{
    "uniprot_canonical_ac": "A0A1P8APD7-1",
    "uniprot_ac": "A0A1P8APD7",
    "uniprot_id": "A0A1P8APD7_ARATH",
    "mass": {
        "chemical_mass": 23829.0,
        "monoisotopic_mass": 23829.0
    },
    "refseq": {
        "ac": "NP_001320946",
        "name": "ankyrin repeat protein",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001320946"
    },
    "gene_names": [
        {
            "name": "T9L24.52; T9L24_52",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001320946",
            "id": "NP_001320946"
        },
        {
            "name": "T9L24.52",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/A0A1P8APD7",
            "id": "A0A1P8APD7"
        },
        {
            "name": "T9L24_52",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/A0A1P8APD7",
            "id": "A0A1P8APD7"
        }
    ],
    "protein_names": [
        {
            "name": "Ankyrin repeat protein",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprotkb/A0A1P8APD7/entry#names_and_taxonomy",
            "id": "A0A1P8APD7"
        },
        {
            "name": "ankyrin repeat protein",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001320946",
            "id": "NP_001320946"
        }
    ],
    "function": [],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Arabidopsis thaliana",
            "taxid": 3702,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A1P8APD7",
                    "url": "https://www.uniprot.org/uniprot/A0A1P8APD7"
                }
            ],
            "common_name": "Mouse-ear cress",
            "glygen_name": "Arabidopsis",
            "reference_species": "Arabidopsis thaliana [3702]"
        }
    ],
    "gene": [
        {
            "name": "",
            "url": "https://www.uniprot.org/uniprot/A0A1P8APD7",
            "locus": {}
        }
    ],
    "crossref": [
        {
            "id": "A0A1P8APD7",
            "url": "https://alphafold.ebi.ac.uk/entry/A0A1P8APD7",
            "database": "AlphaFoldDB",
            "categories": []
        },
        {
            "id": "AT1G73350",
            "url": "https://bar.utoronto.ca/thalemine/portal.do?externalids=AT1G73350",
            "database": "Araport",
            "categories": [
                "Organism-specific",
                "Protein"
            ]
        },
        {
            "id": "843670",
            "url": "https://www.ncbi.nlm.nih.gov/gene/843670",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "ath:AT1G73350",
            "url": "https://www.genome.jp/dbget-bin/www_bget?ath:AT1G73350",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "PKHGEED",
            "url": "https://omabrowser.org/oma/group/PKHGEED/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "A0A1P8APD7",
            "url": "https://www.orthodb.org/?gene=A0A1P8APD7",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR37202",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR37202",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR37202:SF1",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR37202:SF1",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_001320946",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001320946",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "AT1G73350",
            "url": "https://www.arabidopsis.org/servlets/TairObject?type=locus&name=AT1G73350",
            "database": "TAIR",
            "categories": [
                "Organism-specific",
                "Protein"
            ]
        },
        {
            "id": "A0A1P8APD7",
            "url": "https://www.uniprot.org/uniprot/A0A1P8APD7",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A1P8APD7-1",
            "url": "https://www.uniprot.org/uniprot/A0A1P8APD7-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A1P8APF3",
            "url": "https://www.uniprot.org/uniprot/A0A1P8APF3",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A1P8APF3-1",
            "url": "https://www.uniprot.org/uniprot/A0A1P8APF3-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A1P8APF6",
            "url": "https://www.uniprot.org/uniprot/A0A1P8APF6",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A1P8APF6-1",
            "url": "https://www.uniprot.org/uniprot/A0A1P8APF6-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A8MS11",
            "url": "https://www.uniprot.org/uniprot/A8MS11",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A8MS11-1",
            "url": "https://www.uniprot.org/uniprot/A8MS11-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "B3H5Y5",
            "url": "https://www.uniprot.org/uniprot/B3H5Y5",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "B3H5Y5-1",
            "url": "https://www.uniprot.org/uniprot/B3H5Y5-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q84WW0",
            "url": "https://www.uniprot.org/uniprot/Q84WW0",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q84WW0-1",
            "url": "https://www.uniprot.org/uniprot/Q84WW0-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MMKTSPFNEWLQRCKRLLVNVEAIFMDEAVPISLSLFFCFSFFFCSCVMAIILEFLVALDSDDLLYLKEQMEAEEDAERLLRRTEKRAFAAFKKAATQADSSPASIPLPLRVEPKPKSGIRQQDLLRKVVEVKPKRPKISTPSSPSLSPPVRSDRGPTEAKVHRDKQKEEAMPVLKKPGADRNDGKATESNGQGQNAPKGLLGLAYDSSDEED",
        "length": 213,
        "header": "tr|A0A1P8APD7-1|A0A1P8APD7_ARATH Isoform 1 of Ankyrin repeat protein  OS=Arabidopsis thaliana OX=3702 GN= PE=1 SV=1 CANONICAL=A0A1P8APD7-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A0A1P8APD7-1",
            "url": "https://www.uniprot.org/uniprotkb/A0A1P8APD7/entry#A0A1P8APD7-1",
            "sequence": {
                "sequence": "MMKTSPFNEWLQRCKRLLVNVEAIFMDEAVPISLSLFFCFSFFFCSCVMAIILEFLVALDSDDLLYLKEQMEAEEDAERLLRRTEKRAFAAFKKAATQADSSPASIPLPLRVEPKPKSGIRQQDLLRKVVEVKPKRPKISTPSSPSLSPPVRSDRGPTEAKVHRDKQKEEAMPVLKKPGADRNDGKATESNGQGQNAPKGLLGLAYDSSDEED",
                "length": 213,
                "header": "tr|A0A1P8APD7-1|A0A1P8APD7_ARATH Isoform 1 of Ankyrin repeat protein  OS=Arabidopsis thaliana OX=3702 GN= PE=1 SV=1 CANONICAL=A0A1P8APD7-1"
            },
            "locus": {
                "chromosome": "1",
                "start_pos": 27576938,
                "end_pos": 27575686,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "AT1G73350.5",
                        "url": "https://www.ensemblgenomes.org/id/AT1G73350.5"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "AT1G73350.5",
                        "url": "https://www.ensemblgenomes.org/id/AT1G73350.5"
                    }
                ]
            }
        },
        {
            "isoform_ac": "A0A1P8APF3-1",
            "url": "https://www.uniprot.org/uniprotkb/A0A1P8APD7/entry#A0A1P8APF3-1",
            "sequence": {
                "sequence": "MQEVAGERGGYLHGRGDSDDLLYLKEQMEAEEDAERLLRRTEKRAFAAFKKAATQADSSPASIPLPLRVEPKPKSGIRQQDLLRKVVEVKPKRPKISTPSSPSLSPPVRSDRGPTEAKVHRDKQKEEAMPVLKKPGADRNDGKATESNGQGQNAPKGLLGLAYDSSDEED",
                "length": 170,
                "header": "tr|A0A1P8APF3-1|A0A1P8APD7_ARATH Computationally mapped isoform of Ankyrin repeat protein  OS=Arabidopsis thaliana OX=3702 GN= PE=1 SV=1 CANONICAL=A0A1P8APD7-1"
            },
            "locus": {
                "chromosome": "1",
                "start_pos": 27576479,
                "end_pos": 27575686,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "AT1G73350.6",
                        "url": "https://www.ensemblgenomes.org/id/AT1G73350.6"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "AT1G73350.6",
                        "url": "https://www.ensemblgenomes.org/id/AT1G73350.6"
                    }
                ]
            }
        },
        {
            "isoform_ac": "A0A1P8APF6-1",
            "url": "https://www.uniprot.org/uniprotkb/A0A1P8APD7/entry#A0A1P8APF6-1",
            "sequence": {
                "sequence": "MDEAVPISLSLFFCFSFFFCSCVMAIILEFLVALDSDDLLYLKEQMEAEEDAERLLRRTEKRAFAAFKKAATQADSSPASIPLPLRVEPKPKSGIRQQDLLRKVVEVKPKRPKISTPSSPSLSPPVRSDRGPTEAKVHRDKQKEEAMPVLKKPGADRNDGKATESNGQGQNAPKGLLGLAYDSSDEED",
                "length": 188,
                "header": "tr|A0A1P8APF6-1|A0A1P8APD7_ARATH Computationally mapped isoform of Ankyrin repeat protein  OS=Arabidopsis thaliana OX=3702 GN= PE=1 SV=1 CANONICAL=A0A1P8APD7-1"
            },
            "locus": {
                "chromosome": "1",
                "start_pos": 27576442,
                "end_pos": 27575686,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "AT1G73350.4",
                        "url": "https://www.ensemblgenomes.org/id/AT1G73350.4"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "AT1G73350.4",
                        "url": "https://www.ensemblgenomes.org/id/AT1G73350.4"
                    }
                ]
            }
        },
        {
            "isoform_ac": "A8MS11-1",
            "url": "https://www.uniprot.org/uniprotkb/A0A1P8APD7/entry#A8MS11-1",
            "sequence": {
                "sequence": "MAGREVKEYTNLSDPKDKKSGKGKIDDEDVTFQRMVAKMQEVAGERGGYLHGRGALDSDDLLYLKEQMEAEEDAERLLRRTEKRAFAAFKKAATQADSSPASIPLPLRVEPKPKSGIRQQDLLRKVVEVKPKRPKISTPSSPSLSPPVRSDRGPTEAKVHRDKQKEEAMPVLKKPGADRNDGKATESNGQGQNAPKGLLGLAYDSSDEED",
                "length": 210,
                "header": "tr|A8MS11-1|A8MS11_ARATH Computationally mapped isoform of Ankyrin repeat protein  OS=Arabidopsis thaliana OX=3702 GN= PE=1 SV=1 CANONICAL=A0A1P8APD7-1"
            },
            "locus": {
                "chromosome": "1",
                "start_pos": 27577126,
                "end_pos": 27575686,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "AT1G73350.2",
                        "url": "https://www.ensemblgenomes.org/id/AT1G73350.2"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "AT1G73350.2",
                        "url": "https://www.ensemblgenomes.org/id/AT1G73350.2"
                    }
                ]
            }
        },
        {
            "isoform_ac": "B3H5Y5-1",
            "url": "https://www.uniprot.org/uniprotkb/A0A1P8APD7/entry#B3H5Y5-1",
            "sequence": {
                "sequence": "MQEVAGERGGYLHGRGALDSDDLLYLKEQMEAEEDAERLLRRTEKRAFAAFKKAATQADSSPASIPLPLRVEPKPKSGIRQQDLLRKVVEVKPKRPKISTPSSPSLSPPVRSDRGPTEAKVHRDKQKEEAMPVLKKPGADRNDGKATESNGQGQNAPKGLLGLAYDSSDEED",
                "length": 172,
                "header": "tr|B3H5Y5-1|A0A1P8APD7_ARATH Computationally mapped isoform of Ankyrin repeat protein  OS=Arabidopsis thaliana OX=3702 GN= PE=1 SV=1 CANONICAL=A0A1P8APD7-1"
            },
            "locus": {
                "chromosome": "1",
                "start_pos": 27576479,
                "end_pos": 27575686,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "AT1G73350.3",
                        "url": "https://www.ensemblgenomes.org/id/AT1G73350.3"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "AT1G73350.3",
                        "url": "https://www.ensemblgenomes.org/id/AT1G73350.3"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q84WW0-1",
            "url": "https://www.uniprot.org/uniprotkb/A0A1P8APD7/entry#Q84WW0-1",
            "sequence": {
                "sequence": "MAGREVKEYTNLSDPKDKKSGKGKIDDEDVTFQRMVAKMQEVAGERGGYLHGRGDSDDLLYLKEQMEAEEDAERLLRRTEKRAFAAFKKAATQADSSPASIPLPLRVEPKPKSGIRQQDLLRKVVEVKPKRPKISTPSSPSLSPPVRSDRGPTEAKVHRDKQKEEAMPVLKKPGADRNDGKATESNGQGQNAPKGLLGLAYDSSDEED",
                "length": 208,
                "header": "tr|Q84WW0-1|Q84WW0_ARATH Computationally mapped isoform of Ankyrin repeat protein  OS=Arabidopsis thaliana OX=3702 GN= PE=1 SV=1 CANONICAL=A0A1P8APD7-1"
            },
            "locus": {
                "chromosome": "1",
                "start_pos": 27577126,
                "end_pos": 27575686,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "AT1G73350.1",
                        "url": "https://www.ensemblgenomes.org/id/AT1G73350.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "AT1G73350.1",
                        "url": "https://www.ensemblgenomes.org/id/AT1G73350.1"
                    }
                ]
            }
        }
    ],
    "glycosylation": [
        {
            "glytoucan_ac": "",
            "type": "O-linked",
            "subtype": "other",
            "prediction_tool": "isoglyp",
            "site_category": "predicted",
            "site_category_dict": {
                "predicted": true
            },
            "site_seq": "",
            "relation": "attached",
            "comment": "",
            "start_pos": 158,
            "start_aa": "T",
            "end_pos": 158,
            "end_aa": "T",
            "residue": "Thr",
            "site_lbl": "Thr158",
            "evidence": [
                {
                    "id": "GLY_001156",
                    "database": "GlyGen",
                    "url": "https://data.glygen.org/GLY_001156"
                }
            ],
            "filter_code": "00000000000000001000.00000000001000.1.01000"
        }
    ],
    "phosphorylation": [
        {
            "start_pos": 102,
            "end_pos": 102,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "B3H5Y5",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/B3H5Y5"
                },
                {
                    "database": "PubMed",
                    "id": "18463617",
                    "url": "https://glygen.org/publication/PubMed/18463617"
                },
                {
                    "database": "PubMed",
                    "id": "20466843",
                    "url": "https://glygen.org/publication/PubMed/20466843"
                },
                {
                    "database": "PubMed",
                    "id": "23111157",
                    "url": "https://glygen.org/publication/PubMed/23111157"
                },
                {
                    "database": "PubMed",
                    "id": "23572148",
                    "url": "https://glygen.org/publication/PubMed/23572148"
                },
                {
                    "database": "PubMed",
                    "id": "23660473",
                    "url": "https://glygen.org/publication/PubMed/23660473"
                },
                {
                    "database": "PubMed",
                    "id": "23776212",
                    "url": "https://glygen.org/publication/PubMed/23776212"
                },
                {
                    "database": "PubMed",
                    "id": "25561503",
                    "url": "https://glygen.org/publication/PubMed/25561503"
                },
                {
                    "database": "PubMed",
                    "id": "26091701",
                    "url": "https://glygen.org/publication/PubMed/26091701"
                }
            ],
            "site_lbl": "Ser102"
        },
        {
            "start_pos": 105,
            "end_pos": 105,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "B3H5Y5",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/B3H5Y5"
                },
                {
                    "database": "PubMed",
                    "id": "23328941",
                    "url": "https://glygen.org/publication/PubMed/23328941"
                },
                {
                    "database": "PubMed",
                    "id": "23572148",
                    "url": "https://glygen.org/publication/PubMed/23572148"
                },
                {
                    "database": "PubMed",
                    "id": "23660473",
                    "url": "https://glygen.org/publication/PubMed/23660473"
                },
                {
                    "database": "PubMed",
                    "id": "23776212",
                    "url": "https://glygen.org/publication/PubMed/23776212"
                },
                {
                    "database": "PubMed",
                    "id": "25561503",
                    "url": "https://glygen.org/publication/PubMed/25561503"
                }
            ],
            "site_lbl": "Ser105"
        },
        {
            "start_pos": 140,
            "end_pos": 140,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "A8MS11",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/A8MS11"
                },
                {
                    "database": "PubMed",
                    "id": "20466843",
                    "url": "https://glygen.org/publication/PubMed/20466843"
                }
            ],
            "site_lbl": "Ser140"
        },
        {
            "start_pos": 143,
            "end_pos": 143,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q84WW0",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q84WW0"
                },
                {
                    "database": "PubMed",
                    "id": "18463617",
                    "url": "https://glygen.org/publication/PubMed/18463617"
                },
                {
                    "database": "PubMed",
                    "id": "19376835",
                    "url": "https://glygen.org/publication/PubMed/19376835"
                },
                {
                    "database": "PubMed",
                    "id": "20466843",
                    "url": "https://glygen.org/publication/PubMed/20466843"
                }
            ],
            "site_lbl": "Ser143"
        },
        {
            "start_pos": 148,
            "end_pos": 148,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q84WW0",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q84WW0"
                }
            ],
            "site_lbl": "Ser148"
        }
    ],
    "glycation": [],
    "keywords": [
        "glycoprotein",
        "glycoprotein_predicted"
    ],
    "publication": [
        {
            "title": "Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.",
            "journal": "Nature",
            "date": "2000",
            "authors": "Theologis A, Ecker J R, Palm C J, Federspiel N A, Kaul S, White O, Alonso J, Altafi H, Araujo R, Bowman C L, Brooks S Y, Buehler E, Chan A, Chao Q, Chen H, Cheuk R F, Chin C W, Chung M K, Conn L, Conway A B, Conway A R, Creasy T H, Dewar K, Dunn P, Etgu P, Feldblyum T V, Feng J, Fong B, Fujii C Y, Gill J E, Goldsmith A D, Haas B, Hansen N F, Hughes B, Huizar L, Hunter J L, Jenkins J, Johnson-Hopson C, Khan S, Khaykin E, Kim C J, Koo H L, Kremenetskaia I, Kurtz D B, Kwan A, Lam B, Langin-Hooper S, Lee A, Lee J M, Lenz C A, Li J H, Li Y, Lin X, Liu S X, Liu Z A, Luros J S, Maiti R, Marziali A, Militscher J, Miranda M, Nguyen M, Nierman W C, Osborne B I, Pai G, Peterson J, Pham P K, Rizzo M, Rooney T, Rowley D, Sakano H, Salzberg S L, Schwartz J R, Shinn P, Southwick A M, Sun H, Tallon L J, Tambunga G, Toriumi M J, Town C D, Utterback T, Van Aken S, Vaysberg M, Vysotskaia V S, Walker M, Wu D, Yu G, Fraser C M, Venter J C, Davis R W",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "B3H5Y5",
                    "url": "https://www.uniprot.org/uniprot/B3H5Y5"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11130712",
                    "url": "https://glygen.org/publication/PubMed/11130712"
                }
            ]
        },
        {
            "title": "Large-scale phosphorylation mapping reveals the extent of tyrosine phosphorylation in Arabidopsis.",
            "journal": "Molecular systems biology",
            "date": "2008",
            "authors": "Sugiyama Naoyuki, Nakagami Hirofumi, Mochida Keiichi, Daudi Arsalan, Tomita Masaru, Shirasu Ken, Ishihama Yasushi",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "Q84WW0",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q84WW0"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18463617",
                    "url": "https://glygen.org/publication/PubMed/18463617"
                }
            ]
        },
        {
            "title": "Large-scale Arabidopsis phosphoproteome profiling reveals novel chloroplast kinase substrates and phosphorylation networks.",
            "journal": "Plant Physiol.",
            "date": "2009",
            "authors": "Reiland Sonja, Messerli Ga\u00eblle, Baerenfaller Katja, Gerrits Bertran, Endler Anne, Grossmann Jonas, Gruissem Wilhelm, Baginsky Sacha",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "B3H5Y5",
                    "url": "https://www.uniprot.org/uniprot/B3H5Y5"
                },
                {
                    "database": "iPTMnet",
                    "id": "Q84WW0",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q84WW0"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19376835",
                    "url": "https://glygen.org/publication/PubMed/19376835"
                }
            ]
        },
        {
            "title": "Large-scale comparative phosphoproteomics identifies conserved phosphorylation sites in plants.",
            "journal": "Plant physiology",
            "date": "2010-07",
            "authors": "Nakagami Hirofumi, Sugiyama Naoyuki, Mochida Keiichi, Daudi Arsalan, Yoshida Yuko, Toyoda Tetsuro, Tomita Masaru, Ishihama Yasushi, Shirasu Ken",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "A8MS11",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/A8MS11"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20466843",
                    "url": "https://glygen.org/publication/PubMed/20466843"
                }
            ]
        },
        {
            "title": "A large-scale protein phosphorylation analysis reveals novel phosphorylation motifs and phosphoregulatory networks in Arabidopsis.",
            "journal": "Journal of proteomics",
            "date": "2013-01-14",
            "authors": "Wang Xu, Bian Yangyang, Cheng Kai, Gu Li-Fei, Ye Mingliang, Zou Hanfa, Sun Samuel Sai-Ming, He Jun-Xian",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "B3H5Y5",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/B3H5Y5"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23111157",
                    "url": "https://glygen.org/publication/PubMed/23111157"
                }
            ]
        },
        {
            "title": "Quantitative phosphoproteomics after auxin-stimulated lateral root induction identifies an SNX1 protein phosphorylation site required for growth.",
            "journal": "Molecular & cellular proteomics : MCP",
            "date": "2013-05",
            "authors": "Zhang Hongtao, Zhou Houjiang, Berke Lidija, Heck Albert J R, Mohammed Shabaz, Scheres Ben, Menke Frank L H",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "B3H5Y5",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/B3H5Y5"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23328941",
                    "url": "https://glygen.org/publication/PubMed/23328941"
                }
            ]
        },
        {
            "title": "Genetics and phosphoproteomics reveal a protein phosphorylation network in the abscisic acid signaling pathway in Arabidopsis thaliana.",
            "journal": "Science signaling",
            "date": "2013-04-09",
            "authors": "Umezawa Taishi, Sugiyama Naoyuki, Takahashi Fuminori, Anderson Jeffrey C, Ishihama Yasushi, Peck Scott C, Shinozaki Kazuo",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "B3H5Y5",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/B3H5Y5"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23572148",
                    "url": "https://glygen.org/publication/PubMed/23572148"
                }
            ]
        },
        {
            "title": "Quantitative measurement of phosphoproteome response to osmotic stress in arabidopsis based on Library-Assisted eXtracted Ion Chromatogram (LAXIC).",
            "journal": "Molecular & cellular proteomics : MCP",
            "date": "2013-08",
            "authors": "Xue Liang, Wang Pengcheng, Wang Lianshui, Renzi Emily, Radivojac Predrag, Tang Haixu, Arnold Randy, Zhu Jian-Kang, Tao W Andy",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "B3H5Y5",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/B3H5Y5"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23660473",
                    "url": "https://glygen.org/publication/PubMed/23660473"
                }
            ]
        },
        {
            "title": "Quantitative phosphoproteomics identifies SnRK2 protein kinase substrates and reveals the effectors of abscisic acid action.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2013-07-02",
            "authors": "Wang Pengcheng, Xue Liang, Batelli Giorgia, Lee Shinyoung, Hou Yueh-Ju, Van Oosten Michael J, Zhang Huiming, Tao W Andy, Zhu Jian-Kang",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "B3H5Y5",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/B3H5Y5"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23776212",
                    "url": "https://glygen.org/publication/PubMed/23776212"
                }
            ]
        },
        {
            "title": "Quantitative phosphoproteomics of the ataxia telangiectasia-mutated (ATM) and ataxia telangiectasia-mutated and rad3-related (ATR) dependent DNA damage response in Arabidopsis thaliana.",
            "journal": "Molecular & cellular proteomics : MCP",
            "date": "2015-03",
            "authors": "Roitinger Elisabeth, Hofer Manuel, K\u00f6cher Thomas, Pichler Peter, Novatchkova Maria, Yang Jianhua, Schl\u00f6gelhofer Peter, Mechtler Karl",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "B3H5Y5",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/B3H5Y5"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25561503",
                    "url": "https://glygen.org/publication/PubMed/25561503"
                }
            ]
        },
        {
            "title": "Quantitative Circadian Phosphoproteomic Analysis of Arabidopsis Reveals Extensive Clock Control of Key Components in Physiological, Metabolic, and Signaling Pathways.",
            "journal": "Molecular & cellular proteomics : MCP",
            "date": "2015-08",
            "authors": "Choudhary Mani Kant, Nomura Yuko, Wang Lei, Nakagami Hirofumi, Somers David E",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "B3H5Y5",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/B3H5Y5"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26091701",
                    "url": "https://glygen.org/publication/PubMed/26091701"
                }
            ]
        },
        {
            "title": "Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.",
            "journal": "Plant J.",
            "date": "2017",
            "authors": "Cheng Chia-Yi, Krishnakumar Vivek, Chan Agnes P, Thibaud-Nissen Fran\u00e7oise, Schobel Seth, Town Christopher D",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "B3H5Y5",
                    "url": "https://www.uniprot.org/uniprot/B3H5Y5"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27862469",
                    "url": "https://glygen.org/publication/PubMed/27862469"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "ath:AT1G73350",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/www_bget?ath:AT1G73350",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 2,
                "go_terms": [
                    {
                        "name": "membrane",
                        "id": "GO:0016020",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A1P8APD7",
                                "url": "https://www.uniprot.org/uniprot/A0A1P8APD7"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "nucleus",
                        "id": "GO:0005634",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A1P8APD7",
                                "url": "https://www.uniprot.org/uniprot/A0A1P8APD7"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "structures": [
        {
            "pdb_id": "AF-A0A1P8APD7-F1",
            "pdb_chain": "global",
            "start_pos": 1,
            "end_pos": 213,
            "overlap": "1.0",
            "method": "AlphaFold",
            "type": "alphafold",
            "resolution": -1.0,
            "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1P8APD7-F1.pdb"
        }
    ],
    "synthesized_glycans": [],
    "enzyme_annotation": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        }
    ],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [
            158
        ],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [
            102,
            105,
            140,
            143,
            148
        ],
        "sequon_annotation_sites": []
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "exact_sites",
                    "count": 1
                },
                {
                    "field": "exact_o_linked_sites",
                    "count": 1
                },
                {
                    "field": "fuzzy_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "prediction_tool",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "exact_sites",
                    "count": 1
                },
                {
                    "field": "exact_o_linked_sites",
                    "count": 1
                },
                {
                    "field": "fuzzy_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "prediction_tool",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 5
                },
                {
                    "field": "total_sites",
                    "count": 5
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "kinase_uniprot_canonical_ac",
                "kinase_gene_name",
                "residue",
                "comment",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 12
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}