{ "uniprot_canonical_ac": "A0A075B5M7-1", "uniprot_ac": "A0A075B5M7", "uniprot_id": "A0A075B5M7_MOUSE", "mass": { "chemical_mass": 10345.0, "monoisotopic_mass": 10345.0 }, "refseq": {}, "gene_names": [ { "name": "Igkv5-39", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A075B5M7", "id": "A0A075B5M7" } ], "protein_names": [ { "name": "Immunoglobulin kappa variable 5-39", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A075B5M7/entry#names_and_taxonomy", "id": "A0A075B5M7" } ], "function": [], "disease": [], "snv": [ { "evidence": [ { "id": "rs3388820710", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388820710" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 14, "end_pos": 14, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "6", "chr_pos": "69877654", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T14", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A075B5M7", "url": "https://www.uniprot.org/uniprot/A0A075B5M7" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "gene": [ { "name": "Igkv5-39", "url": "https://www.uniprot.org/uniprot/A0A075B5M7", "locus": { "chromosome": "6", "start_pos": 69877408, "end_pos": 69877961, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000076569", "url": "https://www.ensembl.org/id/ENSMUSG00000076569" } ] } } ], "crossref": [ { "id": "A0A075B5M7", "url": "https://alphafold.ebi.ac.uk/entry/A0A075B5M7", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSMUSG00000076569", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000076569", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR003598", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003598", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050150", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050150", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "2686255", "url": "http://www.informatics.jax.org/marker/MGI:2686255", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "SASRCDI", "url": "https://omabrowser.org/oma/group/SASRCDI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR23267", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23267", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23267:SF217", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23267:SF217", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A0A075B5M7", "url": "https://www.uniprot.org/uniprot/A0A075B5M7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A075B5M7-1", "url": "https://www.uniprot.org/uniprot/A0A075B5M7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JDV4", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JDV4-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "DIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGSDFTLSINSVEPEDVGVYYCQNGHSFP", "length": 95, "header": "tr|A0A075B5M7-1|A0A075B5M7_MOUSE Isoform 1 of Immunoglobulin kappa variable 5-39 OS=Mus musculus OX=10090 GN=Igkv5-39 PE=1 SV=7 CANONICAL=A0A075B5M7-1" }, "isoforms": [ { "isoform_ac": "A0A075B5M7-1", "url": "https://www.uniprot.org/uniprotkb/A0A075B5M7/entry#A0A075B5M7-1", "sequence": { "sequence": "DIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGSDFTLSINSVEPEDVGVYYCQNGHSFP", "length": 95, "header": "tr|A0A075B5M7-1|A0A075B5M7_MOUSE Isoform 1 of Immunoglobulin kappa variable 5-39 OS=Mus musculus OX=10090 GN=Igkv5-39 PE=1 SV=7 CANONICAL=A0A075B5M7-1" }, "locus": { "chromosome": "6", "start_pos": 69877694, "end_pos": 69877410, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000103370.3", "url": "https://www.ensembl.org/id/ENSMUST00000103370.3" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000100171.3", "url": "https://www.ensembl.org/id/ENSMUSP00000100171.3" } ] } }, { "isoform_ac": "A0A0G2JDV4-1", "url": "https://www.uniprot.org/uniprotkb/A0A075B5M7/entry#A0A0G2JDV4-1", "sequence": { "sequence": "MVSTSQLLGLLLFWTSASRCDIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGSDFTLSINSVEPEDVGVYYCQNGHSFP", "length": 115, "header": "tr|A0A0G2JDV4-1|A0A075B5M7_MOUSE Computationally mapped isoform of Immunoglobulin kappa variable 5-39 OS=Mus musculus OX=10090 GN=Igkv5-39 PE=1 SV=4 CANONICAL=A0A075B5M7-1" }, "locus": { "chromosome": "6", "start_pos": 69877961, "end_pos": 69877410, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000197290.2", "url": "https://www.ensembl.org/id/ENSMUST00000197290.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000142521.2", "url": "https://www.ensembl.org/id/ENSMUSP00000142521.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool": "isoglyp", "mining_tool": "", "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "start_pos": 14, "start_aa": "T", "end_pos": 14, "end_aa": "T", "residue": "Thr", "site_lbl": "Thr14", "evidence": [ { "id": "GLY_001153", "database": "GlyGen", "url": "https://data.glygen.org/GLY_001153" } ], "filter_code": "00000000000000001000.00000000001000.1.01001" } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "A0A0C4DH26-1", "protein_name": "Probable non-functional immunoglobulin kappa variable 6D-41", "gene_name": "IGKV6D-41", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MVSPLQFLRLLLLWVPASRGDVVMTQSPAFLSVTPGEKVTITCQASEGIGNYLYWYQQKPDQAPKLLIKYASQSISGVPSRFSGSGSGTDFTFTISSLEAEDAATYYCQQGNKHP", "length": 115 }, "evidence": [ { "id": "A0A075B5M7", "url": "https://omabrowser.org/oma/group/A0A075B5M7/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "A0A075B5M7", "url": "https://www.uniprot.org/uniprot/A0A075B5M7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "immune response", "id": "GO:0006955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955", "evidence": [ { "database": "UniProtKB", "id": "A0A075B5M7", "url": "https://www.uniprot.org/uniprot/A0A075B5M7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A075B5M7-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 95, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A075B5M7-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 14 ], "snv_sites": [ 14 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "prediction_tool", "mining_tool", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "prediction_tool", "mining_tool", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }