{ "uniprot_canonical_ac": "A0A096MKE2-1", "uniprot_ac": "A0A096MKE2", "uniprot_id": "A0A096MKE2_RAT", "mass": { "chemical_mass": 20895.0, "monoisotopic_mass": 20895.0 }, "refseq": {}, "gene_names": [ { "name": "Snx12", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A096MKE2", "id": "A0A096MKE2" } ], "protein_names": [ { "name": "Sorting nexin 12", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A096MKE2/entry#names_and_taxonomy", "id": "A0A096MKE2" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A096MKE2", "url": "https://www.uniprot.org/uniprot/A0A096MKE2" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "gene": [ { "name": "Snx12", "url": "https://www.uniprot.org/uniprot/A0A096MKE2", "locus": { "chromosome": "X", "start_pos": 66227053, "end_pos": 66356950, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000004036", "url": "https://www.ensembl.org/id/ENSRNOG00000004036" } ] } } ], "crossref": [ { "id": "A0A096MKE2", "url": "https://alphafold.ebi.ac.uk/entry/A0A096MKE2", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSRNOG00000004036", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000004036", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd07294", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07294", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR001683", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001683", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036871", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036871", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR051074", "url": "https://www.ebi.ac.uk/interpro/entry/IPR051074", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "NMYTDYE", "url": "https://omabrowser.org/oma/group/NMYTDYE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "D4A719", "url": "https://www.orthodb.org/?gene=D4A719", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR45963", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45963", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45963:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45963:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00787", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00787", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "1565585", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1565585", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A096MJN6", "url": "https://www.uniprot.org/uniprot/A0A096MJN6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A096MJN6-1", "url": "https://www.uniprot.org/uniprot/A0A096MJN6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A096MKE2", "url": "https://www.uniprot.org/uniprot/A0A096MKE2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A096MKE2-1", "url": "https://www.uniprot.org/uniprot/A0A096MKE2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D4A719", "url": "https://www.uniprot.org/uniprot/D4A719", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D4A719-1", "url": "https://www.uniprot.org/uniprot/D4A719-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKMNAVYTCSCKRRQLIGTTSLGRCASRSPSHHLPSTFPAEMTLVFTLSLSLFLI", "length": 182, "header": "tr|A0A096MKE2-1|A0A096MKE2_RAT Isoform 1 of Sorting nexin 12 OS=Rattus norvegicus OX=10116 GN=Snx12 PE=1 SV=2 CANONICAL=A0A096MKE2-1" }, "isoforms": [ { "isoform_ac": "A0A096MJN6-1", "url": "https://www.uniprot.org/uniprotkb/A0A096MKE2/entry#A0A096MJN6-1", "sequence": { "sequence": "MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYETNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKVLGLHWLLSMR", "length": 166, "header": "tr|A0A096MJN6-1|A0A096MKE2_RAT Computationally mapped isoform of Sorting nexin 12 OS=Rattus norvegicus OX=10116 GN=Snx12 PE=1 SV=1 CANONICAL=A0A096MKE2-1" }, "locus": { "chromosome": "X", "start_pos": 66356821, "end_pos": 66231280, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000076635.3", "url": "https://www.ensembl.org/id/ENSRNOT00000076635.3" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000068200.2", "url": "https://www.ensembl.org/id/ENSRNOP00000068200.2" } ] } }, { "isoform_ac": "A0A096MKE2-1", "url": "https://www.uniprot.org/uniprotkb/A0A096MKE2/entry#A0A096MKE2-1", "sequence": { "sequence": "MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKMNAVYTCSCKRRQLIGTTSLGRCASRSPSHHLPSTFPAEMTLVFTLSLSLFLI", "length": 182, "header": "tr|A0A096MKE2-1|A0A096MKE2_RAT Isoform 1 of Sorting nexin 12 OS=Rattus norvegicus OX=10116 GN=Snx12 PE=1 SV=2 CANONICAL=A0A096MKE2-1" }, "locus": { "chromosome": "X", "start_pos": 66356821, "end_pos": 66348795, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000076403.2", "url": "https://www.ensembl.org/id/ENSRNOT00000076403.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000068481.2", "url": "https://www.ensembl.org/id/ENSRNOP00000068481.2" } ] } }, { "isoform_ac": "D4A719-1", "url": "https://www.uniprot.org/uniprotkb/A0A096MKE2/entry#D4A719-1", "sequence": { "sequence": "MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKASLELPLWFDC", "length": 170, "header": "tr|D4A719-1|A0A096MKE2_RAT Computationally mapped isoform of Sorting nexin 12 OS=Rattus norvegicus OX=10116 GN=Snx12 PE=1 SV=2 CANONICAL=A0A096MKE2-1" }, "locus": { "chromosome": "X", "start_pos": 66356821, "end_pos": 66341830, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000068098.4", "url": "https://www.ensembl.org/id/ENSRNOT00000068098.4" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000061412.2", "url": "https://www.ensembl.org/id/ENSRNOP00000061412.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Quantitative phosphoproteomics of vasopressin-sensitive renal cells: regulation of aquaporin-2 phosphorylation at two sites.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2006", "authors": "Hoffert JD, Pisitkun T, Wang G, Shen RF, Knepper MA", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJN6", "url": "https://www.uniprot.org/uniprot/A0A096MJN6" } ], "reference": [ { "type": "PubMed", "id": "16641100", "url": "https://glygen.org/publication/PubMed/16641100" } ] }, { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nat. Commun.", "date": "2012", "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJN6", "url": "https://www.uniprot.org/uniprot/A0A096MJN6" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] } ], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "A0A8V0Z7L2-1", "protein_name": "Sorting nexin 12", "gene_name": "SNX12", "tax_id": 9031, "organism": "Gallus gallus", "sequence": { "sequence": "MSEAAVADTRRLNAKPQDLTDAYGPPSNFLEIDIFNPQTVGMGRARYTSYELRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKMSAAYICSCKRRLLIGITSQGKCASRSTWHCLPPFHPPSCKNDIYFYTKSVFSEPAFPLLNLPVCSVFSSFVTGSSLFFWAVVLA", "length": 214 }, "evidence": [ { "id": "A0A096MKE2", "url": "https://omabrowser.org/oma/group/A0A096MKE2/", "database": "OMA" } ], "glygen_name": "Chicken", "common_name": "Chicken" }, { "uniprot_canonical_ac": "A0AAA9SQ30-1", "protein_name": "Sorting nexin 12", "gene_name": "SNX12", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKVYLL", "length": 163 }, "evidence": [ { "id": "A0A096MKE2", "url": "https://omabrowser.org/oma/group/A0A096MKE2/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "O70493-1", "protein_name": "Sorting nexin-12", "gene_name": "Snx12", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRHPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVAGKVLGEKDC", "length": 165 }, "evidence": [ { "id": "A0A096MKE2", "url": "https://omabrowser.org/oma/group/A0A096MKE2/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q08826-1", "protein_name": "Sorting nexin-3", "gene_name": "SNX3", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MPREFKSFGSTEKSLLSKGHGEPSYSEIYAEPENFLEIEVHNPKTHIPNGMDSKGMFTDYEIICRTNLPSFHKRVSKVRRRYSDFEFFRKCLIKEISMLNHPKVMVPHLPGKILLSNRFSNEVIEERRQGLNTWMQSVAGHPLLQSGSKVLVRFIEAEKFVG", "length": 162 }, "evidence": [ { "id": "A0A096MKE2", "url": "https://omabrowser.org/oma/group/A0A096MKE2/", "database": "OMA" } ], "glygen_name": "Yeast", "common_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q9UMY4-2", "protein_name": "Sorting nexin-12", "gene_name": "SNX12", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKVRQ", "length": 162 }, "evidence": [ { "id": "A0A096MKE2", "url": "https://omabrowser.org/oma/group/A0A096MKE2/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q9VG51-1", "protein_name": "Sorting nexin 3, isoform A", "gene_name": "Snx3", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MMVESDGTADATRRLNVKKQTLDDAYAVPANFLEIDVVNPLTTMAAGKKRYTDYEVRMRTNLPVFKVKESSVRRRYSDFEWLRNELERDSKIVVPPLPGKAWKRQMPFRGDEGIFDESFIEERRKGLEAFINKIAGHPLAQNERCLHMFLQENVIDKNYVPGKIRNT", "length": 167 }, "evidence": [ { "id": "A0A096MKE2", "url": "https://omabrowser.org/oma/group/A0A096MKE2/", "database": "OMA" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "early endosome", "id": "GO:0005769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005769", "evidence": [ { "database": "UniProtKB", "id": "A0A096MKE2", "url": "https://www.uniprot.org/uniprot/A0A096MKE2" } ], "pmid": "" }, { "name": "early endosome membrane", "id": "GO:0031901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031901", "evidence": [ { "database": "UniProtKB", "id": "A0A096MKE2", "url": "https://www.uniprot.org/uniprot/A0A096MKE2" } ], "pmid": "" }, { "name": "retromer complex", "id": "GO:0030904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030904", "evidence": [ { "database": "UniProtKB", "id": "A0A096MKE2", "url": "https://www.uniprot.org/uniprot/A0A096MKE2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "negative regulation of gene expression", "id": "GO:0010629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010629", "evidence": [ { "database": "UniProtKB", "id": "A0A096MKE2", "url": "https://www.uniprot.org/uniprot/A0A096MKE2" } ], "pmid": "" }, { "name": "regulation of endocytosis", "id": "GO:0030100", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030100", "evidence": [ { "database": "UniProtKB", "id": "A0A096MKE2", "url": "https://www.uniprot.org/uniprot/A0A096MKE2" } ], "pmid": "" }, { "name": "negative regulation of protein catabolic process", "id": "GO:0042177", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042177", "evidence": [ { "database": "UniProtKB", "id": "A0A096MKE2", "url": "https://www.uniprot.org/uniprot/A0A096MKE2" } ], "pmid": "" }, { "name": "endocytic recycling", "id": "GO:0032456", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032456", "evidence": [ { "database": "UniProtKB", "id": "A0A096MKE2", "url": "https://www.uniprot.org/uniprot/A0A096MKE2" } ], "pmid": "" }, { "name": "negative regulation of early endosome to late endosome transport", "id": "GO:2000642", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000642", "evidence": [ { "database": "UniProtKB", "id": "A0A096MKE2", "url": "https://www.uniprot.org/uniprot/A0A096MKE2" } ], "pmid": "" }, { "name": "negative regulation of protein processing", "id": "GO:0010955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010955", "evidence": [ { "database": "UniProtKB", "id": "A0A096MKE2", "url": "https://www.uniprot.org/uniprot/A0A096MKE2" } ], "pmid": "" }, { "name": "late endosome to Golgi transport", "id": "GO:0034499", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034499", "evidence": [ { "database": "UniProtKB", "id": "A0A096MKE2", "url": "https://www.uniprot.org/uniprot/A0A096MKE2" } ], "pmid": "" }, { "name": "negative regulation of protein transport", "id": "GO:0051224", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051224", "evidence": [ { "database": "UniProtKB", "id": "A0A096MKE2", "url": "https://www.uniprot.org/uniprot/A0A096MKE2" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "A0A096MKE2", "url": "https://www.uniprot.org/uniprot/A0A096MKE2" } ], "pmid": "" }, { "name": "phosphatidylinositol-3-phosphate binding", "id": "GO:0032266", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032266", "evidence": [ { "database": "UniProtKB", "id": "A0A096MKE2", "url": "https://www.uniprot.org/uniprot/A0A096MKE2" } ], "pmid": "" }, { "name": "phosphatidylinositol binding", "id": "GO:0035091", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035091", "evidence": [ { "database": "UniProtKB", "id": "A0A096MKE2", "url": "https://www.uniprot.org/uniprot/A0A096MKE2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A096MKE2-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 182, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A096MKE2-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }