{ "uniprot_canonical_ac": "A0A1D5PRL0-1", "uniprot_ac": "A0A1D5PRL0", "uniprot_id": "A0A1D5PRL0_CHICK", "mass": { "chemical_mass": 10581.0, "monoisotopic_mass": 10581.0 }, "refseq": { "ac": "NP_990718", "name": "osteocalcin preproprotein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_990718" }, "gene_names": [ { "name": "BGLAP", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A1D5PRL0", "id": "A0A1D5PRL0" }, { "name": "BGLAP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_990718", "id": "NP_990718" }, { "name": "BGP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_990718", "id": "NP_990718" } ], "protein_names": [ { "name": "Osteocalcin", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PRL0/entry#names_and_taxonomy", "id": "A0A1D5PRL0" }, { "name": "osteocalcin preproprotein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_990718", "id": "NP_990718" }, { "name": "osteocalcin; gamma-carboxyglutamic acid-containing protein; bone Gla protein; bone gamma-carboxyglutamate (gla) protein (osteocalcin)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_990718", "id": "NP_990718" } ], "function": [ { "annotation": "##Evidence-Data-START## Transcript exon combination :: DR425193.1, U10578.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992290, SAMEA103992323 [ECO:0000348] ##Evidence-Data-END## VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000343.1. On Jan 6, 2017 this sequence version replaced NP_990718.1. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.", "evidence": [ { "database": "RefSeq", "id": "NP_990718", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_990718" } ] }, { "annotation": "Binds strongly to apatite and calcium.", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PRL0", "url": "https://www.uniprot.org/uniprot/A0A1D5PRL0#function" }, { "database": "UniProtKB", "id": "RU361261", "url": "https://www.uniprot.org/uniprot/RU361261#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PRL0", "url": "https://www.uniprot.org/uniprot/A0A1D5PRL0" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "BGLAP", "url": "https://www.uniprot.org/uniprot/A0A1D5PRL0", "locus": { "chromosome": "25", "start_pos": 2674, "end_pos": 1097, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSGALG00010028181", "url": "https://www.ensembl.org/id/ENSGALG00010028181" } ] } } ], "crossref": [ { "id": "A0A1D5PRL0", "url": "https://alphafold.ebi.ac.uk/entry/A0A1D5PRL0", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSGALG00000029494", "url": "https://bgee.org/?page=gene&gene_id=ENSGALG00000029494", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "396348", "url": "https://www.ncbi.nlm.nih.gov/gene/396348", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000294", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000294", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002384", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002384", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035972", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035972", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039176", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039176", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "gga:396348", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:396348", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "DQIGFQE", "url": "https://omabrowser.org/oma/group/DQIGFQE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR14235", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14235", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR14235:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14235:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "R-GGA-159763", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-159763", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-GGA-159782", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-159782", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_990718", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_990718", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1D5PRL0", "url": "https://www.uniprot.org/uniprot/A0A1D5PRL0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1D5PRL0-1", "url": "https://www.uniprot.org/uniprot/A0A1D5PRL0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKAAALLLLAALLTFSLCRSAPDGSDARSAKAFISHRASAEMVRRQKRHYAQDSGVAGAPPNPLEAQREVCELSPDCDELADQIGFQEAYRRFYGPV", "length": 97, "header": "tr|A0A1D5PRL0-1|A0A1D5PRL0_CHICK Isoform 1 of Osteocalcin OS=Gallus gallus OX=9031 GN=BGLAP PE=3 SV=1 CANONICAL=A0A1D5PRL0-1" }, "isoforms": [ { "isoform_ac": "A0A1D5PRL0-1", "url": "https://www.uniprot.org/uniprotkb/A0A1D5PRL0/entry#A0A1D5PRL0-1", "sequence": { "sequence": "MKAAALLLLAALLTFSLCRSAPDGSDARSAKAFISHRASAEMVRRQKRHYAQDSGVAGAPPNPLEAQREVCELSPDCDELADQIGFQEAYRRFYGPV", "length": 97, "header": "tr|A0A1D5PRL0-1|A0A1D5PRL0_CHICK Isoform 1 of Osteocalcin OS=Gallus gallus OX=9031 GN=BGLAP PE=3 SV=1 CANONICAL=A0A1D5PRL0-1" }, "locus": { "chromosome": "25", "start_pos": 2558, "end_pos": 1415, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010068292.1", "url": "https://www.ensembl.org/id/ENSGALT00010068292.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010042035.1", "url": "https://www.ensembl.org/id/ENSGALP00010042035.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "gga:396348", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:396348", "resource": "KEGG Pathway" }, { "id": "R-GGA-159763", "name": "Transport of gamma-carboxylated protein precursors from the endoplasmic reticulum to the Golgi apparatus", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-159763", "resource": "Reactome", "description": "Transport of gamma-carboxylated protein precursors from the endoplasmic reticulum to the Golgi apparatus" }, { "id": "R-GGA-159782", "name": "Removal of aminoterminal propeptides from gamma-carboxylated proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-GGA-159782", "resource": "Reactome", "description": "Removal of aminoterminal propeptides from gamma-carboxylated proteins" } ], "orthologs": [ { "uniprot_canonical_ac": "A1A4R0-1", "protein_name": "Osteocalcin", "gene_name": "BGLAP", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MRTPMLLALLALATLCLAGRADAKPGDAESGKGAAFVSKQEGSEVVKRLRRYLDHWLGAPAPYPDPLEPKREVCELNPDCDELADHIGFQEAYRRFYAQSRACSPAHLAGSPQLWLLSRTPPLPVIPAALE", "length": 131 }, "evidence": [ { "id": "A0A1D5PRL0", "url": "https://omabrowser.org/oma/group/A0A1D5PRL0/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "P02818-1", "protein_name": "Osteocalcin", "gene_name": "BGLAP", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV", "length": 100 }, "evidence": [ { "id": "A0A1D5PRL0", "url": "https://omabrowser.org/oma/group/A0A1D5PRL0/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P04640-1", "protein_name": "Osteocalcin", "gene_name": "Bglap", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MRTLSLLTLLALTAFCLSDLAGAKPSDSESDKAFMSKQEGSKVVNRLRRYLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV", "length": 99 }, "evidence": [ { "id": "A0A1D5PRL0", "url": "https://omabrowser.org/oma/group/A0A1D5PRL0/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "P86547-1", "protein_name": "Osteocalcin-2", "gene_name": "Bglap2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRTLSLLTLLALAALCLSDLTDAKPSGPESDKAFMSKQEGNKVVNRLRRYLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI", "length": 95 }, "evidence": [ { "id": "A0A1D5PRL0", "url": "https://omabrowser.org/oma/group/A0A1D5PRL0/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "structural constituent of bone", "id": "GO:0008147", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008147", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PRL0", "url": "https://www.uniprot.org/uniprot/A0A1D5PRL0" } ], "pmid": "" }, { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PRL0", "url": "https://www.uniprot.org/uniprot/A0A1D5PRL0" } ], "pmid": "" }, { "name": "hydroxyapatite binding", "id": "GO:0046848", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046848", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PRL0", "url": "https://www.uniprot.org/uniprot/A0A1D5PRL0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "regulation of cellular response to insulin stimulus", "id": "GO:1900076", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900076", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PRL0", "url": "https://www.uniprot.org/uniprot/A0A1D5PRL0" } ], "pmid": "" }, { "name": "bone development", "id": "GO:0060348", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060348", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PRL0", "url": "https://www.uniprot.org/uniprot/A0A1D5PRL0" } ], "pmid": "" }, { "name": "biomineral tissue development", "id": "GO:0031214", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031214", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PRL0", "url": "https://www.uniprot.org/uniprot/A0A1D5PRL0" } ], "pmid": "" }, { "name": "osteoblast differentiation", "id": "GO:0001649", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001649", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PRL0", "url": "https://www.uniprot.org/uniprot/A0A1D5PRL0" } ], "pmid": "" }, { "name": "regulation of bone mineralization", "id": "GO:0030500", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030500", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PRL0", "url": "https://www.uniprot.org/uniprot/A0A1D5PRL0" } ], "pmid": "" }, { "name": "response to vitamin D", "id": "GO:0033280", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033280", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PRL0", "url": "https://www.uniprot.org/uniprot/A0A1D5PRL0" } ], "pmid": "" }, { "name": "response to vitamin K", "id": "GO:0032571", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032571", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PRL0", "url": "https://www.uniprot.org/uniprot/A0A1D5PRL0" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PRL0", "url": "https://www.uniprot.org/uniprot/A0A1D5PRL0" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5PRL0", "url": "https://www.uniprot.org/uniprot/A0A1D5PRL0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A1D5PRL0-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 97, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1D5PRL0-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }