{ "uniprot_canonical_ac": "A0A1B0GVZ2-1", "uniprot_ac": "A0A1B0GVZ2", "uniprot_id": "F240B_HUMAN", "mass": { "chemical_mass": 9744.0, "monoisotopic_mass": 9744.0 }, "refseq": {}, "gene_names": [ { "name": "FAM240B", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A1B0GVZ2", "id": "A0A1B0GVZ2" } ], "protein_names": [ { "name": "Protein FAM240B", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GVZ2/entry#names_and_taxonomy", "id": "A0A1B0GVZ2" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GVZ2", "url": "https://www.uniprot.org/uniprot/A0A1B0GVZ2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "gene": [ { "name": "FAM240B", "url": "https://www.uniprot.org/uniprot/A0A1B0GVZ2", "locus": { "chromosome": "9", "start_pos": 38694266, "end_pos": 38720133, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000283329", "url": "https://www.ensembl.org/id/ENSG00000283329" } ] } } ], "crossref": [ { "id": "A0A1B0GVZ2", "url": "https://alphafold.ebi.ac.uk/entry/A0A1B0GVZ2", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSG00000283329", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000283329", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "FAM240B", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=FAM240B", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "53430", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=53430", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR040261", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040261", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "NX_A0A1B0GVZ2", "url": "https://www.nextprot.org/entry/NX_A0A1B0GVZ2", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "NFWEKTI", "url": "https://omabrowser.org/oma/group/NFWEKTI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A1B0GVZ2", "url": "https://www.orthodb.org/?gene=A0A1B0GVZ2", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR40387", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR40387", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR40387:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR40387:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "A0A1B0GVZ2", "url": "https://pharos.nih.gov/targets/A0A1B0GVZ2", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_A0A1B0GVZ2", "url": "http://purl.obolibrary.org/obo/PR_A0A1B0GVZ2", "database": "PRO", "categories": [ "Protein" ] }, { "id": "A0A1B0GVZ2", "url": "https://www.uniprot.org/uniprot/A0A1B0GVZ2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GVZ2-1", "url": "https://www.uniprot.org/uniprot/A0A1B0GVZ2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNNQYIRREVFCCGTCHELKSFWEKEISKQTFYRELEEDRQERSALKKLREEWRQRLERRLRMLDNPVEKEKPAHTAD", "length": 78, "header": "sp|A0A1B0GVZ2-1|F240B_HUMAN Isoform 1 of Protein FAM240B OS=Homo sapiens OX=9606 GN=FAM240B PE=3 SV=1 CANONICAL=A0A1B0GVZ2-1" }, "isoforms": [ { "isoform_ac": "A0A1B0GVZ2-1", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GVZ2/entry#A0A1B0GVZ2-1", "sequence": { "sequence": "MNNQYIRREVFCCGTCHELKSFWEKEISKQTFYRELEEDRQERSALKKLREEWRQRLERRLRMLDNPVEKEKPAHTAD", "length": 78, "header": "sp|A0A1B0GVZ2-1|F240B_HUMAN Isoform 1 of Protein FAM240B OS=Homo sapiens OX=9606 GN=FAM240B PE=3 SV=1 CANONICAL=A0A1B0GVZ2-1" }, "locus": { "chromosome": "9", "start_pos": 38703999, "end_pos": 38694779, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000637493.2", "url": "https://www.ensembl.org/id/ENST00000637493.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000490097.1", "url": "https://www.ensembl.org/id/ENSP00000490097.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "E1BSG9-1", "protein_name": "Uncharacterized protein", "gene_name": "LOC427470", "tax_id": 9031, "organism": "Gallus gallus", "sequence": { "sequence": "MNSQYMRHEVRGCETSNLRNFWEKTIEQQTRYLQIEKERQQRSALTKLRNEWMERLEKRIKMLRTQPEDASS", "length": 72 }, "evidence": [ { "id": "A0A1B0GVZ2", "url": "https://omabrowser.org/oma/group/A0A1B0GVZ2/", "database": "OMA" } ], "glygen_name": "Chicken", "common_name": "Chicken" }, { "uniprot_canonical_ac": "J3QMB3-1", "protein_name": "Family with sequence similarity 240 member B", "gene_name": "Fam240b", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MNSQYMRREVFCCETCDELKSFWEKEIHKQTCYRELEEDRQGRSALRKLREEWKERLEKRLRMLDNPDDKEKQANPEN", "length": 78 }, "evidence": [ { "id": "A0A1B0GVZ2", "url": "https://omabrowser.org/oma/group/A0A1B0GVZ2/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "M0R4M3-1", "protein_name": "Family with sequence similarity 240 member B", "gene_name": "Fam240b", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MNSQYMRREVFCCETCDELKSFWEKEIRKQTCYRELEEDRQERSALRKLREEWKERLEKRLRMLDNPDDKETQANPES", "length": 78 }, "evidence": [ { "id": "A0A1B0GVZ2", "url": "https://omabrowser.org/oma/group/A0A1B0GVZ2/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" } ], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A1B0GVZ2-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 78, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A1B0GVZ2-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }