{ "uniprot_canonical_ac": "A0A0D5BWD2-1", "uniprot_ac": "A0A0D5BWD2", "uniprot_id": "A0A0D5BWD2_PIG", "mass": { "chemical_mass": 31015.0, "monoisotopic_mass": 31015.0 }, "refseq": {}, "gene_names": [ { "name": "C1QBP", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2", "id": "A0A0D5BWD2" } ], "protein_names": [ { "name": "Complement component 1 Q subcomponent-binding protein, mitochondrial", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A0D5BWD2/entry#names_and_taxonomy", "id": "A0A0D5BWD2" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Sus scrofa", "taxid": 9823, "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "common_name": "Pig", "glygen_name": "Pig", "reference_species": "Sus scrofa [9823]" } ], "gene": [ { "name": "C1QBP", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2", "locus": { "chromosome": "12", "start_pos": 51555689, "end_pos": 51548415, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSSSCG00000035048", "url": "https://www.ensembl.org/id/ENSSSCG00000035048" } ] } } ], "crossref": [ { "id": "ENSSSCG00000035048", "url": "https://bgee.org/?page=gene&gene_id=ENSSSCG00000035048", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR003428", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003428", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036561", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036561", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "VYFNVNH", "url": "https://omabrowser.org/oma/group/VYFNVNH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0D5BWD2", "url": "https://www.orthodb.org/?gene=A0A0D5BWD2", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10826", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10826", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10826:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10826:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02330", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF02330", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-SSC-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-140837", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-SSC-8980692", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-8980692", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-SSC-9013106", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-9013106", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0D5BWD2-1", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A286ZUP1", "url": "https://www.uniprot.org/uniprot/A0A286ZUP1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A286ZUP1-1", "url": "https://www.uniprot.org/uniprot/A0A286ZUP1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLQLLRCVPRALGTAVAGLCVAAPSQPLPRLLQPASRLCARPFGLLSVRAGSVQPPSLLRPRGPCACGCGCGGLHTEGDKAFVEFLNDEIKEEKKIQKHKSLPKMSGGWELEVNGTEAKLVRKVAGEKITVTFNINNSIPPPYGEEEQPSEGQKVEEQEPELTSTPNFVVEVTKDGSKKALVLDCHYPEDEIGQEDEAQSDIFSIKEVSFQSTDDSDWKDTNYTLNTDSLDWGLYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKGFVKSQ", "length": 281, "header": "tr|A0A0D5BWD2-1|A0A0D5BWD2_PIG Isoform 1 of Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Sus scrofa OX=9823 GN=C1QBP PE=2 SV=1 CANONICAL=A0A0D5BWD2-1" }, "isoforms": [ { "isoform_ac": "A0A0D5BWD2-1", "url": "https://www.uniprot.org/uniprotkb/A0A0D5BWD2/entry#A0A0D5BWD2-1", "sequence": { "sequence": "MLQLLRCVPRALGTAVAGLCVAAPSQPLPRLLQPASRLCARPFGLLSVRAGSVQPPSLLRPRGPCACGCGCGGLHTEGDKAFVEFLNDEIKEEKKIQKHKSLPKMSGGWELEVNGTEAKLVRKVAGEKITVTFNINNSIPPPYGEEEQPSEGQKVEEQEPELTSTPNFVVEVTKDGSKKALVLDCHYPEDEIGQEDEAQSDIFSIKEVSFQSTDDSDWKDTNYTLNTDSLDWGLYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKGFVKSQ", "length": 281, "header": "tr|A0A0D5BWD2-1|A0A0D5BWD2_PIG Isoform 1 of Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Sus scrofa OX=9823 GN=C1QBP PE=2 SV=1 CANONICAL=A0A0D5BWD2-1" }, "locus": {} }, { "isoform_ac": "A0A286ZUP1-1", "url": "https://www.uniprot.org/uniprotkb/A0A0D5BWD2/entry#A0A286ZUP1-1", "sequence": { "sequence": "MLQLLRCVPRALGTAVAGLCVAAPSQPLPRLLQPPSLLRPRGPCACGCGCGGLHTEGDKAFVEFLNDEIKEEKKIQKHKSLPKMSGGWELEVNGTEAKLVRKVAGEKITVTFNINNSIPPPYGEEEQPSEGQKVEEQEPELTSTPNFVVEVTKDGSKKALVLDCHYPEDEIGQEDEAQSDIFSIKEVSFQSTDDSDWKDTNYTLNTDSLDWGLYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKGFVKSQ", "length": 260, "header": "tr|A0A286ZUP1-1|A0A286ZUP1_PIG Computationally mapped isoform of Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Sus scrofa OX=9823 GN=C1QBP PE=3 SV=1 CANONICAL=A0A0D5BWD2-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "R-SSC-140837", "name": "Intrinsic Pathway of Fibrin Clot Formation", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-140837", "resource": "Reactome", "description": "Intrinsic Pathway of Fibrin Clot Formation" }, { "id": "R-SSC-8980692", "name": "RHOA GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-8980692", "resource": "Reactome", "description": "RHOA GTPase cycle" }, { "id": "R-SSC-9013106", "name": "RHOC GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-9013106", "resource": "Reactome", "description": "RHOC GTPase cycle" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "mitochondrial matrix", "id": "GO:0005759", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005759", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 18, "go_terms": [ { "name": "adaptive immune response", "id": "GO:0002250", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002250", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" }, { "name": "negative regulation of double-strand break repair via homologous recombination", "id": "GO:2000042", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000042", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" }, { "name": "positive regulation of apoptotic process", "id": "GO:0043065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043065", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" }, { "name": "positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction", "id": "GO:0051897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051897", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" }, { "name": "negative regulation of type II interferon production", "id": "GO:0032689", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032689", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" }, { "name": "negative regulation of mRNA splicing, via spliceosome", "id": "GO:0048025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048025", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" }, { "name": "positive regulation of substrate adhesion-dependent cell spreading", "id": "GO:1900026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900026", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" }, { "name": "positive regulation of trophoblast cell migration", "id": "GO:1901165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901165", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" }, { "name": "phosphatidylinositol 3-kinase/protein kinase B signal transduction", "id": "GO:0043491", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043491", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" }, { "name": "negative regulation of interleukin-12 production", "id": "GO:0032695", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032695", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" }, { "name": "regulation of complement activation", "id": "GO:0030449", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030449", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" }, { "name": "negative regulation of MDA-5 signaling pathway", "id": "GO:0039534", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039534", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" }, { "name": "negative regulation of RIG-I signaling pathway", "id": "GO:0039536", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039536", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" }, { "name": "cytosolic ribosome assembly", "id": "GO:0042256", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042256", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" }, { "name": "negative regulation of defense response to virus", "id": "GO:0050687", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050687", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" }, { "name": "positive regulation of neutrophil chemotaxis", "id": "GO:0090023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090023", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" }, { "name": "positive regulation of dendritic cell chemotaxis", "id": "GO:2000510", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000510", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "enzyme inhibitor activity", "id": "GO:0004857", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004857", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" }, { "name": "transcription corepressor activity", "id": "GO:0003714", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003714", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" }, { "name": "complement component C1q complex binding", "id": "GO:0001849", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001849", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" }, { "name": "hyaluronic acid binding", "id": "GO:0005540", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005540", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" }, { "name": "kininogen binding", "id": "GO:0030984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030984", "evidence": [ { "database": "UniProtKB", "id": "A0A0D5BWD2", "url": "https://www.uniprot.org/uniprot/A0A0D5BWD2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 114, "end_pos": 116, "annotation": "n_glycosylation_sequon" }, { "start_pos": 136, "end_pos": 138, "annotation": "n_glycosylation_sequon" }, { "start_pos": 222, "end_pos": 224, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 114, "end_pos": 116 }, { "start_pos": 136, "end_pos": 138 }, { "start_pos": 222, "end_pos": 224 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }