{ "uniprot_canonical_ac": "A0A0G2JZP9-1", "uniprot_ac": "A0A0G2JZP9", "uniprot_id": "A0A0G2JZP9_RAT", "mass": { "chemical_mass": 17444.0, "monoisotopic_mass": 17444.0 }, "refseq": { "ac": "NP_001258153", "name": "RING finger protein 11", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258153" }, "gene_names": [ { "name": "Rnf11", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9", "id": "A0A0G2JZP9" }, { "name": "Rnf11l1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258153", "id": "NP_001258153" }, { "name": "Rnf11l1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9", "id": "A0A0G2JZP9" }, { "name": "Rnf11", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258153", "id": "NP_001258153" } ], "protein_names": [ { "name": "RING finger protein 11", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258153", "id": "NP_001258153" }, { "name": "Ring finger protein 11", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0G2JZP9/entry#names_and_taxonomy", "id": "A0A0G2JZP9" }, { "name": "ring finger protein 1; ring finger protein 11-like 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258153", "id": "NP_001258153" } ], "function": [ { "annotation": "Our findings demonstrate that RNF11 in neurons can modulate susceptibility to 6-OHDA toxicity through NF-kappaB mediated responses", "evidence": [ { "database": "RefSeq", "id": "NP_001258153", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258153" }, { "database": "PubMed", "id": "23318928", "url": "https://glygen.org/publication/PubMed/23318928" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZP9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "gene": [ { "name": "Rnf11", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9", "locus": { "chromosome": "5", "start_pos": 124212445, "end_pos": 124234750, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000057589", "url": "https://www.ensembl.org/id/ENSRNOG00000057589" } ] } } ], "crossref": [ { "id": "A0A0G2JZP9", "url": "https://alphafold.ebi.ac.uk/entry/A0A0G2JZP9", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSRNOG00000057589", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000057589", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd16468", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16468", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "100364162", "url": "https://www.ncbi.nlm.nih.gov/gene/100364162", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001841", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001841", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013083", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013083", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042981", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042981", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR052804", "url": "https://www.ebi.ac.uk/interpro/entry/IPR052804", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:100364162", "url": "https://www.genome.jp/dbget-bin/www_bget?rno:100364162", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "HLDCIDN", "url": "https://omabrowser.org/oma/group/HLDCIDN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR46359", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46359", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46359:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46359:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13639", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13639", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001258153", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258153", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "2321596", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=2321596", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2JZP9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JZP9-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN", "length": 154, "header": "tr|A0A0G2JZP9-1|A0A0G2JZP9_RAT Isoform 1 of Ring finger protein 11 OS=Rattus norvegicus OX=10116 GN=Rnf11 PE=1 SV=2 CANONICAL=A0A0G2JZP9-1" }, "isoforms": [ { "isoform_ac": "A0A0G2JZP9-1", "url": "https://www.uniprot.org/uniprotkb/A0A0G2JZP9/entry#A0A0G2JZP9-1", "sequence": { "sequence": "MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN", "length": 154, "header": "tr|A0A0G2JZP9-1|A0A0G2JZP9_RAT Isoform 1 of Ring finger protein 11 OS=Rattus norvegicus OX=10116 GN=Rnf11 PE=1 SV=2 CANONICAL=A0A0G2JZP9-1" }, "locus": { "chromosome": "5", "start_pos": 124234667, "end_pos": 124214130, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000080048.2", "url": "https://www.ensembl.org/id/ENSRNOT00000080048.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000071133.2", "url": "https://www.ensembl.org/id/ENSRNOP00000071133.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool": "isoglyp", "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "start_pos": 52, "start_aa": "T", "end_pos": 52, "end_aa": "T", "residue": "Thr", "site_lbl": "Thr52", "evidence": [ { "id": "GLY_001157", "database": "GlyGen", "url": "https://data.glygen.org/GLY_001157" } ], "filter_code": "00000000000000001000.00000000001000.1.01000" } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nat. Commun.", "date": "2012", "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZP9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] }, { "title": "RING finger protein 11 (RNF11) modulates susceptibility to 6-OHDA-induced nigral degeneration and behavioral deficits through NF-kappaB signaling in dopaminergic cells.", "journal": "Neurobiology of disease", "date": "2013", "authors": "Pranski EL, Dalal NV, Sanford CV, Herskowitz JH, Gearing M, Lazo C, Miller GW, Lah JJ, Levey AI, Betarbet RS", "evidence": [ { "database": "RefSeq", "id": "NP_001258153", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258153" } ], "reference": [ { "type": "PubMed", "id": "23318928", "url": "https://glygen.org/publication/PubMed/23318928" } ] } ], "pathway": [ { "id": "rno:100364162", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?rno:100364162", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A4X1WAX0-1", "protein_name": "Ring finger protein 11", "gene_name": "RNF11", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN", "length": 154 }, "evidence": [ { "id": "A0A0G2JZP9", "url": "https://omabrowser.org/oma/group/A0A0G2JZP9/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "A0A8V1A0D9-1", "protein_name": "Ring finger protein 11", "gene_name": "RNF11", "tax_id": 9031, "organism": "Gallus gallus", "sequence": { "sequence": "ALRVSISGLSEGPERAVLLPSFSRHCSVCTVSDKRLLLERSVRTVPTQPTVGAAVKEATGPVFQRQPRVRSPRVTLIPTCSWEEQVPVPVYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN", "length": 196 }, "evidence": [ { "id": "A0A0G2JZP9", "url": "https://omabrowser.org/oma/group/A0A0G2JZP9/", "database": "OMA" } ], "glygen_name": "Chicken", "common_name": "Chicken" }, { "uniprot_canonical_ac": "Q08DI6-1", "protein_name": "RING finger protein 11", "gene_name": "RNF11", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN", "length": 154 }, "evidence": [ { "id": "A0A0G2JZP9", "url": "https://omabrowser.org/oma/group/A0A0G2JZP9/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "Q9QYK7-1", "protein_name": "RING finger protein 11", "gene_name": "Rnf11", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPIYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN", "length": 154 }, "evidence": [ { "id": "47565311", "url": "http://www.informatics.jax.org/homology/47565311", "database": "MGI" }, { "id": "A0A0G2JZP9", "url": "https://omabrowser.org/oma/group/A0A0G2JZP9/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9Y3C5-1", "protein_name": "RING finger protein 11", "gene_name": "RNF11", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN", "length": 154 }, "evidence": [ { "id": "47565311", "url": "http://www.informatics.jax.org/homology/47565311", "database": "MGI" }, { "id": "A0A0G2JZP9", "url": "https://omabrowser.org/oma/group/A0A0G2JZP9/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "ubiquitin protein ligase activity", "id": "GO:0061630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061630", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZP9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "ubiquitin ligase complex", "id": "GO:0000151", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000151", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZP9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "ubiquitin-dependent protein catabolic process", "id": "GO:0006511", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006511", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZP9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9" } ], "pmid": "" }, { "name": "protein autoubiquitination", "id": "GO:0051865", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051865", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZP9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A0G2JZP9-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 154, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A0G2JZP9-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 52 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "prediction_tool", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "prediction_tool", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }