{
    "uniprot_canonical_ac": "A0A088BHA6-1",
    "uniprot_ac": "A0A088BHA6",
    "uniprot_id": "A0A088BHA6_CHICK",
    "mass": {
        "chemical_mass": 16358.0,
        "monoisotopic_mass": 16358.0
    },
    "refseq": {},
    "gene_names": [
        {
            "name": "EDYM1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/A0A088BHA6",
            "id": "A0A088BHA6"
        }
    ],
    "protein_names": [
        {
            "name": "Epidermal differentiation protein",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprotkb/A0A088BHA6/entry#names_and_taxonomy",
            "id": "A0A088BHA6"
        }
    ],
    "function": [],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Gallus gallus",
            "taxid": 9031,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A088BHA6",
                    "url": "https://www.uniprot.org/uniprot/A0A088BHA6"
                }
            ],
            "common_name": "Chicken",
            "glygen_name": "Chicken",
            "reference_species": "Gallus gallus [9031]"
        }
    ],
    "gene": [
        {
            "name": "EDYM1",
            "url": "https://www.uniprot.org/uniprot/A0A088BHA6",
            "locus": {
                "chromosome": "25",
                "start_pos": 1627960,
                "end_pos": 1625019,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSGALG00010028290",
                        "url": "https://www.ensembl.org/id/ENSGALG00010028290"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "YQYKQQC",
            "url": "https://omabrowser.org/oma/group/YQYKQQC/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "A0A088BHA6",
            "url": "https://www.orthodb.org/?gene=A0A088BHA6",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "A0A088BHA6",
            "url": "https://www.uniprot.org/uniprot/A0A088BHA6",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A088BHA6-1",
            "url": "https://www.uniprot.org/uniprot/A0A088BHA6-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MSYWYQYKQQCFIPSGAKHITPAFTQCHSPGVVKSVPCASCASRDAKQCTTRRIVQSIPKCPMPCTSSCVEKHVVEGHSSSCSHRSADGCTMMFSQPHGQHLCMPHCRQVGVTERPQVCAPVHVGQHSSYPCSYQWSDSYHYRCGQS",
        "length": 147,
        "header": "tr|A0A088BHA6-1|A0A088BHA6_CHICK Isoform 1 of Epidermal differentiation protein  OS=Gallus gallus OX=9031 GN=EDYM1 PE=2 SV=1 CANONICAL=A0A088BHA6-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A0A088BHA6-1",
            "url": "https://www.uniprot.org/uniprotkb/A0A088BHA6/entry#A0A088BHA6-1",
            "sequence": {
                "sequence": "MSYWYQYKQQCFIPSGAKHITPAFTQCHSPGVVKSVPCASCASRDAKQCTTRRIVQSIPKCPMPCTSSCVEKHVVEGHSSSCSHRSADGCTMMFSQPHGQHLCMPHCRQVGVTERPQVCAPVHVGQHSSYPCSYQWSDSYHYRCGQS",
                "length": 147,
                "header": "tr|A0A088BHA6-1|A0A088BHA6_CHICK Isoform 1 of Epidermal differentiation protein  OS=Gallus gallus OX=9031 GN=EDYM1 PE=2 SV=1 CANONICAL=A0A088BHA6-1"
            },
            "locus": {
                "chromosome": "25",
                "start_pos": 1627037,
                "end_pos": 1626597,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSGALT00010068498.1",
                        "url": "https://www.ensembl.org/id/ENSGALT00010068498.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSGALP00010042146.1",
                        "url": "https://www.ensembl.org/id/ENSGALP00010042146.1"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Evolutionary origin and diversification of epidermal barrier proteins in amniotes.",
            "journal": "Mol. Biol. Evol.",
            "date": "2014",
            "authors": "Strasser Bettina, Mlitz Veronika, Hermann Marcela, Rice Robert H, Eigenheer Richard A, Alibardi Lorenzo, Tschachler Erwin, Eckhart Leopold",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A088BHA6",
                    "url": "https://www.uniprot.org/uniprot/A0A088BHA6"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25169930",
                    "url": "https://glygen.org/publication/PubMed/25169930"
                }
            ]
        }
    ],
    "pathway": [],
    "orthologs": [],
    "go_annotation": {},
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "structures": [],
    "synthesized_glycans": [],
    "enzyme_annotation": [],
    "cluster_types": [],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [],
        "sequon_annotation_sites": []
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}