{ "uniprot_canonical_ac": "A0A087WW49-1", "uniprot_ac": "A0A087WW49", "uniprot_id": "A0A087WW49_HUMAN", "mass": { "chemical_mass": 12944.0, "monoisotopic_mass": 12944.0 }, "refseq": {}, "gene_names": [ { "name": "LOC102724971", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A087WW49", "id": "A0A087WW49" } ], "protein_names": [ { "name": "Ig-like domain-containing protein", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A087WW49/entry#names_and_taxonomy", "id": "A0A087WW49" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A0A087WW49", "url": "https://www.uniprot.org/uniprot/A0A087WW49" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "gene": [ { "name": "LOC102724971", "url": "https://www.uniprot.org/uniprot/A0A087WW49", "locus": { "chromosome": "HG2365_PATCH", "start_pos": 2331526, "end_pos": 2331959, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000288413", "url": "https://www.ensembl.org/id/ENSG00000288413" } ] } } ], "crossref": [ { "id": "A0A087WW49", "url": "https://alphafold.ebi.ac.uk/entry/A0A087WW49", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSG00000278263", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000278263", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "ENSG00000278263", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ENSG00000278263", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050199", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050199", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "WMGRISS", "url": "https://omabrowser.org/oma/group/WMGRISS/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR23266", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23266", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23266:SF387", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23266:SF387", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A0A087WW49", "url": "https://www.uniprot.org/uniprot/A0A087WW49", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WW49-1", "url": "https://www.uniprot.org/uniprot/A0A087WW49-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSETLSLTCVVSGGSISSSNWWSWVRQPPGKGLEWIGEIYHSGSPNYNPSLKSRVTISVDKSKNQFSLKLSSVTAADTAVYYCAR", "length": 117, "header": "tr|A0A087WW49-1|A0A087WW49_HUMAN Isoform 1 of Ig-like domain-containing protein OS=Homo sapiens OX=9606 GN=LOC102724971 PE=4 SV=1 CANONICAL=A0A087WW49-1" }, "isoforms": [ { "isoform_ac": "A0A087WW49-1", "url": "https://www.uniprot.org/uniprotkb/A0A087WW49/entry#A0A087WW49-1", "sequence": { "sequence": "MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSETLSLTCVVSGGSISSSNWWSWVRQPPGKGLEWIGEIYHSGSPNYNPSLKSRVTISVDKSKNQFSLKLSSVTAADTAVYYCAR", "length": 117, "header": "tr|A0A087WW49-1|A0A087WW49_HUMAN Isoform 1 of Ig-like domain-containing protein OS=Homo sapiens OX=9606 GN=LOC102724971 PE=4 SV=1 CANONICAL=A0A087WW49-1" }, "locus": { "chromosome": "HG2365_PATCH", "start_pos": 2331959, "end_pos": 2331526, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000672082.1", "url": "https://www.ensembl.org/id/ENST00000672082.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000500772.1", "url": "https://www.ensembl.org/id/ENSP00000500772.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "A0A087WW49", "url": "https://www.uniprot.org/uniprot/A0A087WW49" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0A087WW49", "url": "https://www.uniprot.org/uniprot/A0A087WW49" } ], "pmid": "" }, { "name": "immunoglobulin complex", "id": "GO:0019814", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019814", "evidence": [ { "database": "UniProtKB", "id": "A0A087WW49", "url": "https://www.uniprot.org/uniprot/A0A087WW49" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "antigen binding", "id": "GO:0003823", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003823", "evidence": [ { "database": "UniProtKB", "id": "A0A087WW49", "url": "https://www.uniprot.org/uniprot/A0A087WW49" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "immunoglobulin mediated immune response", "id": "GO:0016064", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016064", "evidence": [ { "database": "UniProtKB", "id": "A0A087WW49", "url": "https://www.uniprot.org/uniprot/A0A087WW49" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A087WW49-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 117, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A087WW49-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }