{ "uniprot_canonical_ac": "A0A140B2F4-1", "uniprot_ac": "A0A140B2F4", "uniprot_id": "A0A140B2F4_CHICK", "mass": { "chemical_mass": 23601.0, "monoisotopic_mass": 23601.0 }, "refseq": {}, "gene_names": [ { "name": "MRAP2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A140B2F4", "id": "A0A140B2F4" } ], "protein_names": [ { "name": "Melanocortin-2 receptor accessory protein 2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A140B2F4/entry#names_and_taxonomy", "id": "A0A140B2F4" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A0A140B2F4", "url": "https://www.uniprot.org/uniprot/A0A140B2F4" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "MRAP2", "url": "https://www.uniprot.org/uniprot/A0A140B2F4", "locus": { "chromosome": "3", "start_pos": 77215295, "end_pos": 77229776, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSGALG00010002873", "url": "https://www.ensembl.org/id/ENSGALG00010002873" } ] } } ], "crossref": [ { "id": "IPR028111", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028111", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "gga:421836", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:421836", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "RSYFHFY", "url": "https://omabrowser.org/oma/group/RSYFHFY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A140B2F4", "url": "https://www.orthodb.org/?gene=A0A140B2F4", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR28675", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28675", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR28675:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28675:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF15183", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF15183", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001307836", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001307836", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A140B2F4", "url": "https://www.uniprot.org/uniprot/A0A140B2F4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140B2F4-1", "url": "https://www.uniprot.org/uniprot/A0A140B2F4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSALRLISNRTSQQALSNSDYTWEYEYYEYGPVSFEGLKAHKYSIVIGFWVGLAVFVIFMFFVLTLLTKTGAPHQENTESSEKRFRMNSFVADFGRPLESERVFSRQIAEESRSLFHFCINEVEHLDKAQQSQKGPDLESNIHFQEVSRSSGTLEEDLNCLAKYNIPNFVNTEQNSSLGEGDLLILQPPRVLESKTAMQSSHRILD", "length": 206, "header": "tr|A0A140B2F4-1|A0A140B2F4_CHICK Isoform 1 of Melanocortin-2 receptor accessory protein 2 OS=Gallus gallus OX=9031 GN=MRAP2 PE=2 SV=1 CANONICAL=A0A140B2F4-1" }, "isoforms": [ { "isoform_ac": "A0A140B2F4-1", "url": "https://www.uniprot.org/uniprotkb/A0A140B2F4/entry#A0A140B2F4-1", "sequence": { "sequence": "MSALRLISNRTSQQALSNSDYTWEYEYYEYGPVSFEGLKAHKYSIVIGFWVGLAVFVIFMFFVLTLLTKTGAPHQENTESSEKRFRMNSFVADFGRPLESERVFSRQIAEESRSLFHFCINEVEHLDKAQQSQKGPDLESNIHFQEVSRSSGTLEEDLNCLAKYNIPNFVNTEQNSSLGEGDLLILQPPRVLESKTAMQSSHRILD", "length": 206, "header": "tr|A0A140B2F4-1|A0A140B2F4_CHICK Isoform 1 of Melanocortin-2 receptor accessory protein 2 OS=Gallus gallus OX=9031 GN=MRAP2 PE=2 SV=1 CANONICAL=A0A140B2F4-1" }, "locus": { "chromosome": "3", "start_pos": 77225901, "end_pos": 77215461, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010006650.1", "url": "https://www.ensembl.org/id/ENSGALT00010006650.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010004075.1", "url": "https://www.ensembl.org/id/ENSGALP00010004075.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "gga:421836", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?gga:421836", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A6H7D6-1", "protein_name": "MRAP2 protein", "gene_name": "MRAP2", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MSAQRLISNRTAQQSASNSDYTWEYEYYEIGPVSFEGLKAHKYSIVIGFWVGLAVFVIFMFFVLTLLTKTGAPHQDNAESSEKRFRMNSFVSDFGKPLEPDKVFSRQGNEESRSFFHCYINEVDHLEKAKACLQTTALDSEVHLQEAIRCSGRPEEELNRLMKFDIPNFVNTDQNSFGEDDLLISETPIVLENKPVVQTSHKELD", "length": 205 }, "evidence": [ { "id": "A0A140B2F4", "url": "https://omabrowser.org/oma/group/A0A140B2F4/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "D3Z1Q2-1", "protein_name": "Melanocortin-2 receptor accessory protein 2", "gene_name": "Mrap2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEMSAQRLASNRTSPQSPSNSDYTWEYEYYEIGPVSFEGLKAHKYSIVIGFWVGLAVFVIFMFFVLTLLTKTGAPHQDNAESSERRFRMNSFVSDFGKPLESDKVFSRQGNEESRSLFHCYINEVEHLDRVKVCHQTTAIDSDVHLQEASRSSGRPEEELARFMKFDIPNFVNTEQSSFGEDDLLISEAPVLLENKPVSQTSRIDLD", "length": 207 }, "evidence": [ { "id": "A0A140B2F4", "url": "https://omabrowser.org/oma/group/A0A140B2F4/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "A0A140B2F4", "url": "https://www.uniprot.org/uniprot/A0A140B2F4" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0A140B2F4", "url": "https://www.uniprot.org/uniprot/A0A140B2F4" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 7, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "A0A140B2F4", "url": "https://www.uniprot.org/uniprot/A0A140B2F4" } ], "pmid": "" }, { "name": "type 3 melanocortin receptor binding", "id": "GO:0031781", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031781", "evidence": [ { "database": "UniProtKB", "id": "A0A140B2F4", "url": "https://www.uniprot.org/uniprot/A0A140B2F4" } ], "pmid": "" }, { "name": "type 4 melanocortin receptor binding", "id": "GO:0031782", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031782", "evidence": [ { "database": "UniProtKB", "id": "A0A140B2F4", "url": "https://www.uniprot.org/uniprot/A0A140B2F4" } ], "pmid": "" }, { "name": "type 1 melanocortin receptor binding", "id": "GO:0070996", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070996", "evidence": [ { "database": "UniProtKB", "id": "A0A140B2F4", "url": "https://www.uniprot.org/uniprot/A0A140B2F4" } ], "pmid": "" }, { "name": "corticotropin hormone receptor binding", "id": "GO:0031780", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031780", "evidence": [ { "database": "UniProtKB", "id": "A0A140B2F4", "url": "https://www.uniprot.org/uniprot/A0A140B2F4" } ], "pmid": "" }, { "name": "type 5 melanocortin receptor binding", "id": "GO:0031783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031783", "evidence": [ { "database": "UniProtKB", "id": "A0A140B2F4", "url": "https://www.uniprot.org/uniprot/A0A140B2F4" } ], "pmid": "" }, { "name": "signaling receptor regulator activity", "id": "GO:0030545", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030545", "evidence": [ { "database": "UniProtKB", "id": "A0A140B2F4", "url": "https://www.uniprot.org/uniprot/A0A140B2F4" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "protein localization to plasma membrane", "id": "GO:0072659", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072659", "evidence": [ { "database": "UniProtKB", "id": "A0A140B2F4", "url": "https://www.uniprot.org/uniprot/A0A140B2F4" } ], "pmid": "" }, { "name": "energy homeostasis", "id": "GO:0097009", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097009", "evidence": [ { "database": "UniProtKB", "id": "A0A140B2F4", "url": "https://www.uniprot.org/uniprot/A0A140B2F4" } ], "pmid": "" }, { "name": "feeding behavior", "id": "GO:0007631", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007631", "evidence": [ { "database": "UniProtKB", "id": "A0A140B2F4", "url": "https://www.uniprot.org/uniprot/A0A140B2F4" } ], "pmid": "" }, { "name": "energy reserve metabolic process", "id": "GO:0006112", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006112", "evidence": [ { "database": "UniProtKB", "id": "A0A140B2F4", "url": "https://www.uniprot.org/uniprot/A0A140B2F4" } ], "pmid": "" }, { "name": "negative regulation of protein localization to plasma membrane", "id": "GO:1903077", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903077", "evidence": [ { "database": "UniProtKB", "id": "A0A140B2F4", "url": "https://www.uniprot.org/uniprot/A0A140B2F4" } ], "pmid": "" }, { "name": "positive regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway", "id": "GO:0106071", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0106071", "evidence": [ { "database": "UniProtKB", "id": "A0A140B2F4", "url": "https://www.uniprot.org/uniprot/A0A140B2F4" } ], "pmid": "" }, { "name": "negative regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway", "id": "GO:0106072", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0106072", "evidence": [ { "database": "UniProtKB", "id": "A0A140B2F4", "url": "https://www.uniprot.org/uniprot/A0A140B2F4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 175, "end_pos": 177, "annotation": "n_glycosylation_sequon" }, { "start_pos": 9, "end_pos": 11, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 175, "end_pos": 177 }, { "start_pos": 9, "end_pos": 11 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }