{ "uniprot_canonical_ac": "A0A0B4KF65-1", "uniprot_ac": "A0A0B4KF65", "uniprot_id": "A0A0B4KF65_DROME", "mass": { "chemical_mass": 44966.0, "monoisotopic_mass": 44966.0 }, "refseq": { "ac": "NP_001262254", "name": "uncharacterized protein, isoform I", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262254" }, "gene_names": [ { "name": "BcDNA:GH22993", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65", "id": "A0A0B4KF65" }, { "name": "Dmel\\CG31522", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65", "id": "A0A0B4KF65" }, { "name": "anon-WO0118547.381", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65", "id": "A0A0B4KF65" }, { "name": "BcDNA:GH22993", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65", "id": "A0A0B4KF65" }, { "name": "BcDNA:LD10305", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65", "id": "A0A0B4KF65" }, { "name": "CG31522-RA", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65", "id": "A0A0B4KF65" }, { "name": "CG31522", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262254", "id": "NP_001262254" }, { "name": "CG31522", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65", "id": "A0A0B4KF65" }, { "name": "CG9798", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65", "id": "A0A0B4KF65" }, { "name": "Dmel\\CG31522", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65", "id": "A0A0B4KF65" }, { "name": "Dmel_CG31522", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65", "id": "A0A0B4KF65" }, { "name": "anon-WO0118547.381; BcDNA:GH22993; BcDNA:LD10305; CG9798; Dmel\\CG31522", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262254", "id": "NP_001262254" }, { "name": "anon-WO0118547.381", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65", "id": "A0A0B4KF65" } ], "protein_names": [ { "name": "Elongation of very long chain fatty acids protein", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0B4KF65/entry#names_and_taxonomy", "id": "A0A0B4KF65" }, { "name": "2.3.1.199", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0B4KF65/entry#names_and_taxonomy", "id": "A0A0B4KF65" }, { "name": "CG31522-PI", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262254", "id": "NP_001262254" }, { "name": "Very-long-chain 3-oxoacyl-CoA synthase", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0B4KF65/entry#names_and_taxonomy", "id": "A0A0B4KF65" }, { "name": "uncharacterized protein, isoform I", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262254", "id": "NP_001262254" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KF65", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "gene": [ { "name": "BcDNA:GH22993", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65", "locus": { "chromosome": "3R", "start_pos": 4441415, "end_pos": 4462883, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0051522", "url": "https://www.ensemblgenomes.org/id/FBgn0051522" } ] } } ], "crossref": [ { "id": "A0A0B4KF65", "url": "https://alphafold.ebi.ac.uk/entry/A0A0B4KF65", "database": "AlphaFoldDB", "categories": [] }, { "id": "FBgn0051522", "url": "https://bgee.org/?page=gene&gene_id=FBgn0051522", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "FBgn0051522", "url": "https://flybase.org/reports/FBgn0051522", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "40567", "url": "https://www.ncbi.nlm.nih.gov/gene/40567", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q8IPL8", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q8IPL8*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002076", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002076", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG31522", "url": "https://www.genome.jp/dbget-bin/www_bget?dme:Dmel_CG31522", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "HAMVNSM", "url": "https://omabrowser.org/oma/group/HAMVNSM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0B4KF65", "url": "https://www.orthodb.org/?gene=A0A0B4KF65", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "Q8IPL8", "url": "https://www.orthodb.org/?gene=Q8IPL8", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "Q9VN29", "url": "https://www.orthodb.org/?gene=Q9VN29", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11157", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11157", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11157:SF167", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11157:SF167", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01151", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01151", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-DME-2046105", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-2046105", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-2046106", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-2046106", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DME-75876", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-75876", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001262254", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262254", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "32727", "url": "https://www.rhea-db.org/rhea/32727", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0B4KF65", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0B4KF65-1", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8IPL8", "url": "https://www.uniprot.org/uniprot/Q8IPL8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8IPL8-1", "url": "https://www.uniprot.org/uniprot/Q8IPL8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9VN29", "url": "https://www.uniprot.org/uniprot/Q9VN29", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9VN29-1", "url": "https://www.uniprot.org/uniprot/Q9VN29-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MALIMKYIDSISRYMDSHSDSRTKGWPMMSSPFPTLAVCLTYVYLVKVLGPRLMENRKPLNLQNTLVMYNAIQVVFSAWLFYECLMGGWWGSYSFRCQPVDYTDSPTSRRIGISGWLTGHYSFRCQPVDYSNNPRTLRMVHACWWYYFSKFTEFMDTIFFVLRKKSSQVTTLHVIHHGCMPMSVWFGVKFTPGGHSTFFGLLNTFVHIVMYTYYMFSAMGPQYQKYLWWKKYLTTLQMVQFILIMVHAFQLLFIDCNYPKAFVWWIGMHAVMFFFLFNEFYKAAYRSRMMKKNGALANGHAKPNGYCKSINAHDDLAMPQTTEATATATPASKANGSSTPPSNGHANGVENVYKQVANGSAHKGSNGGLSNGYATKLLDDASQELKQRKTPK", "length": 392, "header": "tr|A0A0B4KF65-1|A0A0B4KF65_DROME Isoform 1 of Elongation of very long chain fatty acids protein OS=Drosophila melanogaster OX=7227 GN=BcDNA:GH22993 PE=1 SV=1 CANONICAL=A0A0B4KF65-1" }, "isoforms": [ { "isoform_ac": "A0A0B4KF65-1", "url": "https://www.uniprot.org/uniprotkb/A0A0B4KF65/entry#A0A0B4KF65-1", "sequence": { "sequence": "MALIMKYIDSISRYMDSHSDSRTKGWPMMSSPFPTLAVCLTYVYLVKVLGPRLMENRKPLNLQNTLVMYNAIQVVFSAWLFYECLMGGWWGSYSFRCQPVDYTDSPTSRRIGISGWLTGHYSFRCQPVDYSNNPRTLRMVHACWWYYFSKFTEFMDTIFFVLRKKSSQVTTLHVIHHGCMPMSVWFGVKFTPGGHSTFFGLLNTFVHIVMYTYYMFSAMGPQYQKYLWWKKYLTTLQMVQFILIMVHAFQLLFIDCNYPKAFVWWIGMHAVMFFFLFNEFYKAAYRSRMMKKNGALANGHAKPNGYCKSINAHDDLAMPQTTEATATATPASKANGSSTPPSNGHANGVENVYKQVANGSAHKGSNGGLSNGYATKLLDDASQELKQRKTPK", "length": 392, "header": "tr|A0A0B4KF65-1|A0A0B4KF65_DROME Isoform 1 of Elongation of very long chain fatty acids protein OS=Drosophila melanogaster OX=7227 GN=BcDNA:GH22993 PE=1 SV=1 CANONICAL=A0A0B4KF65-1" }, "locus": { "chromosome": "3R", "start_pos": 4447758, "end_pos": 4442750, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0335432", "url": "https://www.ensemblgenomes.org/id/FBtr0335432" }, { "database": "Ensembl Peptide", "id": "FBpp0307413", "url": "https://www.ensemblgenomes.org/id/FBpp0307413" } ] } }, { "isoform_ac": "Q8IPL8-1", "url": "https://www.uniprot.org/uniprotkb/A0A0B4KF65/entry#Q8IPL8-1", "sequence": { "sequence": "MALIMKYIDSISRYMDSHSDSRTKGWPMMSSPFPTLAVCLTYVYLVKVLGPRLMENRKPLNLQNTLVMYNAIQVVFSAWLFYEIGISGWLTGHYSFRCQPVDYSNNPRTLRMVHACWWYYFSKFTEFMDTIFFVLRKKSSQVTTLHVIHHGCMPMSVWFGVKFTPGGHSTFFGLLNTFVHIVMYTYYMFSAMGPQYQKYLWWKKYLTTLQMVQFILIMVHAFQLLFIDCNYPKAFVWWIGMHAVMFFFLFNEFYKAAYRSRMMKKNGALANGHAKPNGYCKSINAHDDLAMPQTTEATATATPASKANGSSTPPSNGHANGVENVYKQVANGSAHKGSNGGLSNGYATKLLDDASQELKQRKTPK", "length": 365, "header": "tr|Q8IPL8-1|Q8IPL8_DROME Computationally mapped isoform of Elongation of very long chain fatty acids protein OS=Drosophila melanogaster OX=7227 GN=anon-WO0118547.381 PE=1 SV=2 CANONICAL=A0A0B4KF65-1" }, "locus": { "chromosome": "3R", "start_pos": 4447758, "end_pos": 4442750, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0078939", "url": "https://www.ensemblgenomes.org/id/FBtr0078939" }, { "database": "Ensembl Peptide", "id": "FBpp0078579", "url": "https://www.ensemblgenomes.org/id/FBpp0078579" } ] } }, { "isoform_ac": "Q9VN29-1", "url": "https://www.uniprot.org/uniprotkb/A0A0B4KF65/entry#Q9VN29-1", "sequence": { "sequence": "MALIMKYIDSISRYMDSHSDSRTKGWPMMSSPFPTLAVCLTYVYLVKVLGPRLMENRKPLNLQNTLVMYNAIQVVFSAWLFYECLMGGWWGSYSFRCQPVDYTDSPTSRRMVHACWWYYFSKFTEFMDTIFFVLRKKSSQVTTLHVIHHGCMPMSVWFGVKFTPGGHSTFFGLLNTFVHIVMYTYYMFSAMGPQYQKYLWWKKYLTTLQMVQFILIMVHAFQLLFIDCNYPKAFVWWIGMHAVMFFFLFNEFYKAAYRSRMMKKNGALANGHAKPNGYCKSINAHDDLAMPQTTEATATATPASKANGSSTPPSNGHANGVENVYKQVANGSAHKGSNGGLSNGYATKLLDDASQELKQRKTPK", "length": 364, "header": "tr|Q9VN29-1|A0A0B4KF65_DROME Computationally mapped isoform of Elongation of very long chain fatty acids protein OS=Drosophila melanogaster OX=7227 GN=BcDNA:GH22993 PE=1 SV=3 CANONICAL=A0A0B4KF65-1" }, "locus": { "chromosome": "3R", "start_pos": 4447758, "end_pos": 4442750, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0078942", "url": "https://www.ensemblgenomes.org/id/FBtr0078942" }, { "database": "Ensembl Peptide", "id": "FBpp0078582", "url": "https://www.ensemblgenomes.org/id/FBpp0078582" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool": "isoglyp", "mining_tool": "", "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "start_pos": 329, "start_aa": "T", "end_pos": 329, "end_aa": "T", "residue": "Thr", "site_lbl": "Thr329", "evidence": [ { "id": "GLY_001163", "database": "GlyGen", "url": "https://data.glygen.org/GLY_001163" } ], "filter_code": "00000000000000001000.00000000001000.1.01000" } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "Q9VN29", "url": "https://www.uniprot.org/uniprot/Q9VN29" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence.", "journal": "Genome Biol.", "date": "2002", "authors": "Celniker SE, Wheeler DA, Kronmiller B, Carlson JW, Halpern A, Patel S, Adams M, Champe M, Dugan SP, Frise E, Hodgson A, George RA, Hoskins RA, Laverty T, Muzny DM, Nelson CR, Pacleb JM, Park S, Pfeiffer BD, Richards S, Sodergren EJ, Svirskas R, Tabor PE, Wan K, Stapleton M, Sutton GG, Venter C, Weinstock G, Scherer SE, Myers EW, Gibbs RA, Rubin GM", "evidence": [ { "database": "UniProtKB", "id": "Q9VN29", "url": "https://www.uniprot.org/uniprot/Q9VN29" } ], "reference": [ { "type": "PubMed", "id": "12537568", "url": "https://glygen.org/publication/PubMed/12537568" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VN29", "url": "https://www.uniprot.org/uniprot/Q9VN29" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective.", "journal": "Genome Biol.", "date": "2002", "authors": "Kaminker JS, Bergman CM, Kronmiller B, Carlson J, Svirskas R, Patel S, Frise E, Wheeler DA, Lewis SE, Rubin GM, Ashburner M, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VN29", "url": "https://www.uniprot.org/uniprot/Q9VN29" } ], "reference": [ { "type": "PubMed", "id": "12537573", "url": "https://glygen.org/publication/PubMed/12537573" } ] }, { "title": "Heterochromatic sequences in a Drosophila whole-genome shotgun assembly.", "journal": "Genome Biol.", "date": "2002", "authors": "Hoskins RA, Smith CD, Carlson JW, Carvalho AB, Halpern A, Kaminker JS, Kennedy C, Mungall CJ, Sullivan BA, Sutton GG, Yasuhara JC, Wakimoto BT, Myers EW, Celniker SE, Rubin GM, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "Q9VN29", "url": "https://www.uniprot.org/uniprot/Q9VN29" } ], "reference": [ { "type": "PubMed", "id": "12537574", "url": "https://glygen.org/publication/PubMed/12537574" } ] }, { "title": "Combined evidence annotation of transposable elements in genome sequences.", "journal": "PLoS Comput. Biol.", "date": "2005", "authors": "Quesneville H, Bergman CM, Andrieu O, Autard D, Nouaud D, Ashburner M, Anxolabehere D", "evidence": [ { "database": "UniProtKB", "id": "Q9VN29", "url": "https://www.uniprot.org/uniprot/Q9VN29" } ], "reference": [ { "type": "PubMed", "id": "16110336", "url": "https://glygen.org/publication/PubMed/16110336" } ] }, { "title": "The Release 5.1 annotation of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Smith CD, Shu S, Mungall CJ, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "Q9VN29", "url": "https://www.uniprot.org/uniprot/Q9VN29" } ], "reference": [ { "type": "PubMed", "id": "17569856", "url": "https://glygen.org/publication/PubMed/17569856" } ] }, { "title": "Sequence finishing and mapping of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Hoskins RA, Carlson JW, Kennedy C, Acevedo D, Evans-Holm M, Frise E, Wan KH, Park S, Mendez-Lago M, Rossi F, Villasante A, Dimitri P, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VN29", "url": "https://www.uniprot.org/uniprot/Q9VN29" } ], "reference": [ { "type": "PubMed", "id": "17569867", "url": "https://glygen.org/publication/PubMed/17569867" } ] }, { "title": "The Release 6 reference sequence of the Drosophila melanogaster genome.", "journal": "Genome Res.", "date": "2015", "authors": "Hoskins RA, Carlson JW, Wan KH, Park S, Mendez I, Galle SE, Booth BW, Pfeiffer BD, George RA, Svirskas R, Krzywinski M, Schein J, Accardo MC, Damia E, Messina G, Mendez-Lago M, de Pablos B, Demakova OV, Andreyeva EN, Boldyreva LV, Marra M, Carvalho AB, Dimitri P, Villasante A, Zhimulev IF, Rubin GM, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q9VN29", "url": "https://www.uniprot.org/uniprot/Q9VN29" } ], "reference": [ { "type": "PubMed", "id": "25589440", "url": "https://glygen.org/publication/PubMed/25589440" } ] }, { "title": "Gene Model Annotations for Drosophila melanogaster: The Rule-Benders.", "journal": "G3 (Bethesda)", "date": "2015", "authors": "Crosby MA, Gramates LS, Dos Santos G, Matthews BB, St Pierre SE, Zhou P, Schroeder AJ, Falls K, Emmert DB, Russo SM, Gelbart WM", "evidence": [ { "database": "UniProtKB", "id": "Q9VN29", "url": "https://www.uniprot.org/uniprot/Q9VN29" } ], "reference": [ { "type": "PubMed", "id": "26109356", "url": "https://glygen.org/publication/PubMed/26109356" } ] }, { "title": "Gene Model Annotations for Drosophila melanogaster: Impact of High-Throughput Data.", "journal": "G3 (Bethesda)", "date": "2015", "authors": "Matthews BB, Dos Santos G, Crosby MA, Emmert DB, St Pierre SE, Gramates LS, Zhou P, Schroeder AJ, Falls K, Strelets V, Russo SM, Gelbart WM", "evidence": [ { "database": "UniProtKB", "id": "Q9VN29", "url": "https://www.uniprot.org/uniprot/Q9VN29" } ], "reference": [ { "type": "PubMed", "id": "26109357", "url": "https://glygen.org/publication/PubMed/26109357" } ] } ], "pathway": [ { "id": "dme:Dmel_CG31522", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?dme:Dmel_CG31522", "resource": "KEGG Pathway" }, { "id": "R-DME-2046105", "name": "Linoleic acid (LA) metabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-2046105", "resource": "Reactome", "description": "Linoleic acid (LA) metabolism" }, { "id": "R-DME-2046106", "name": "alpha-linolenic acid (ALA) metabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-2046106", "resource": "Reactome", "description": "alpha-linolenic acid (ALA) metabolism" }, { "id": "R-DME-75876", "name": "Synthesis of very long-chain fatty acyl-CoAs", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-75876", "resource": "Reactome", "description": "Synthesis of very long-chain fatty acyl-CoAs" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A1B0GWP1-1", "protein_name": "Elongation of very long chain fatty acids protein 1", "gene_name": "Elovl1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MNCVVRRKEGSRRRPGRQSSLEEGGRKGGKGGRQGKVWRGMVGGSLQAGWMLHPNCLFSHIPLLTMARIQLGALGMLGKYFTTELDSQPYPFVSEPSELSDSVSCLFDYMCDGVMHDPCLMPTLHPSLESLARMEAVVNLYQELMKCADPRIQNYPLMGSPLLITSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLVTLSLYIVYEFLMSGWLSTYTWRCDPVDFSNNPEALRMVRVAWLFMLSKVIELMDTVIFILRKKDGQVTFLHVFHHSVLPWSWWWGIKIAPGGMGSFHAMINSSVHVVMYLYYGLSALGPVAQPYLWWKKHMTAIQLIQFVLVSLHISQYYFMPSCNYQYPIIIHLIWMYGTIFFILFSNFWYHSYTKGKRLPRAVQQNGAAASMKVKAN", "length": 412 }, "evidence": [ { "id": "A0A0B4KF65", "url": "https://omabrowser.org/oma/group/A0A0B4KF65/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "A0A8V0ZRH3-1", "protein_name": "Elongation of very long chain fatty acids protein 1", "gene_name": "ELOVL1", "tax_id": 9031, "organism": "Gallus gallus", "sequence": { "sequence": "MLVYNQLEAVITRHTATTMEGIVTMYQDFMKKADPRIADYPLMQSPFLVLGILLAYVYFVLSLGPRLMANRKPLNLKKFMVLYNFFLVGLSLYIVYEFLMAGWLTGYTWRCDPVDFSQDPKALRMVSVAWLFVFSKFIELTDTVIFVLRKKNEQVTFLHLFHHSVLPWSWWWGAKFGPGGMGSFHAMINSMVHVVMYFYYGLSAAGPAFQKYLWWKKHITAIQLAQFVIVSVHISQYYFMPSCQYQFPIFIHLIWIYGTIFFILFSNFWYQSYTKGKRLPRVAQQAAQHNGSSIHENGTVTNGKVKSN", "length": 308 }, "evidence": [ { "id": "A0A0B4KF65", "url": "https://omabrowser.org/oma/group/A0A0B4KF65/", "database": "OMA" } ], "glygen_name": "Chicken", "common_name": "Chicken" }, { "uniprot_canonical_ac": "Q9BW60-1", "protein_name": "Very long chain fatty acid elongase 1", "gene_name": "ELOVL1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEAVVNLYQEVMKHADPRIQGYPLMGSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLVALSLYIVYEFLMSGWLSTYTWRCDPVDYSNSPEALRMVRVAWLFLFSKFIELMDTVIFILRKKDGQVTFLHVFHHSVLPWSWWWGVKIAPGGMGSFHAMINSSVHVIMYLYYGLSAFGPVAQPYLWWKKHMTAIQLIQFVLVSLHISQYYFMSSCNYQYPVIIHLIWMYGTIFFMLFSNFWYHSYTKGKRLPRALQQNGAPGIAKVKAN", "length": 279 }, "evidence": [ { "id": "A0A0B4KF65", "url": "https://omabrowser.org/oma/group/A0A0B4KF65/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q9JLJ5-1", "protein_name": "Very long chain fatty acid elongase 1", "gene_name": "Elovl1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEAVVNLYHELMKHADPRIQSYPLMGSPLLITSILLTYVYFILSLGPRIMANRKPFQLRGFMIVYNFSLVILSLYIVYEFLMSGWLSTYTWRCDPIDFSNSPEALRMVRVAWLFMLSKVIELMDTVIFILRKKDGQVTFLHVFHHSVLPWSWWWGIKIAPGGMGSFHAMINSSVHVVMYLYYGLSALGPVAQPYLWWKKHMTAIQLIQFVLVSLHISQYYFMPSCNYQYPIIIHLIWMYGTIFFILFSNFWYHSYTKGKRLPRAVQQNGAPATTKVKAN", "length": 279 }, "evidence": [ { "id": "A0A0B4KF65", "url": "https://omabrowser.org/oma/group/A0A0B4KF65/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KF65", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "sphingolipid biosynthetic process", "id": "GO:0030148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030148", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KF65", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ], "pmid": "" }, { "name": "fatty acid elongation", "id": "GO:0030497", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030497", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KF65", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ], "pmid": "" }, { "name": "fatty acid elongation, monounsaturated fatty acid", "id": "GO:0034625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034625", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KF65", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ], "pmid": "" }, { "name": "fatty acid elongation, polyunsaturated fatty acid", "id": "GO:0034626", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034626", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KF65", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ], "pmid": "" }, { "name": "fatty acid elongation, saturated fatty acid", "id": "GO:0019367", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019367", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KF65", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ], "pmid": "" }, { "name": "very long-chain fatty acid biosynthetic process", "id": "GO:0042761", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042761", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KF65", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "fatty acid elongase activity", "id": "GO:0009922", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009922", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KF65", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 335, "end_pos": 337, "annotation": "n_glycosylation_sequon" }, { "start_pos": 358, "end_pos": 360, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "32727", "name": "", "equation": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A8JNR0-1", "Q9VHX7-1", "A0A0B4KF65-1", "A1ZBD2-1", "Q9VH58-1", "Q9VV87-1", "Q9VH59-1", "Q9VCT3-1", "Q6NN18-1", "Q4V3H4-1", "Q8IMY2-1", "Q9VCY6-1", "Q5JZZ4-1", "Q9VCY7-1", "Q95T98-1", "Q9VCY5-1", "Q9VH57-1", "Q8SXD1-1", "Q9VCZ0-1", "Q9VH55-1" ], "evidence": [ { "id": "32727", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/32727" } ] }, { "id": "R-DME-2046088", "name": "Elongation of stearidonoyl-CoA to eicosatetraenoyl-CoA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-2046052", "R-ALL-2046066" ], "output_participant_list": [ "R-ALL-162743", "R-ALL-2046051" ], "enzyme_list": [ "A0A0B4KF65-1", "A8JNR0-1", "Q5JZZ4-1", "Q9VV87-1" ], "evidence": [ { "id": "R-DME-2046088", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-2046088" } ] }, { "id": "R-DME-2046094", "name": "Elongation of gamma-lenolenoyl-CoA to dihomo-gamma-lenolenoyl-CoA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-2046042" ], "output_participant_list": [ "R-ALL-2046045" ], "enzyme_list": [ "A0A0B4KF65-1", "A8JNR0-1", "Q5JZZ4-1", "Q9VV87-1" ], "evidence": [ { "id": "R-DME-2046094", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-2046094" } ] }, { "id": "R-DME-548800", "name": "ELOVL1,2,3,5 elongate AA-CoA and Mal-CoA to 3ODCT-CoA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-548816" ], "enzyme_list": [ "A0A0B4KF65-1", "A8JNR0-1", "Q5JZZ4-1", "Q9VV87-1" ], "evidence": [ { "id": "R-DME-548800", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-548800" } ] }, { "id": "R-DME-548814", "name": "ELOVL3,6,7 elongate PALM-CoA and Mal-CoA to 3OOD-CoA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-548812" ], "enzyme_list": [ "Q9VCT3-1", "A0A0B4KF65-1", "Q8SXD1-1", "Q9VCY6-1", "Q9VH58-1", "Q9VV87-1", "Q9VH59-1", "A1ZBD2-1", "Q6NN18-1", "Q8IMY2-1", "Q9VCY7-1", "Q9VCZ0-1", "Q9VH55-1", "Q9VHX7-1", "Q4V3H4-1", "Q95T98-1", "Q9VCY5-1", "Q9VH57-1" ], "evidence": [ { "id": "R-DME-548814", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-548814" } ] }, { "id": "R-DME-548815", "name": "ELOVL7 elongates ICS-CoA and Mal-CoA to 3ODC-CoA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-548794" ], "output_participant_list": [ "R-ALL-548829" ], "enzyme_list": [ "Q9VCT3-1", "A0A0B4KF65-1", "Q8SXD1-1", "Q9VCY6-1", "Q9VH58-1", "Q9VH59-1", "A1ZBD2-1", "Q6NN18-1", "Q8IMY2-1", "Q9VCY7-1", "Q9VCZ0-1", "Q9VH55-1", "Q9VHX7-1", "Q4V3H4-1", "Q95T98-1", "Q9VCY5-1", "Q9VH57-1" ], "evidence": [ { "id": "R-DME-548815", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-548815" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-162743", "participant_name": "CoA-SH [endoplasmic reticulum lumen]", "crossref": [ { "id": "C00010", "database": "COMPOUND", "url": "" }, { "id": "57287", "database": "ChEBI", "url": "" }, { "id": "000008551087", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-2046042", "participant_name": "GLA-CoA [endoplasmic reticulum lumen]", "crossref": [ { "id": "15508", "database": "ChEBI", "url": "" }, { "id": "C03035", "database": "COMPOUND", "url": "" }, { "id": "HMDB0006368", "database": "HMDB Metabolite", "url": "" } ] }, { "participant_id": "R-ALL-2046045", "participant_name": "DGL-CoA [endoplasmic reticulum lumen]", "crossref": [ { "id": "27979", "database": "ChEBI", "url": "" }, { "id": "HMDB0003947", "database": "HMDB Metabolite", "url": "" }, { "id": "C03595", "database": "COMPOUND", "url": "" } ] }, { "participant_id": "R-ALL-2046051", "participant_name": "ETA-CoA [endoplasmic reticulum lumen]", "crossref": [ { "id": "63542", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-2046052", "participant_name": "SDA-CoA [endoplasmic reticulum lumen]", "crossref": [ { "id": "63545", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-2046066", "participant_name": "Malonyl-CoA [endoplasmic reticulum lumen]", "crossref": [ { "id": "C00083", "database": "COMPOUND", "url": "" }, { "id": "000008551112", "database": "ZINC", "url": "" }, { "id": "57384", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-548794", "participant_name": "ICS-CoA [cytosol]", "crossref": [ { "id": "57380", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-548812", "participant_name": "3OOD-CoA [cytosol]", "crossref": [ { "id": "71407", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-548816", "participant_name": "3ODCT-CoA [cytosol]", "crossref": [ { "id": "73852", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-548829", "participant_name": "3ODC-CoA [cytosol]", "crossref": [ { "id": "71451", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0B4KF65", "gene_name": "BcDNA:GH22993", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "A0A0B4KF65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "A0A0B4KF65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B4KF65" } ] } ] }, { "uniprot_ac": "A1ZBD2", "gene_name": "Dmel\\CG17821", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "A1ZBD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZBD2" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "A1ZBD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZBD2" } ] } ] }, { "uniprot_ac": "A8JNR0", "gene_name": "Elo68beta", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "A8JNR0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A8JNR0" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "A8JNR0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A8JNR0" } ] } ] }, { "uniprot_ac": "Q4V3H4", "gene_name": "Dmel\\CG9459", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q4V3H4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V3H4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q4V3H4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V3H4" } ] } ] }, { "uniprot_ac": "Q5JZZ4", "gene_name": "Elo68alpha", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q5JZZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5JZZ4" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q5JZZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5JZZ4" } ] } ] }, { "uniprot_ac": "Q6NN18", "gene_name": "CT42569", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q6NN18", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NN18" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q6NN18", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NN18" } ] } ] }, { "uniprot_ac": "Q8IMY2", "gene_name": "Dmel\\CG31141", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q8IMY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IMY2" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q8IMY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IMY2" } ] } ] }, { "uniprot_ac": "Q8SXD1", "gene_name": "CG12138", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q8SXD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SXD1" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q8SXD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SXD1" } ] } ] }, { "uniprot_ac": "Q95T98", "gene_name": "CG9798", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q95T98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q95T98" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q95T98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q95T98" } ] } ] }, { "uniprot_ac": "Q9VCT3", "gene_name": "Dmel\\CG6660", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VCT3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCT3" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VCT3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCT3" } ] } ] }, { "uniprot_ac": "Q9VCY5", "gene_name": "CG13844", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VCY5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY5" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VCY5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY5" } ] } ] }, { "uniprot_ac": "Q9VCY6", "gene_name": "sit", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VCY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY6" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VCY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY6" } ] } ] }, { "uniprot_ac": "Q9VCY7", "gene_name": "bond", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VCY7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY7" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VCY7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCY7" } ] } ] }, { "uniprot_ac": "Q9VCZ0", "gene_name": "Dmel\\CG5326", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VCZ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCZ0" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VCZ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCZ0" } ] } ] }, { "uniprot_ac": "Q9VH55", "gene_name": "CT26802", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VH55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH55" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VH55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH55" } ] } ] }, { "uniprot_ac": "Q9VH57", "gene_name": "Dmel\\CG16904", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VH57", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH57" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VH57", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH57" } ] } ] }, { "uniprot_ac": "Q9VH58", "gene_name": "eloF", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VH58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH58" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VH58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH58" } ] } ] }, { "uniprot_ac": "Q9VH59", "gene_name": "Dmel\\CG8534", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VH59", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH59" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VH59", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH59" } ] } ] }, { "uniprot_ac": "Q9VHX7", "gene_name": "Elovl7", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VHX7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHX7" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VHX7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHX7" } ] } ] }, { "uniprot_ac": "Q9VV87", "gene_name": "Baldspot", "activity": [ { "ec_number": "2.3.1.199", "activity": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "Q9VV87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VV87" } ] }, { "ec_number": "2.3.1.199", "activity": "", "evidence": [ { "id": "Q9VV87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VV87" } ] } ] } ], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A0B4KF65-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 392, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A0B4KF65-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [ { "ec_number": "2.3.1.199", "ec_name": "a very-long-chain acyl-CoA + H(+) + malonyl-CoA = a very-long-chain 3-oxoacyl-CoA + CO2 + CoA.", "evidence": [ { "id": "2.3.1.199", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/?query=ec:2.3.1.199" }, { "id": "2.3.1.199", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.3.1.199" } ] } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 329 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 335, "end_pos": 337 }, { "start_pos": 358, "end_pos": 360 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "prediction_tool", "mining_tool", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "prediction_tool", "mining_tool", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }