{ "uniprot_canonical_ac": "A0A0A6YWI4-1", "uniprot_ac": "A0A0A6YWI4", "uniprot_id": "A0A0A6YWI4_MOUSE", "mass": { "chemical_mass": 15061.0, "monoisotopic_mass": 15061.0 }, "refseq": {}, "gene_names": [ { "name": "2310009B15Rik", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0A6YWI4", "id": "A0A0A6YWI4" } ], "protein_names": [ { "name": "RIKEN cDNA 2310009B15 gene", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A0A6YWI4/entry#names_and_taxonomy", "id": "A0A0A6YWI4" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A0A6YWI4", "url": "https://www.uniprot.org/uniprot/A0A0A6YWI4" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "gene": [ { "name": "2310009B15Rik", "url": "https://www.uniprot.org/uniprot/A0A0A6YWI4", "locus": { "chromosome": "1", "start_pos": 138779721, "end_pos": 138784590, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000079283", "url": "https://www.ensembl.org/id/ENSMUSG00000079283" } ] } } ], "crossref": [ { "id": "A0A0A6YWI4", "url": "https://alphafold.ebi.ac.uk/entry/A0A0A6YWI4", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSMUSG00000079283", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000079283", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "69549", "url": "https://www.ncbi.nlm.nih.gov/gene/69549", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR040807", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040807", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:69549", "url": "https://www.genome.jp/dbget-bin/www_bget?mmu:69549", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1916799", "url": "http://www.informatics.jax.org/marker/MGI:1916799", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "YLVLTQI", "url": "https://omabrowser.org/oma/group/YLVLTQI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "D3Z1T2", "url": "https://www.orthodb.org/?gene=D3Z1T2", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR21037", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21037", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR21037:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21037:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF17653", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF17653", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A0A0A6YWI4", "url": "https://www.uniprot.org/uniprot/A0A0A6YWI4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0A6YWI4-1", "url": "https://www.uniprot.org/uniprot/A0A0A6YWI4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z1T2", "url": "https://www.uniprot.org/uniprot/D3Z1T2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z1T2-1", "url": "https://www.uniprot.org/uniprot/D3Z1T2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAAQGIWTLARVSLGRPPPRAEGFRQQLNSTLGSTSEGARGGSAADSWGTPEGEPRHPASRELTAAERHIVELHRAACAVRPAPACPARGLCACARPATRPRGGPAGRCWTSGLGRVGLGRPLRGSCEKPGRTFAFRTERCLP", "length": 143, "header": "tr|A0A0A6YWI4-1|A0A0A6YWI4_MOUSE Isoform 1 of RIKEN cDNA 2310009B15 gene OS=Mus musculus OX=10090 GN=2310009B15Rik PE=4 SV=1 CANONICAL=A0A0A6YWI4-1" }, "isoforms": [ { "isoform_ac": "A0A0A6YWI4-1", "url": "https://www.uniprot.org/uniprotkb/A0A0A6YWI4/entry#A0A0A6YWI4-1", "sequence": { "sequence": "MAAQGIWTLARVSLGRPPPRAEGFRQQLNSTLGSTSEGARGGSAADSWGTPEGEPRHPASRELTAAERHIVELHRAACAVRPAPACPARGLCACARPATRPRGGPAGRCWTSGLGRVGLGRPLRGSCEKPGRTFAFRTERCLP", "length": 143, "header": "tr|A0A0A6YWI4-1|A0A0A6YWI4_MOUSE Isoform 1 of RIKEN cDNA 2310009B15 gene OS=Mus musculus OX=10090 GN=2310009B15Rik PE=4 SV=1 CANONICAL=A0A0A6YWI4-1" }, "locus": {} }, { "isoform_ac": "D3Z1T2-1", "url": "https://www.uniprot.org/uniprotkb/A0A0A6YWI4/entry#D3Z1T2-1", "sequence": { "sequence": "MAAQGIWTLARVSLGRPPPRAEGFRQQLNSTLGSTSEGARGGSAADSWGTPEGEPRHPASRELTAAERHIVELHRAACAAGQLSYMDPATGYVVLTRLAHLQRGACCGSACRHCPYGQVNVKDPSKKKQFNSYFYV", "length": 136, "header": "tr|D3Z1T2-1|A0A0A6YWI4_MOUSE Computationally mapped isoform of RIKEN cDNA 2310009B15 gene OS=Mus musculus OX=10090 GN=2310009B15Rik PE=4 SV=1 CANONICAL=A0A0A6YWI4-1" }, "locus": { "chromosome": "1", "start_pos": 138784555, "end_pos": 138779843, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000112025.3", "url": "https://www.ensembl.org/id/ENSMUST00000112025.3" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000107656.2", "url": "https://www.ensembl.org/id/ENSMUSP00000107656.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "mmu:69549", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?mmu:69549", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A287B7D8-1", "protein_name": "Chromosome 10 C1orf53 homolog", "gene_name": "C10H1orf53", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MAAWRVRVSAGAALRGQQPAAPPPKPPRVGAEFRQPLRFTFCSASKGDRGVSGPDSLEGGATGRASEELTEAERRIAELHAAACAAGQLNYVDPATGYVVLTQLAHVQRGHCCGSACRHCPYGQVSVKDPSKKKQFNSYFYV", "length": 142 }, "evidence": [ { "id": "A0A0A6YWI4", "url": "https://omabrowser.org/oma/group/A0A0A6YWI4/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "A0A3Q1LXG2-1", "protein_name": "Chromosome 16 C1orf53 homolog", "gene_name": "C16H1orf53", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MAAWRVPASALRRTQPAAAPPERPPRDGTAFRRRRGVPLCSVAREDGGGPGPDSRGGPEEATKRPASQELTAAERRIAELHAAACAAGQLNYVDPATGYVVFTQLAHLQRGQCCGSACRHCPYGQINVKDPSKKKQFNSYFYV", "length": 143 }, "evidence": [ { "id": "A0A0A6YWI4", "url": "https://omabrowser.org/oma/group/A0A0A6YWI4/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "A0A8V0XZW1-1", "protein_name": "Chromosome 1 open reading frame 53", "gene_name": "C1orf53", "tax_id": 9031, "organism": "Gallus gallus", "sequence": { "sequence": "MLCPTSSSARPSQLPHDGHSRDSSPAPARLPPALPGPGSARRPPQRARPGPRAATGAARSAAAAAARPPPPGQPPAPQLTPLERRIVELHREAAAAGRQTYVDPATGYQVLTEVAHLRRGKCCGSACRHCPYEQVNVKDQSKKKRFNSFFYV", "length": 152 }, "evidence": [ { "id": "A0A0A6YWI4", "url": "https://omabrowser.org/oma/group/A0A0A6YWI4/", "database": "OMA" } ], "glygen_name": "Chicken", "common_name": "Chicken" }, { "uniprot_canonical_ac": "F7EXE9-1", "protein_name": "Similar to novel protein", "gene_name": "C13h1orf53", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAAQGIRALSRQALGRSPPWAEDFRQQLCSTLHSASEGACGGSAPGSWGTAEEEQRHPVNRELTPAERHIAELHRAACAVRPAPACPAASAPARVRPPDPEAGPGPEVLGAAGPLAWAGRPGASAQKVLRETRSHFCVPDREAGQLSYLDPATGYVVLTRLAHLQRGACCGSACRHCPYGQVNVKDPSKKKQFNSYFYV", "length": 199 }, "evidence": [ { "id": "A0A0A6YWI4", "url": "https://omabrowser.org/oma/group/A0A0A6YWI4/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q5VUE5-1", "protein_name": "Uncharacterized protein C1orf53", "gene_name": "C1orf53", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAARQIWARTGAALCRQPSAAPPPAPLWVRAGFRQQLSLTLCPANEGNCGGSAPSTPGRPERAARPSVSEELTAAERQIAELHAAACAAGQLNYVDPATGYVVLTQIAHLQRGECCGSACRHCPYGQVNVKDPSKKKQFNSYFYV", "length": 145 }, "evidence": [ { "id": "47563952", "url": "http://www.informatics.jax.org/homology/47563952", "database": "MGI" }, { "id": "A0A0A6YWI4", "url": "https://omabrowser.org/oma/group/A0A0A6YWI4/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" } ], "go_annotation": {}, "pro_annotation": [], "site_annotation": [ { "start_pos": 29, "end_pos": 31, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A0A6YWI4-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 143, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A0A6YWI4-F1.pdb" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 29, "end_pos": 31 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }