{ "uniprot_canonical_ac": "A0A075B5R4-1", "uniprot_ac": "A0A075B5R4", "uniprot_id": "A0A075B5R4_MOUSE", "mass": { "chemical_mass": 12992.0, "monoisotopic_mass": 12992.0 }, "refseq": {}, "gene_names": [ { "name": "Ighv14-1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A075B5R4", "id": "A0A075B5R4" } ], "protein_names": [ { "name": "Immunoglobulin heavy variable 14-1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A075B5R4/entry#names_and_taxonomy", "id": "A0A075B5R4" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A075B5R4", "url": "https://www.uniprot.org/uniprot/A0A075B5R4" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "gene": [ { "name": "Ighv14-1", "url": "https://www.uniprot.org/uniprot/A0A075B5R4", "locus": { "chromosome": "12", "start_pos": 113895573, "end_pos": 113896002, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000094509", "url": "https://www.ensembl.org/id/ENSMUSG00000094509" } ] } } ], "crossref": [ { "id": "A0A075B5R4", "url": "https://alphafold.ebi.ac.uk/entry/A0A075B5R4", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSMUSG00000094509", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000094509", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050199", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050199", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "4439920", "url": "http://www.informatics.jax.org/marker/MGI:4439920", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "CAMHSVE", "url": "https://omabrowser.org/oma/group/CAMHSVE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR23266", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23266", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23266:SF394", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23266:SF394", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A0A075B5R4", "url": "https://www.uniprot.org/uniprot/A0A075B5R4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A075B5R4-1", "url": "https://www.uniprot.org/uniprot/A0A075B5R4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKCSWVIFFLMAVVTGVNSEVQLQQSGAELVRPGASVKLSCTASGFNIKDYYMHWVKQRPEQGLEWIGRIDPEDGDTEYAPKFQGKATMTADTSSNTAYLQLSSLTSEDTAVYYCTT", "length": 117, "header": "tr|A0A075B5R4-1|A0A075B5R4_MOUSE Isoform 1 of Immunoglobulin heavy variable 14-1 OS=Mus musculus OX=10090 GN=Ighv14-1 PE=1 SV=1 CANONICAL=A0A075B5R4-1" }, "isoforms": [ { "isoform_ac": "A0A075B5R4-1", "url": "https://www.uniprot.org/uniprotkb/A0A075B5R4/entry#A0A075B5R4-1", "sequence": { "sequence": "MKCSWVIFFLMAVVTGVNSEVQLQQSGAELVRPGASVKLSCTASGFNIKDYYMHWVKQRPEQGLEWIGRIDPEDGDTEYAPKFQGKATMTADTSSNTAYLQLSSLTSEDTAVYYCTT", "length": 117, "header": "tr|A0A075B5R4-1|A0A075B5R4_MOUSE Isoform 1 of Immunoglobulin heavy variable 14-1 OS=Mus musculus OX=10090 GN=Ighv14-1 PE=1 SV=1 CANONICAL=A0A075B5R4-1" }, "locus": { "chromosome": "12", "start_pos": 113896002, "end_pos": 113895573, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000103463.3", "url": "https://www.ensembl.org/id/ENSMUST00000103463.3" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000100244.3", "url": "https://www.ensembl.org/id/ENSMUSP00000100244.3" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool": "", "mining_tool": "", "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "36064721", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36064721" }, { "id": "A0A075B5R4", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A0A075B5R4" } ], "filter_code": "00000000000000000000.0000000.00000001000000.1000000.0100000000.10010000111101.00000.01000" } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "O-GlcNAcylation enhances CPS1 catalytic efficiency for ammonia and promotes ureagenesis.", "journal": "Nature communications", "date": "2022", "authors": "Soria LR, Makris G, D'Alessio AM, De Angelis A, Boffa I, Pravata VM, Rufenacht V, Attanasio S, Nusco E, Arena P, Ferenbach AT, Paris D, Cuomo P, Motta A, Nitzahn M, Lipshutz GS, Martinez-Pizarro A, Richard E, Desviat LR, Haberle J, van Aalten DMF, Brunetti-Pierri N", "evidence": [ { "database": "O-GlcNAc Database", "id": "A0A075B5R4", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A0A075B5R4" } ], "reference": [ { "type": "PubMed", "id": "36064721", "url": "https://glygen.org/publication/PubMed/36064721" } ] } ], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "A0A8I6A2J1-1", "protein_name": "Ig-like domain-containing protein", "gene_name": "ENSRNOG00000064886", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MHTKQKHLSTVFSTVVIHKIFIMKCSWIILFLMALTTGVNSEVQLQQYGAELGKPGTSVKLSCKVSGYNIRSTYMHWVNQRPGKGLEWIGRIDPANGNTIYAEKFKSKATLTADTSSNTAYMQLSQLKSDDTAIYFCAMHSVESTS", "length": 146 }, "evidence": [ { "id": "A0A075B5R4", "url": "https://omabrowser.org/oma/group/A0A075B5R4/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "antigen binding", "id": "GO:0003823", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003823", "evidence": [ { "database": "UniProtKB", "id": "A0A075B5R4", "url": "https://www.uniprot.org/uniprot/A0A075B5R4" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "immunoglobulin mediated immune response", "id": "GO:0016064", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016064", "evidence": [ { "database": "UniProtKB", "id": "A0A075B5R4", "url": "https://www.uniprot.org/uniprot/A0A075B5R4" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "immunoglobulin complex", "id": "GO:0019814", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019814", "evidence": [ { "database": "UniProtKB", "id": "A0A075B5R4", "url": "https://www.uniprot.org/uniprot/A0A075B5R4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A075B5R4-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 117, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A075B5R4-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "prediction_tool", "mining_tool", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "prediction_tool", "mining_tool", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }