp0078422", "url": "https://www.ensemblgenomes.org/id/FBpp0078422" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "Q8IPP2", "url": "https://www.uniprot.org/uniprot/Q8IPP2" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence.", "journal": "Genome Biol.", "date": "2002", "authors": "Celniker SE, Wheeler DA, Kronmiller B, Carlson JW, Halpern A, Patel S, Adams M, Champe M, Dugan SP, Frise E, Hodgson A, George RA, Hoskins RA, Laverty T, Muzny DM, Nelson CR, Pacleb JM, Park S, Pfeiffer BD, Richards S, Sodergren EJ, Svirskas R, Tabor PE, Wan K, Stapleton M, Sutton GG, Venter C, Weinstock G, Scherer SE, Myers EW, Gibbs RA, Rubin GM", "evidence": [ { "database": "UniProtKB", "id": "Q8IPP2", "url": "https://www.uniprot.org/uniprot/Q8IPP2" } ], "reference": [ { "type": "PubMed", "id": "12537568", "url": "https://glygen.org/publication/PubMed/12537568" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "Q8IPP2", "url": "https://www.uniprot.org/uniprot/Q8IPP2" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective.", "journal": "Genome Biol.", "date": "2002", "authors": "Kaminker JS, Bergman CM, Kronmiller B, Carlson J, Svirskas R, Patel S, Frise E, Wheeler DA, Lewis SE, Rubin GM, Ashburner M, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q8IPP2", "url": "https://www.uniprot.org/uniprot/Q8IPP2" } ], "reference": [ { "type": "PubMed", "id": "12537573", "url": "https://glygen.org/publication/PubMed/12537573" } ] }, { "title": "Heterochromatic sequences in a Drosophila whole-genome shotgun assembly.", "journal": "Genome Biol.", "date": "2002", "authors": "Hoskins RA, Smith CD, Carlson JW, Carvalho AB, Halpern A, Kaminker JS, Kennedy C, Mungall CJ, Sullivan BA, Sutton GG, Yasuhara JC, Wakimoto BT, Myers EW, Celniker SE, Rubin GM, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "Q8IPP2", "url": "https://www.uniprot.org/uniprot/Q8IPP2" } ], "reference": [ { "type": "PubMed", "id": "12537574", "url": "https://glygen.org/publication/PubMed/12537574" } ] }, { "title": "Combined evidence annotation of transposable elements in genome sequences.", "journal": "PLoS Comput. Biol.", "date": "2005", "authors": "Quesneville H, Bergman CM, Andrieu O, Autard D, Nouaud D, Ashburner M, Anxolabehere D", "evidence": [ { "database": "UniProtKB", "id": "Q8IPP2", "url": "https://www.uniprot.org/uniprot/Q8IPP2" } ], "reference": [ { "type": "PubMed", "id": "16110336", "url": "https://glygen.org/publication/PubMed/16110336" } ] }, { "title": "The Release 5.1 annotation of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Smith CD, Shu S, Mungall CJ, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "Q8IPP2", "url": "https://www.uniprot.org/uniprot/Q8IPP2" } ], "reference": [ { "type": "PubMed", "id": "17569856", "url": "https://glygen.org/publication/PubMed/17569856" } ] }, { "title": "Sequence finishing and mapping of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Hoskins RA, Carlson JW, Kennedy C, Acevedo D, Evans-Holm M, Frise E, Wan KH, Park S, Mendez-Lago M, Rossi F, Villasante A, Dimitri P, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q8IPP2", "url": "https://www.uniprot.org/uniprot/Q8IPP2" } ], "reference": [ { "type": "PubMed", "id": "17569867", "url": "https://glygen.org/publication/PubMed/17569867" } ] }, { "title": "The Release 6 reference sequence of the Drosophila melanogaster genome.", "journal": "Genome Res.", "date": "2015", "authors": "Hoskins RA, Carlson JW, Wan KH, Park S, Mendez I, Galle SE, Booth BW, Pfeiffer BD, George RA, Svirskas R, Krzywinski M, Schein J, Accardo MC, Damia E, Messina G, Mendez-Lago M, de Pablos B, Demakova OV, Andreyeva EN, Boldyreva LV, Marra M, Carvalho AB, Dimitri P, Villasante A, Zhimulev IF, Rubin GM, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q8IPP2", "url": "https://www.uniprot.org/uniprot/Q8IPP2" } ], "reference": [ { "type": "PubMed", "id": "25589440", "url": "https://glygen.org/publication/PubMed/25589440" } ] }, { "title": "Gene Model Annotations for Drosophila melanogaster: The Rule-Benders.", "journal": "G3 (Bethesda)", "date": "2015", "authors": "Crosby MA, Gramates LS, Dos Santos G, Matthews BB, St Pierre SE, Zhou P, Schroeder AJ, Falls K, Emmert DB, Russo SM, Gelbart WM", "evidence": [ { "database": "UniProtKB", "id": "Q8IPP2", "url": "https://www.uniprot.org/uniprot/Q8IPP2" } ], "reference": [ { "type": "PubMed", "id": "26109356", "url": "https://glygen.org/publication/PubMed/26109356" } ] }, { "title": "Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data.", "journal": "G3 (Bethesda)", "date": "2015", "authors": "Matthews BB, Dos Santos G, Crosby MA, Emmert DB, St Pierre SE, Gramates LS, Zhou P, Schroeder AJ, Falls K, Strelets V, Russo SM, Gelbart WM", "evidence": [ { "database": "UniProtKB", "id": "Q8IPP2", "url": "https://www.uniprot.org/uniprot/Q8IPP2" } ], "reference": [ { "type": "PubMed", "id": "26109357", "url": "https://glygen.org/publication/PubMed/26109357" } ] } ], "pathway": [ { "id": "dme:Dmel_CG1116", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?dme:Dmel_CG1116", "resource": "KEGG Pathway" }, { "id": "R-DME-6811440", "name": "Retrograde transport at the Trans-Golgi-Network", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-6811440", "resource": "Reactome", "description": "Retrograde transport at the Trans-Golgi-Network" }, { "id": "R-DME-8876198", "name": "RAB GEFs exchange GTP for GDP on RABs", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-8876198", "resource": "Reactome", "description": "RAB GEFs exchange GTP for GDP on RABs" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A8I5ZYV2-1", "protein_name": "RGP1 homolog, RAB6A GEF complex partner 1", "gene_name": "Rgp1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MIEVVAELSRGPVFLAGEALECVVTVTNPLPPTATSASRWGCCEALAWASAQIHCQFHASESRVALPPPDSSQPDVQPDSQTVFLPHRGERGQCILSTPPKILFCDLRLDPGESKSYSYSEVLPTEGPPSFRGQSVKYVYKLTIGCQRVNSPITLLRVPLRVLVLTGLQDVHFPQDEAVAPSSPFLEEDDSGKKDSWLAELAGERLMAATSCRSLHLYNISDGRGKVGTFGIFKSVYRLGEDVVGTLNLGEGTVACLQFSVSLQTEERVQPEYQRRRGTGVAPSVSHVTHARHQESCLHTTRTSFSLPIPLCSTPGFCTAIVSLKWRLHFEFVTSREPGLVLLPPLEQPEPATWTGPEQVPVDTFSWDLPIKVLPTSPTLVSYAAPGPSTSSITI", "length": 395 }, "evidence": [ { "id": "A0A0C4DHA5", "url": "https://omabrowser.org/oma/group/A0A0C4DHA5/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "A0AAA9SZG5-1", "protein_name": "RGP1 homolog, RAB6A GEF complex partner 1", "gene_name": "RGP1", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MIEVVAELSRGPVFLAGEALECVVTVTNPLPPTATSASSEALAWASAQIHCQFHASESRVALPPPDSSQPDVQPESQTVLLPHRGERGQCILSTPPKILFCDLRLDPGESKSYSYSEVLPVEGPPSFRGQSVKYVYKLTIGCQRVNSPITLLRVPLRVLVLTGLQDVRFPQDEAVAPSSPFLEEDEGGKKDSWLTELAGERLMAATSCRSLHLYNISDGRGKVGTFGIFKSVYRLGEDVVGTLNLGEGTVACLQFSVSLQTEERVQPEYQRRRGAGGAPSVSHITHARHQESCLHTTRTSFSLPIPLSSTPGFCTAIVSLKWRLHFEFVTSREPGLVLLPPVEQPEPATWTGPEQVPVDTFSWDLPIKVLPTSPTLASYAAPGPSTSTITI", "length": 391 }, "evidence": [ { "id": "A0A0C4DHA5", "url": "https://omabrowser.org/oma/group/A0A0C4DHA5/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "F1STB5-1", "protein_name": "RAB6A-GEF complex partner protein 2", "gene_name": "RGP1", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MIEVVAELSRGPVFLAGEALECVVTVTNPLPPTATSASSEALAWASAQIHCQFHASESRVALPPPDSSQPDVQPESQTVFLPHRGERGQCILSTPPKILFCDLRLDPGESKSYSYSEVLPIEGPPSFRGQSVKYVYKLTIGCQRVNSPITLLRVPLRVLVLTGLQDVQFPQDEAVAPSSPFLEEDEGGKKDSWLAELAGERLMAATSCRSLHLYNISDGRGKVGTFGIFKSVYRLGEDVVGTLNLGEGTVACLQFSVSLQTEERVQPEYQRRRGAGGAPSVSHVTHARHQESCLHTTRTSFSLPIPLSSTPGFCTAIVSLKWRLHFEFVTSREPGLVLLPPTEQPEPVTWTGPEQVPVDTFSWDLPIKVLPTSPTLASYAAPGPSTSTITI", "length": 391 }, "evidence": [ { "id": "A0A0C4DHA5", "url": "https://omabrowser.org/oma/group/A0A0C4DHA5/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "Q8BHT7-1", "protein_name": "RAB6A-GEF complex partner protein 2", "gene_name": "Rgp1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MIEVVAELSRGPVFLAGEALECVVTVTNPLPPTATSASSEALAWASAQIHCQFHASESRVALPPPDSSQPDVQPDSQTVFLPHRGERGQCILSTPPKILFCDLRLDPGESKSYSYSEVLPTEGPPSFRGQSVKYVYKLTIGCQRVNSPITLLRVPLRVLVLTGLQDVHFPQDEAVAPSSPFLEEDDSGKKDSWLAELAGERLMAATSCRSLHLYNISDGRGKVGTFGIFKSVYRLGEDVVGTLNLGEGTVACLQFSVSLQTEERVQPEYQRRRGTGVAPSVSHVTHARHQESCLHTTRTSFSLPIPLCSTPGFCTAIVSLKWRLHFEFVTSREPGLVLLPPLEQPEPATWTGPEQVPVDTFSWDLPIKVLPTSPTLVSYAAPGPSTSSITI", "length": 391 }, "evidence": [ { "id": "A0A0C4DHA5", "url": "https://omabrowser.org/oma/group/A0A0C4DHA5/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q92546-1", "protein_name": "RAB6A-GEF complex partner protein 2", "gene_name": "RGP1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MIEVVAELSRGPVFLAGEALECVVTVTNPLPPTATSASSEALAWASAQIHCQFHASESRVALPPPDSSQPDVQPDSQTVFLPHRGERGQCILSTPPKILFCDLRLDPGESKSYSYSEVLPIEGPPSFRGQSVKYVYKLTIGCQRVNSPITLLRVPLRVLVLTGLQDVRFPQDEAVAPSSPFLEEDEGGKKDSWLAELAGERLMAATSCRSLHLYNISDGRGKVGTFGIFKSVYRLGEDVVGTLNLGEGTVACLQFSVSLQTEERVQPEYQRRRGAGGVPSVSHVTHARHQESCLHTTRTSFSLPIPLSSTPGFCTAIVSLKWRLHFEFVTSREPGLVLLPPVEQPEPTTWTGPEQVPVDTFSWDLPIKVLPTSPTLASYAAPGPSTSTITI", "length": 391 }, "evidence": [ { "id": "A0A0C4DHA5", "url": "https://omabrowser.org/oma/group/A0A0C4DHA5/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "Ric1-Rgp1 guanyl-nucleotide exchange factor complex", "id": "GO:0034066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034066", "evidence": [ { "database": "UniProtKB", "id": "A0A0C4DHA5", "url": "https://www.uniprot.org/uniprot/A0A0C4DHA5" } ], "pmid": "" }, { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "A0A0C4DHA5", "url": "https://www.uniprot.org/uniprot/A0A0C4DHA5" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A0A0C4DHA5", "url": "https://www.uniprot.org/uniprot/A0A0C4DHA5" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "A0A0C4DHA5", "url": "https://www.uniprot.org/uniprot/A0A0C4DHA5" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "small GTPase binding", "id": "GO:0031267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031267", "evidence": [ { "database": "UniProtKB", "id": "A0A0C4DHA5", "url": "https://www.uniprot.org/uniprot/A0A0C4DHA5" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "retrograde transport, endosome to Golgi", "id": "GO:0042147", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042147", "evidence": [ { "database": "UniProtKB", "id": "A0A0C4DHA5", "url": "https://www.uniprot.org/uniprot/A0A0C4DHA5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 214, "end_pos": 216, "annotation": "n_glycosylation_sequon" }, { "start_pos": 435, "end_pos": 437, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A0C4DHA5-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 443, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A0C4DHA5-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 214, "end_pos": 216 }, { "start_pos": 435, "end_pos": 437 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }