{ "uniprot_canonical_ac": "A0A096MJ99-1", "uniprot_ac": "A0A096MJ99", "uniprot_id": "A0A096MJ99_RAT", "mass": { "chemical_mass": 15625.0, "monoisotopic_mass": 15625.0 }, "refseq": {}, "gene_names": [ { "name": "Vamp4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A096MJ99", "id": "A0A096MJ99" } ], "protein_names": [ { "name": "Vesicle-associated membrane protein 4", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A096MJ99/entry#names_and_taxonomy", "id": "A0A096MJ99" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A096MJ99", "url": "https://www.uniprot.org/uniprot/A0A096MJ99" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "gene": [ { "name": "Vamp4", "url": "https://www.uniprot.org/uniprot/A0A096MJ99", "locus": { "chromosome": "13", "start_pos": 74933686, "end_pos": 74919880, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000003071", "url": "https://www.ensembl.org/id/ENSRNOG00000003071" } ] } } ], "crossref": [ { "id": "A0A096MJ99", "url": "https://alphafold.ebi.ac.uk/entry/A0A096MJ99", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSRNOG00000003071", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000003071", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd15869", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15869", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR001388", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001388", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042855", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042855", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042887", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042887", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "CKMRLLL", "url": "https://omabrowser.org/oma/group/CKMRLLL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A096MJ99", "url": "https://www.orthodb.org/?gene=A0A096MJ99", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR46897", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46897", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46897:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46897:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00957", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00957", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6811440", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-8856825", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8856825", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-8856828", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8856828", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "1309753", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1309753", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A096MJ99", "url": "https://www.uniprot.org/uniprot/A0A096MJ99", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A096MJ99-1", "url": "https://www.uniprot.org/uniprot/A0A096MJ99-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A096MK21", "url": "https://www.uniprot.org/uniprot/A0A096MK21", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A096MK21-1", "url": "https://www.uniprot.org/uniprot/A0A096MK21-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKGVLALSMRVPMLSVSQHLDA", "length": 135, "header": "tr|A0A096MJ99-1|A0A096MJ99_RAT Isoform 1 of Vesicle-associated membrane protein 4 OS=Rattus norvegicus OX=10116 GN=Vamp4 PE=1 SV=2 CANONICAL=A0A096MJ99-1" }, "isoforms": [ { "isoform_ac": "A0A096MJ99-1", "url": "https://www.uniprot.org/uniprotkb/A0A096MJ99/entry#A0A096MJ99-1", "sequence": { "sequence": "MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKGVLALSMRVPMLSVSQHLDA", "length": 135, "header": "tr|A0A096MJ99-1|A0A096MJ99_RAT Isoform 1 of Vesicle-associated membrane protein 4 OS=Rattus norvegicus OX=10116 GN=Vamp4 PE=1 SV=2 CANONICAL=A0A096MJ99-1" }, "locus": { "chromosome": "13", "start_pos": 74933683, "end_pos": 74923573, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000076922.3", "url": "https://www.ensembl.org/id/ENSRNOT00000076922.3" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000068049.2", "url": "https://www.ensembl.org/id/ENSRNOP00000068049.2" } ] } }, { "isoform_ac": "A0A096MK21-1", "url": "https://www.uniprot.org/uniprotkb/A0A096MJ99/entry#A0A096MK21-1", "sequence": { "sequence": "MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLCVLSPARSLILVNP", "length": 52, "header": "tr|A0A096MK21-1|A0A096MK21_RAT Computationally mapped isoform of Vesicle-associated membrane protein 4 OS=Rattus norvegicus OX=10116 GN=Vamp4 PE=1 SV=1 CANONICAL=A0A096MJ99-1" }, "locus": { "chromosome": "13", "start_pos": 74926156, "end_pos": 74923573, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000076324.2", "url": "https://www.ensembl.org/id/ENSRNOT00000076324.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000068349.1", "url": "https://www.ensembl.org/id/ENSRNOP00000068349.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nat. Commun.", "date": "2012", "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJ99", "url": "https://www.uniprot.org/uniprot/A0A096MJ99" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] } ], "pathway": [ { "id": "R-RNO-6811440", "name": "Retrograde transport at the Trans-Golgi-Network", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6811440", "resource": "Reactome", "description": "Retrograde transport at the Trans-Golgi-Network" }, { "id": "R-RNO-8856825", "name": "Cargo recognition for clathrin-mediated endocytosis", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8856825", "resource": "Reactome", "description": "Cargo recognition for clathrin-mediated endocytosis" }, { "id": "R-RNO-8856828", "name": "Clathrin-mediated endocytosis", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8856828", "resource": "Reactome", "description": "Clathrin-mediated endocytosis" } ], "orthologs": [ { "uniprot_canonical_ac": "O70480-1", "protein_name": "Vesicle-associated membrane protein 4", "gene_name": "Vamp4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALAAAILLLMIIILIVVKFRT", "length": 141 }, "evidence": [ { "id": "A0A096MJ99", "url": "https://omabrowser.org/oma/group/A0A096MJ99/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "O75379-1", "protein_name": "Vesicle-associated membrane protein 4", "gene_name": "VAMP4", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRT", "length": 141 }, "evidence": [ { "id": "A0A096MJ99", "url": "https://omabrowser.org/oma/group/A0A096MJ99/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q32L97-1", "protein_name": "Vesicle-associated membrane protein 4", "gene_name": "VAMP4", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAVILLLVIIILIVVKYRT", "length": 141 }, "evidence": [ { "id": "A0A096MJ99", "url": "https://omabrowser.org/oma/group/A0A096MJ99/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "glutamatergic synapse", "id": "GO:0098978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098978", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJ99", "url": "https://www.uniprot.org/uniprot/A0A096MJ99" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJ99", "url": "https://www.uniprot.org/uniprot/A0A096MJ99" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJ99", "url": "https://www.uniprot.org/uniprot/A0A096MJ99" } ], "pmid": "" }, { "name": "phagocytic vesicle", "id": "GO:0045335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045335", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJ99", "url": "https://www.uniprot.org/uniprot/A0A096MJ99" } ], "pmid": "" }, { "name": "trans-Golgi network", "id": "GO:0005802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005802", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJ99", "url": "https://www.uniprot.org/uniprot/A0A096MJ99" } ], "pmid": "" }, { "name": "SNARE complex", "id": "GO:0031201", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031201", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJ99", "url": "https://www.uniprot.org/uniprot/A0A096MJ99" } ], "pmid": "" }, { "name": "presynaptic endosome membrane", "id": "GO:0098954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098954", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJ99", "url": "https://www.uniprot.org/uniprot/A0A096MJ99" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 10, "go_terms": [ { "name": "regulation of Golgi to plasma membrane protein transport", "id": "GO:0042996", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042996", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJ99", "url": "https://www.uniprot.org/uniprot/A0A096MJ99" } ], "pmid": "" }, { "name": "neurotransmitter receptor transport, endosome to postsynaptic membrane", "id": "GO:0098887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098887", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJ99", "url": "https://www.uniprot.org/uniprot/A0A096MJ99" } ], "pmid": "" }, { "name": "Golgi to plasma membrane protein transport", "id": "GO:0043001", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043001", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJ99", "url": "https://www.uniprot.org/uniprot/A0A096MJ99" } ], "pmid": "" }, { "name": "cellular response to type II interferon", "id": "GO:0071346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071346", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJ99", "url": "https://www.uniprot.org/uniprot/A0A096MJ99" } ], "pmid": "" }, { "name": "Golgi ribbon formation", "id": "GO:0090161", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090161", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJ99", "url": "https://www.uniprot.org/uniprot/A0A096MJ99" } ], "pmid": "" }, { "name": "endocytic recycling", "id": "GO:0032456", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032456", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJ99", "url": "https://www.uniprot.org/uniprot/A0A096MJ99" } ], "pmid": "" }, { "name": "SNARE complex assembly", "id": "GO:0035493", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035493", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJ99", "url": "https://www.uniprot.org/uniprot/A0A096MJ99" } ], "pmid": "" }, { "name": "synaptic vesicle to endosome fusion", "id": "GO:0016189", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016189", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJ99", "url": "https://www.uniprot.org/uniprot/A0A096MJ99" } ], "pmid": "" }, { "name": "regulation of synaptic vesicle endocytosis", "id": "GO:1900242", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900242", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJ99", "url": "https://www.uniprot.org/uniprot/A0A096MJ99" } ], "pmid": "" }, { "name": "vesicle-mediated transport in synapse", "id": "GO:0099003", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099003", "evidence": [ { "database": "UniProtKB", "id": "A0A096MJ99", "url": "https://www.uniprot.org/uniprot/A0A096MJ99" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 100, "end_pos": 102, "annotation": "n_glycosylation_sequon" }, { "start_pos": 70, "end_pos": 72, "annotation": "n_glycosylation_sequon" }, { "start_pos": 94, "end_pos": 96, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A096MJ99-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 135, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A096MJ99-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 100, "end_pos": 102 }, { "start_pos": 70, "end_pos": 72 }, { "start_pos": 94, "end_pos": 96 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }