{
    "title": "Members of the YABBY gene family specify abaxial cell fate in Arabidopsis.",
    "journal": "Development",
    "date": "1999",
    "authors": "Siegfried K R, Eshed Y, Baum S F, Otsuga D, Drews G N, Bowman J L",
    "reference": {
        "type": "PubMed",
        "id": "10457020",
        "url": "https://pubmed.ncbi.nlm.nih.gov/10457020"
    },
    "referenced_glycans": [],
    "referenced_proteins": [
        {
            "uniprot_canonical_ac": "Q9XFB0-1",
            "protein_name": "Putative axial regulator YABBY 2",
            "gene_name": "YAB2",
            "tax_name": "Mouse-ear cress"
        },
        {
            "uniprot_canonical_ac": "O22152-1",
            "protein_name": "Axial regulator YABBY 1",
            "gene_name": "AFO; YAB1",
            "tax_name": "Mouse-ear cress"
        },
        {
            "uniprot_canonical_ac": "Q9XFB1-1",
            "protein_name": "Axial regulator YABBY 3",
            "gene_name": "YAB3",
            "tax_name": "Mouse-ear cress"
        }
    ],
    "species": [
        {
            "name": "Arabidopsis thaliana",
            "taxid": 3702,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9XFB0",
                    "url": "https://www.uniprot.org/uniprot/Q9XFB0"
                }
            ],
            "common_name": "Mouse-ear cress",
            "glygen_name": "Arabidopsis",
            "reference_species": "Arabidopsis thaliana [3702]"
        }
    ],
    "mutagenesis": [
        {
            "start_pos": 178,
            "end_pos": 178,
            "sequence_org": "N",
            "sequence_mut": "K",
            "comment": "In fil-4; abnormal abaxial determination during embryogenesis and organogenesis, filamentous flowers.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O22152",
                    "url": "https://www.uniprot.org/uniprot/O22152"
                },
                {
                    "database": "PubMed",
                    "id": "10457020",
                    "url": "https://pubmed.ncbi.nlm.nih.gov/10457020"
                }
            ],
            "uniprot_canonical_ac": "O22152-1"
        },
        {
            "start_pos": 179,
            "end_pos": 229,
            "sequence_org": "WAHFPHIHFGLVPDNQPVKKTNMPQQEGEDNMVMKEGFYAPAAANVGVTPY",
            "sequence_mut": "",
            "comment": "In fil-7; abnormal abaxial determination during embryogenesis and organogenesis, filamentous flowers.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O22152",
                    "url": "https://www.uniprot.org/uniprot/O22152"
                },
                {
                    "database": "PubMed",
                    "id": "10457020",
                    "url": "https://pubmed.ncbi.nlm.nih.gov/10457020"
                }
            ],
            "uniprot_canonical_ac": "O22152-1"
        },
        {
            "start_pos": 30,
            "end_pos": 30,
            "sequence_org": "C",
            "sequence_mut": "Y",
            "comment": "In fil-2; abnormal abaxial determination during embryogenesis and organogenesis, filamentous flowers.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O22152",
                    "url": "https://www.uniprot.org/uniprot/O22152"
                },
                {
                    "database": "PubMed",
                    "id": "10457020",
                    "url": "https://pubmed.ncbi.nlm.nih.gov/10457020"
                },
                {
                    "database": "PubMed",
                    "id": "10323860",
                    "url": "https://pubmed.ncbi.nlm.nih.gov/10323860"
                }
            ],
            "uniprot_canonical_ac": "O22152-1"
        },
        {
            "start_pos": 33,
            "end_pos": 33,
            "sequence_org": "C",
            "sequence_mut": "Y",
            "comment": "In fil-3; abnormal abaxial determination during embryogenesis and organogenesis, filamentous flowers.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O22152",
                    "url": "https://www.uniprot.org/uniprot/O22152"
                },
                {
                    "database": "PubMed",
                    "id": "10457020",
                    "url": "https://pubmed.ncbi.nlm.nih.gov/10457020"
                }
            ],
            "uniprot_canonical_ac": "O22152-1"
        }
    ],
    "record_id": "pubmed.10457020",
    "abstract": "",
    "glycosylation": [],
    "snv": [],
    "phosphorylation": [],
    "glycation": [],
    "section_stats": [
        {
            "table_id": "referenced_proteins",
            "table_stats": [
                {
                    "field": "total",
                    "count": 3
                }
            ],
            "sort_fields": [
                "uniprot_canonical_ac",
                "protein_name",
                "gene_name",
                "tax_name"
            ]
        },
        {
            "table_id": "referenced_glycans",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        }
    ]
}