{
    "uniprot_canonical_ac": "A0A1P8ASZ9-1",
    "uniprot_ac": "A0A1P8ASZ9",
    "uniprot_id": "A0A1P8ASZ9_ARATH",
    "mass": {
        "chemical_mass": 41996.0,
        "monoisotopic_mass": 41996.0
    },
    "refseq": {
        "ac": "NP_001322116",
        "name": "AGAMOUS-like 94",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001322116"
    },
    "gene_names": [
        {
            "name": "AGL94",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/A0A1P8ASZ9",
            "id": "A0A1P8ASZ9"
        },
        {
            "name": "AGAMOUS-like 94; F10D13.25; F10D13_25",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001322116",
            "id": "NP_001322116"
        },
        {
            "name": "AGAMOUS-like 94",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/A0A1P8ASZ9",
            "id": "A0A1P8ASZ9"
        },
        {
            "name": "AGL94",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001322116",
            "id": "NP_001322116"
        },
        {
            "name": "F10D13.25",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/A0A1P8ASZ9",
            "id": "A0A1P8ASZ9"
        },
        {
            "name": "F10D13_25",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/A0A1P8ASZ9",
            "id": "A0A1P8ASZ9"
        }
    ],
    "protein_names": [
        {
            "name": "AGAMOUS-like 94",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001322116",
            "id": "NP_001322116"
        },
        {
            "name": "AGAMOUS-like 94",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprotkb/A0A1P8ASZ9/entry#names_and_taxonomy",
            "id": "A0A1P8ASZ9"
        }
    ],
    "function": [],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Arabidopsis thaliana",
            "taxid": 3702,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A1P8ASZ9",
                    "url": "https://www.uniprot.org/uniprot/A0A1P8ASZ9"
                }
            ],
            "common_name": "Mouse-ear cress",
            "glygen_name": "Arabidopsis",
            "reference_species": "Arabidopsis thaliana [3702]"
        }
    ],
    "gene": [
        {
            "name": "AGL94",
            "url": "https://www.uniprot.org/uniprot/A0A1P8ASZ9",
            "locus": {
                "chromosome": "1",
                "start_pos": 26145001,
                "end_pos": 26147751,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "AT1G69540",
                        "url": "https://www.ensemblgenomes.org/id/AT1G69540"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "A0A1P8ASZ9",
            "url": "https://alphafold.ebi.ac.uk/entry/A0A1P8ASZ9",
            "database": "AlphaFoldDB",
            "categories": []
        },
        {
            "id": "AT1G69540",
            "url": "https://bar.utoronto.ca/thalemine/portal.do?externalids=AT1G69540",
            "database": "Araport",
            "categories": [
                "Organism-specific",
                "Protein"
            ]
        },
        {
            "id": "cd00266",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00266",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "843289",
            "url": "https://www.ncbi.nlm.nih.gov/gene/843289",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "Q766C0",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:Q766C0*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR002100",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR002100",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR033897",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR033897",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR036879",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR036879",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR050142",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR050142",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "ath:AT1G69540",
            "url": "https://www.genome.jp/dbget-bin/www_bget?ath:AT1G69540",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "QFHHTYN",
            "url": "https://omabrowser.org/oma/group/QFHHTYN/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "A0A1P8ASZ9",
            "url": "https://www.orthodb.org/?gene=A0A1P8ASZ9",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR48019",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48019",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR48019:SF12",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48019:SF12",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00319",
            "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00319",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_001322116",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001322116",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "AT1G69540",
            "url": "https://www.arabidopsis.org/servlets/TairObject?type=locus&name=AT1G69540",
            "database": "TAIR",
            "categories": [
                "Organism-specific",
                "Protein"
            ]
        },
        {
            "id": "A0A1P8ASZ2",
            "url": "https://www.uniprot.org/uniprot/A0A1P8ASZ2",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A1P8ASZ2-1",
            "url": "https://www.uniprot.org/uniprot/A0A1P8ASZ2-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A1P8ASZ9",
            "url": "https://www.uniprot.org/uniprot/A0A1P8ASZ9",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A1P8ASZ9-1",
            "url": "https://www.uniprot.org/uniprot/A0A1P8ASZ9-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q766C0",
            "url": "https://www.uniprot.org/uniprot/Q766C0",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q766C0-1",
            "url": "https://www.uniprot.org/uniprot/Q766C0-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MGRVKLKIKKLQNMNGRQCTYTKRRHGIMKKAKELSILCDIDVVLLMFSPMGKASICIGKHSIGEVIAKFAQLSPQERAKRKLENLEALRKTFMKANHDIDISKFLDRISTPTVEVLSEKIRFLQTQLSDIHTRLSYWTDVDNIDSVDVLQQLEHSLRQSLAQIYGRKASMPQRQQQQLMSSQCKNQLQTEIDIDFGMEMEQQLENFSWVRTDENMNVPIEEEDPNLQLHHMYKDITCSASSALGNYSGLFSKSSDILQKLETGSIPGTSADPNQQFSNLSFLNDQKLKQLAEWNLLGSPADYYVSQILEASYKPQIGGKNNGASSETLPYVAVFDDPLYFWVNNGLFIIHLFSKLCYYWSCFADCF",
        "length": 367,
        "header": "tr|A0A1P8ASZ9-1|A0A1P8ASZ9_ARATH Isoform 1 of AGAMOUS-like 94  OS=Arabidopsis thaliana OX=3702 GN=AGL94 PE=4 SV=1 CANONICAL=A0A1P8ASZ9-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A0A1P8ASZ2-1",
            "url": "https://www.uniprot.org/uniprotkb/A0A1P8ASZ9/entry#A0A1P8ASZ2-1",
            "sequence": {
                "sequence": "MKANHDIDISKFLDRISTPTVEVLSEKIRFLQTQLSDIHTRLSYWTDVDNIDSVDVLQQLEHSLRQSLAQIYGRKASMPQRQQQQLMSSQCKNQLQTEIDIDFGMEMEQQLENFSWVRTDENMNVPIEEEDPNLQLHHMYKDITCSASSALGNYSGLFSKSSDILQKLETGSIPGTSADPNQQFSNLSFLNDQKLKQLAEWNLLGSPADYYVSQILEASYKPQIGGKNNGASSETLPYVAVFDDPLYFWPN",
                "length": 251,
                "header": "tr|A0A1P8ASZ2-1|A0A1P8ASZ2_ARATH Computationally mapped isoform of AGAMOUS-like 94  OS=Arabidopsis thaliana OX=3702 GN=AGL94 PE=4 SV=1 CANONICAL=A0A1P8ASZ9-1"
            },
            "locus": {
                "chromosome": "1",
                "start_pos": 26146600,
                "end_pos": 26145309,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "AT1G69540.3",
                        "url": "https://www.ensemblgenomes.org/id/AT1G69540.3"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "AT1G69540.3",
                        "url": "https://www.ensemblgenomes.org/id/AT1G69540.3"
                    }
                ]
            }
        },
        {
            "isoform_ac": "A0A1P8ASZ9-1",
            "url": "https://www.uniprot.org/uniprotkb/A0A1P8ASZ9/entry#A0A1P8ASZ9-1",
            "sequence": {
                "sequence": "MGRVKLKIKKLQNMNGRQCTYTKRRHGIMKKAKELSILCDIDVVLLMFSPMGKASICIGKHSIGEVIAKFAQLSPQERAKRKLENLEALRKTFMKANHDIDISKFLDRISTPTVEVLSEKIRFLQTQLSDIHTRLSYWTDVDNIDSVDVLQQLEHSLRQSLAQIYGRKASMPQRQQQQLMSSQCKNQLQTEIDIDFGMEMEQQLENFSWVRTDENMNVPIEEEDPNLQLHHMYKDITCSASSALGNYSGLFSKSSDILQKLETGSIPGTSADPNQQFSNLSFLNDQKLKQLAEWNLLGSPADYYVSQILEASYKPQIGGKNNGASSETLPYVAVFDDPLYFWVNNGLFIIHLFSKLCYYWSCFADCF",
                "length": 367,
                "header": "tr|A0A1P8ASZ9-1|A0A1P8ASZ9_ARATH Isoform 1 of AGAMOUS-like 94  OS=Arabidopsis thaliana OX=3702 GN=AGL94 PE=4 SV=1 CANONICAL=A0A1P8ASZ9-1"
            },
            "locus": {
                "chromosome": "1",
                "start_pos": 26147159,
                "end_pos": 26145338,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "AT1G69540.2",
                        "url": "https://www.ensemblgenomes.org/id/AT1G69540.2"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "AT1G69540.2",
                        "url": "https://www.ensemblgenomes.org/id/AT1G69540.2"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q766C0-1",
            "url": "https://www.uniprot.org/uniprotkb/A0A1P8ASZ9/entry#Q766C0-1",
            "sequence": {
                "sequence": "MGRVKLKIKKLQNMNGRQCTYTKRRHGIMKKAKELSILCDIDVVLLMFSPMGKASICIGKHSIGEVIAKFAQLSPQERAKRKLENLEALRKTFMKANHDIDISKFLDRISTPTVEVLSEKIRFLQTQLSDIHTRLSYWTDVDNIDSVDVLQQLEHSLRQSLAQIYGRKASMPQRQQQQLMSSQCKNQLQTEIDIDFGMEMEQQLENFSWVRTDENMNVPIEEEDPNLQLHHMYKDITCSASSALGNYSGLFSKSSDILQKLETGSIPGTSADPNQQFSNLSFLNDQKLKQLAEWNLLGSPADYYVSQILEASYKPQIGGKNNGASSETLPYVAVFDDPLYFWPN",
                "length": 344,
                "header": "tr|Q766C0-1|A0A1P8ASZ9_ARATH Computationally mapped isoform of AGAMOUS-like 94  OS=Arabidopsis thaliana OX=3702 GN=AGL94 PE=4 SV=1 CANONICAL=A0A1P8ASZ9-1"
            },
            "locus": {
                "chromosome": "1",
                "start_pos": 26147159,
                "end_pos": 26145309,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "AT1G69540.1",
                        "url": "https://www.ensemblgenomes.org/id/AT1G69540.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "AT1G69540.1",
                        "url": "https://www.ensemblgenomes.org/id/AT1G69540.1"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.",
            "journal": "Nature",
            "date": "2000",
            "authors": "Theologis A, Ecker J R, Palm C J, Federspiel N A, Kaul S, White O, Alonso J, Altafi H, Araujo R, Bowman C L, Brooks S Y, Buehler E, Chan A, Chao Q, Chen H, Cheuk R F, Chin C W, Chung M K, Conn L, Conway A B, Conway A R, Creasy T H, Dewar K, Dunn P, Etgu P, Feldblyum T V, Feng J, Fong B, Fujii C Y, Gill J E, Goldsmith A D, Haas B, Hansen N F, Hughes B, Huizar L, Hunter J L, Jenkins J, Johnson-Hopson C, Khan S, Khaykin E, Kim C J, Koo H L, Kremenetskaia I, Kurtz D B, Kwan A, Lam B, Langin-Hooper S, Lee A, Lee J M, Lenz C A, Li J H, Li Y, Lin X, Liu S X, Liu Z A, Luros J S, Maiti R, Marziali A, Militscher J, Miranda M, Nguyen M, Nierman W C, Osborne B I, Pai G, Peterson J, Pham P K, Rizzo M, Rooney T, Rowley D, Sakano H, Salzberg S L, Schwartz J R, Shinn P, Southwick A M, Sun H, Tallon L J, Tambunga G, Toriumi M J, Town C D, Utterback T, Van Aken S, Vaysberg M, Vysotskaia V S, Walker M, Wu D, Yu G, Fraser C M, Venter J C, Davis R W",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q766C0",
                    "url": "https://www.uniprot.org/uniprot/Q766C0"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11130712",
                    "url": "https://glygen.org/publication/PubMed/11130712"
                }
            ]
        },
        {
            "title": "Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.",
            "journal": "Mol. Biol. Evol.",
            "date": "2003",
            "authors": "Kofuji Rumiko, Sumikawa Naomi, Yamasaki Misuzu, Kondo Kimihiko, Ueda Kunihiko, Ito Motomi, Hasebe Mitsuyasu",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q766C0",
                    "url": "https://www.uniprot.org/uniprot/Q766C0"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12949148",
                    "url": "https://glygen.org/publication/PubMed/12949148"
                }
            ]
        },
        {
            "title": "Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.",
            "journal": "Plant J.",
            "date": "2017",
            "authors": "Cheng Chia-Yi, Krishnakumar Vivek, Chan Agnes P, Thibaud-Nissen Fran\u00e7oise, Schobel Seth, Town Christopher D",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q766C0",
                    "url": "https://www.uniprot.org/uniprot/Q766C0"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27862469",
                    "url": "https://glygen.org/publication/PubMed/27862469"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "ath:AT1G69540",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/www_bget?ath:AT1G69540",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "nucleus",
                        "id": "GO:0005634",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A1P8ASZ9",
                                "url": "https://www.uniprot.org/uniprot/A0A1P8ASZ9"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 2,
                "go_terms": [
                    {
                        "name": "regulation of transcription by RNA polymerase II",
                        "id": "GO:0006357",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A1P8ASZ9",
                                "url": "https://www.uniprot.org/uniprot/A0A1P8ASZ9"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of transcription by RNA polymerase II",
                        "id": "GO:0045944",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A1P8ASZ9",
                                "url": "https://www.uniprot.org/uniprot/A0A1P8ASZ9"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 5,
                "go_terms": [
                    {
                        "name": "protein dimerization activity",
                        "id": "GO:0046983",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046983",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A1P8ASZ9",
                                "url": "https://www.uniprot.org/uniprot/A0A1P8ASZ9"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding",
                        "id": "GO:0000978",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A1P8ASZ9",
                                "url": "https://www.uniprot.org/uniprot/A0A1P8ASZ9"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "DNA-binding transcription factor activity, RNA polymerase II-specific",
                        "id": "GO:0000981",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A1P8ASZ9",
                                "url": "https://www.uniprot.org/uniprot/A0A1P8ASZ9"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "DNA-binding transcription factor activity",
                        "id": "GO:0003700",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003700",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A1P8ASZ9",
                                "url": "https://www.uniprot.org/uniprot/A0A1P8ASZ9"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cis-regulatory region sequence-specific DNA binding",
                        "id": "GO:0000987",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000987",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A1P8ASZ9",
                                "url": "https://www.uniprot.org/uniprot/A0A1P8ASZ9"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 206,
            "end_pos": 208,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 246,
            "end_pos": 248,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 279,
            "end_pos": 281,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "structures": [
        {
            "pdb_id": "AF-A0A1P8ASZ9-F1",
            "pdb_chain": "global",
            "start_pos": 1,
            "end_pos": 367,
            "overlap": "1.0",
            "method": "AlphaFold",
            "type": "alphafold",
            "resolution": -1.0,
            "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1P8ASZ9-F1.pdb"
        }
    ],
    "synthesized_glycans": [],
    "enzyme_annotation": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        }
    ],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [],
        "sequon_annotation_sites": [
            {
                "start_pos": 206,
                "end_pos": 208
            },
            {
                "start_pos": 246,
                "end_pos": 248
            },
            {
                "start_pos": 279,
                "end_pos": 281
            }
        ]
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 3
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}