{
"uniprot_canonical_ac": "P14324-1",
"uniprot_ac": "P14324",
"uniprot_id": "FPPS_HUMAN",
"mass": {
"chemical_mass": 48275.0,
"monoisotopic_mass": 48275.0
},
"refseq": {
"ac": "NP_001129293",
"name": "farnesyl pyrophosphate synthase isoform a",
"summary": "This gene encodes an enzyme that catalyzes the production of geranyl pyrophosphate and farnesyl pyrophosphate from isopentenyl pyrophosphate and dimethylallyl pyrophosphate. The resulting product, farnesyl pyrophosphate, is a key intermediate in cholesterol and sterol biosynthesis, a substrate for protein farnesylation and geranylgeranylation, and a ligand or agonist for certain hormone receptors and growth receptors. Drugs that inhibit this enzyme prevent the post-translational modifications of small GTPases and have been used to treat diseases related to bone resorption. Multiple pseudogenes have been found on chromosomes 1, 7, 14, 15, 21 and X. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2008].",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129293"
},
"gene_names": [
{
"name": "FDPS",
"resource": "UniProtKB",
"type": "recommended",
"url": "https://www.uniprot.org/uniprot/P14324",
"id": "P14324"
},
{
"name": "FDPS",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129293",
"id": "NP_001129293"
},
{
"name": "FPPS; FPS; POROK9",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129293",
"id": "NP_001129293"
},
{
"name": "FPS",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/P14324",
"id": "P14324"
},
{
"name": "KIAA1293",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/P14324",
"id": "P14324"
},
{
"name": "hCG_1997329",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/P14324",
"id": "P14324"
}
],
"protein_names": [
{
"name": "Farnesyl pyrophosphate synthase",
"resource": "UniProtKB",
"type": "recommended",
"url": "",
"id": "P14324"
},
{
"name": "(2E,6E)-farnesyl diphosphate synthase",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P14324"
},
{
"name": "2.5.1.10",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P14324"
},
{
"name": "2.5.1.1",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P14324"
},
{
"name": "Dimethylallyltranstransferase",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P14324"
},
{
"name": "FPP synthase",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P14324"
},
{
"name": "FPS",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P14324"
},
{
"name": "Farnesyl diphosphate synthase",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P14324"
},
{
"name": "Geranyltranstransferase",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P14324"
},
{
"name": "farnesyl pyrophosphate synthase isoform a",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129293",
"id": "NP_001129293"
},
{
"name": "farnesyl pyrophosphate synthetase, dimethylallyltranstransferase, geranyltranstransferase; FPP synthetase; farnesyl pyrophosphate synthase; FPP synthase; (2E,6E)-farnesyl diphosphate synthase",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129293",
"id": "NP_001129293"
}
],
"function": [
{
"annotation": "Farnesyl diphosphate synthase exacerbates nonalcoholic steatohepatitis via the activation of AHR-CD36 axis.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001129293",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129293"
},
{
"database": "PubMed",
"id": "37310396",
"url": "https://glygen.org/publication/PubMed/37310396"
}
]
},
{
"annotation": "Key enzyme in isoprenoid biosynthesis which catalyzes the formation of farnesyl diphosphate (FPP), a precursor for several classes of essential metabolites including sterols, dolichols, carotenoids, and ubiquinones. FPP also serves as substrate for protein farnesylation and geranylgeranylation. Catalyzes the sequential condensation of isopentenyl pyrophosphate with the allylic pyrophosphates, dimethylallyl pyrophosphate, and then with the resultant geranylpyrophosphate to the ultimate product farnesyl pyrophosphate.",
"evidence": [
{
"database": "UniProtKB",
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324#function"
}
]
},
{
"annotation": "Novel missense mutations of MVK and FDPS gene in Chinese patients with disseminated superficial actinic porokeratosis.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001129293",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129293"
},
{
"database": "PubMed",
"id": "34751146",
"url": "https://glygen.org/publication/PubMed/34751146"
}
]
},
{
"annotation": "This gene encodes an enzyme that catalyzes the production of geranyl pyrophosphate and farnesyl pyrophosphate from isopentenyl pyrophosphate and dimethylallyl pyrophosphate. The resulting product, farnesyl pyrophosphate, is a key intermediate in cholesterol and sterol biosynthesis, a substrate for protein farnesylation and geranylgeranylation, and a ligand or agonist for certain hormone receptors and growth receptors. Drugs that inhibit this enzyme prevent the post-translational modifications of small GTPases and have been used to treat diseases related to bone resorption. Multiple pseudogenes have been found on chromosomes 1, 7, 14, 15, 21 and X. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2008].",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001129293",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129293"
}
]
},
{
"annotation": "Towards an Improvement of Anticancer Activity of Benzyl Adenosine Analogs. Publication Status: Online-Only",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001129293",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129293"
},
{
"database": "PubMed",
"id": "34885721",
"url": "https://glygen.org/publication/PubMed/34885721"
}
]
}
],
"disease": [
{
"disease_id": "MONDO:0014713",
"recommended_name": {
"id": "MONDO:0014713",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0014713",
"name": "porokeratosis 9, multiple types",
"description": "Any porokeratosis (disease) in which the cause of the disease is a mutation in the FDPS gene."
},
"synonyms": [
{
"id": "MONDO:0014713",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0014713",
"name": "FDPS porokeratosis (disease)",
"description": ""
},
{
"id": "MONDO:0014713",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0014713",
"name": "POROK9",
"description": ""
},
{
"id": "MONDO:0014713",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0014713",
"name": "porokeratosis (disease) caused by mutation in FDPS",
"description": ""
},
{
"id": "MONDO:0014713",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0014713",
"name": "porokeratosis 9, multiple types",
"description": ""
},
{
"id": "MONDO:0014713",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0014713",
"name": "porokeratosis 9, multiple types; POROK9",
"description": ""
},
{
"id": "MIM:616631",
"resource": "MIM",
"url": "https://www.omim.org/entry/616631",
"name": "Porokeratosis 9, multiple types",
"description": "Porokeratosis 9, multiple types"
}
],
"evidence": [
{
"id": "616631",
"database": "MIM",
"url": "https://www.omim.org/entry/616631"
}
]
}
],
"snv": [
{
"evidence": [
{
"id": "rs61729685",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61729685"
},
{
"id": "rs61729685",
"database": "1000Genomes",
"url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs61729685"
},
{
"id": "rs61729685",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61729685"
},
{
"id": "rs61729685",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs61729685#frequency_tab"
},
{
"id": "rs61729685",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs61729685"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 120,
"end_pos": 120,
"sequence_org": "I",
"sequence_mut": "T",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NAI->NAT).",
"chr_id": "1",
"chr_pos": "155312274",
"ref_nt": "C",
"alt_nt": "null",
"minor_allelic_frequency": "0.002596",
"site_lbl": "I120",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs533042404",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs533042404"
},
{
"id": "rs533042404",
"database": "1000Genomes",
"url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs533042404"
},
{
"id": "rs533042404",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs533042404"
},
{
"id": "rs533042404",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs533042404"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 173,
"end_pos": 173,
"sequence_org": "D",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DSS->NSS).",
"chr_id": "1",
"chr_pos": "155317977",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "0.0002",
"site_lbl": "D173",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs1572094770",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1572094770"
},
{
"id": "rs1572094770",
"database": "ENSEMBL",
"url": "https://www.ensembl.org/id/rs1572094770"
}
],
"glycoeffect": [
"o-glyco-site-loss"
],
"start_pos": 4,
"end_pos": 4,
"sequence_org": "S",
"sequence_mut": "F",
"comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).",
"chr_id": "1",
"chr_pos": "155317984",
"ref_nt": "T",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "S4",
"keywords": [
"ebi",
"germline"
]
}
],
"mutagenesis": [],
"expression_tissue": [
{
"tissue": {
"name": "Adult mammalian kidney",
"namespace": "UBERON",
"id": "0000082",
"url": "http://purl.obolibrary.org/obo/UBERON_0000082"
},
"score": "94.3",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000160752",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160752"
}
]
},
{
"tissue": {
"name": "Oral cavity",
"namespace": "UBERON",
"id": "0000167",
"url": "http://purl.obolibrary.org/obo/UBERON_0000167"
},
"score": "96.57",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000160752",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160752"
}
]
},
{
"tissue": {
"name": "Stomach",
"namespace": "UBERON",
"id": "0000945",
"url": "http://purl.obolibrary.org/obo/UBERON_0000945"
},
"score": "95.43",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000160752",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160752"
}
]
},
{
"tissue": {
"name": "Uterus",
"namespace": "UBERON",
"id": "0000995",
"url": "http://purl.obolibrary.org/obo/UBERON_0000995"
},
"score": "92.27",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000160752",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160752"
}
]
},
{
"tissue": {
"name": "Esophagus",
"namespace": "UBERON",
"id": "0001043",
"url": "http://purl.obolibrary.org/obo/UBERON_0001043"
},
"score": "96.92",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000160752",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160752"
}
]
},
{
"tissue": {
"name": "Rectum",
"namespace": "UBERON",
"id": "0001052",
"url": "http://purl.obolibrary.org/obo/UBERON_0001052"
},
"score": "98.42",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000160752",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160752"
}
]
},
{
"tissue": {
"name": "Colon",
"namespace": "UBERON",
"id": "0001155",
"url": "http://purl.obolibrary.org/obo/UBERON_0001155"
},
"score": "96.26",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000160752",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160752"
}
]
},
{
"tissue": {
"name": "Urinary bladder",
"namespace": "UBERON",
"id": "0001255",
"url": "http://purl.obolibrary.org/obo/UBERON_0001255"
},
"score": "95.02",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000160752",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160752"
}
]
},
{
"tissue": {
"name": "Thyroid gland",
"namespace": "UBERON",
"id": "0002046",
"url": "http://purl.obolibrary.org/obo/UBERON_0002046"
},
"score": "96.88",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000160752",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160752"
}
]
},
{
"tissue": {
"name": "Lung",
"namespace": "UBERON",
"id": "0002048",
"url": "http://purl.obolibrary.org/obo/UBERON_0002048"
},
"score": "93.83",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000160752",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160752"
}
]
},
{
"tissue": {
"name": "Liver",
"namespace": "UBERON",
"id": "0002107",
"url": "http://purl.obolibrary.org/obo/UBERON_0002107"
},
"score": "97.66",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000160752",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160752"
}
]
},
{
"tissue": {
"name": "Prostate gland",
"namespace": "UBERON",
"id": "0002367",
"url": "http://purl.obolibrary.org/obo/UBERON_0002367"
},
"score": "97.91",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000160752",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160752"
}
]
},
{
"tissue": {
"name": "Thoracic mammary gland",
"namespace": "UBERON",
"id": "0005200",
"url": "http://purl.obolibrary.org/obo/UBERON_0005200"
},
"score": "97.59",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000160752",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160752"
}
]
}
],
"expression_disease": [
{
"significant": "No",
"trend": "down",
"name": "Prostate cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10283",
"evidence": [
{
"database": "BioXpress",
"id": "P14324",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14324"
}
],
"disease": [
{
"disease_id": "DOID:10283",
"recommended_name": {
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer",
"description": "A male reproductive organ cancer that is located_in the prostate."
},
"synonyms": [
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "NGP - new growth of prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "malignant tumor of the prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "tumor of the prostate",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, type 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "HPC9",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "EHBP1 familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "familial prostate cancer caused by mutation in EHBP1",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, type 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "HPC12",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, type 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "HPC5",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, type 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, susceptibility to, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "HPC3",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, type 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, susceptibility to, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "HPC4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, on chromosome 7",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "MSMB familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "familial prostate cancer caused by mutation in MSMB",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, type 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "HPC13",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, type 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "HPC8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "predisposing for prostate cancer",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, type 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "HPC6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "HPC10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate carcinoma",
"description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate carcinoma",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, somatic",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, hereditary",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "HPC7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer aggressiveness",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "RNASEL familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "familial prostate cancer caused by mutation in RNASEL",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, type 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "HPC1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "Prca1",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "HPC11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "HPC14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "HPC15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "HPCX1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer susceptibility, X-linked",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "HPCX2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MIM:611868",
"resource": "MIM",
"url": "https://www.omim.org/entry/611868",
"name": "Prostate cancer, hereditary, 12",
"description": "Prostate cancer, hereditary, 12"
},
{
"id": "MIM:611928",
"resource": "MIM",
"url": "https://www.omim.org/entry/611928",
"name": "Prostate cancer, hereditary, 13",
"description": "Prostate cancer, hereditary, 13"
},
{
"id": "MIM:176807",
"resource": "MIM",
"url": "https://www.omim.org/entry/176807",
"name": "Prostate cancer",
"description": "Prostate cancer"
},
{
"id": "MIM:601518",
"resource": "MIM",
"url": "https://www.omim.org/entry/601518",
"name": "Prostate cancer, hereditary, 1",
"description": "Prostate cancer, hereditary, 1"
},
{
"id": "MIM:611955",
"resource": "MIM",
"url": "https://www.omim.org/entry/611955",
"name": "Prostate cancer, hereditary, 11",
"description": "Prostate cancer, hereditary, 11"
}
]
}
]
},
{
"significant": "No",
"trend": "down",
"name": "Stomach cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10534",
"evidence": [
{
"database": "BioXpress",
"id": "P14324",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14324"
}
],
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Urinary bladder cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11054",
"evidence": [
{
"database": "BioXpress",
"id": "P14324",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14324"
}
],
"disease": [
{
"disease_id": "DOID:11054",
"recommended_name": {
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
},
"synonyms": [
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "bladder cancer",
"description": ""
},
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": "A primary or metastatic malignant neoplasm involving the bladder."
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "bladder cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "cancer of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumour",
"description": ""
},
{
"id": "MIM:109800",
"resource": "MIM",
"url": "https://www.omim.org/entry/109800",
"name": "Bladder cancer",
"description": "Bladder cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Head and neck cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11934",
"evidence": [
{
"database": "BioXpress",
"id": "P14324",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14324"
}
],
"disease": [
{
"disease_id": "DOID:11934",
"recommended_name": {
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck cancer",
"description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
},
"synonyms": [
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck tumours",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head/neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "tumor of head and neck",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Lung cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1324",
"evidence": [
{
"database": "BioXpress",
"id": "P14324",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14324"
}
],
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Breast cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1612",
"evidence": [
{
"database": "BioXpress",
"id": "P14324",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14324"
}
],
"disease": [
{
"disease_id": "DOID:1612",
"recommended_name": {
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland."
},
"synonyms": [
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant neoplasm of breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant tumor of the breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary cancer",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "primary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, lobular, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of the breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial Male",
"description": ""
},
{
"id": "MIM:114480",
"resource": "MIM",
"url": "https://www.omim.org/entry/114480",
"name": "Breast cancer",
"description": "Breast cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Thyroid cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1781",
"evidence": [
{
"database": "BioXpress",
"id": "P14324",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14324"
}
],
"disease": [
{
"disease_id": "DOID:1781",
"recommended_name": {
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid cancer",
"description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
},
"synonyms": [
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid gland cancer",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "Thyroid gland neoplasm",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant tumour of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Kidney cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:263",
"evidence": [
{
"database": "BioXpress",
"id": "P14324",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14324"
}
],
"disease": [
{
"disease_id": "DOID:263",
"recommended_name": {
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "kidney cancer",
"description": "A urinary system cancer that is located_in the kidney."
},
"synonyms": [
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant neoplasm of kidney except pelvis",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant tumour of kidney",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "renal cancer",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Liver cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:3571",
"evidence": [
{
"database": "BioXpress",
"id": "P14324",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14324"
}
],
"disease": [
{
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Uterine cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:363",
"evidence": [
{
"database": "BioXpress",
"id": "P14324",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14324"
}
],
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Esophageal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:5041",
"evidence": [
{
"database": "BioXpress",
"id": "P14324",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14324"
}
],
"disease": [
{
"disease_id": "DOID:5041",
"recommended_name": {
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophageal cancer",
"description": "A gastrointestinal system cancer that is located_in the esophagus."
},
"synonyms": [
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophagus cancer",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Distal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Proximal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of the middle Third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": "A primary or metastatic malignant neoplasm involving the esophagus."
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "oesophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the middle third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of abdominal oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the middle third of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Aerodigestive tract cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Escc, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "gastric cardia adenocarcinoma, susceptibility to",
"description": ""
},
{
"id": "MIM:133239",
"resource": "MIM",
"url": "https://www.omim.org/entry/133239",
"name": "Esophageal cancer",
"description": "Esophageal cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Colorectal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:9256",
"evidence": [
{
"database": "BioXpress",
"id": "P14324",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14324"
}
],
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
}
]
}
],
"species": [
{
"name": "Homo sapiens",
"taxid": 9606,
"evidence": [
{
"database": "UniProtKB",
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324"
}
],
"common_name": "Human"
}
],
"gene": [
{
"name": "FDPS",
"url": "https://www.uniprot.org/uniprot/P14324",
"locus": {
"chromosome": "1",
"start_pos": 155320666,
"end_pos": 155308748,
"strand": "-",
"evidence": [
{
"database": "Ensembl Gene",
"id": "ENSG00000160752",
"url": "https://www.ensembl.org/id/ENSG00000160752"
}
]
}
}
],
"crossref": [
{
"id": "ENSG00000160752",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000160752",
"database": "Bgee",
"categories": [
"Gene Expression"
]
},
{
"id": "2.5.1.1",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.5.1.1&UniProtAcc=P14324",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "2.5.1.10",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.5.1.10&UniProtAcc=P14324",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "cd00685",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00685",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "CHEMBL1782",
"url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1782",
"database": "ChEMBL",
"categories": [
"Other"
]
},
{
"id": "FDPS",
"url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=FDPS",
"database": "GeneCards",
"categories": [
"Gene Annotation",
"Organism-specific"
]
},
{
"id": "2224",
"url": "https://www.ncbi.nlm.nih.gov/gene/2224",
"database": "GeneID",
"categories": [
"Genome Annotation"
]
},
{
"id": "3631",
"url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=3631",
"database": "HGNC",
"categories": [
"Organism-specific"
]
},
{
"id": "P14324",
"url": "https://www.ebi.ac.uk/intact/interactors/id:P14324*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "IPR000092",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR000092",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR008949",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR008949",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR033749",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR033749",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR039702",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR039702",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "hsa:2224",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2224",
"database": "KEGG Pathway",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "134629",
"url": "http://www.omim.org/entry/134629",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "616631",
"url": "http://www.omim.org/entry/616631",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "NX_P14324",
"url": "https://www.nextprot.org/entry/NX_P14324",
"database": "neXtProt",
"categories": [
"Protein",
"Organism-specific"
]
},
{
"id": "P14324",
"url": "https://oglcnac.org/atlas/detail/P14324",
"database": "O-GlcNAc Atlas",
"categories": [
"Glycoproteomics"
]
},
{
"id": "P14324",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P14324",
"database": "O-GlcNAc Database",
"categories": [
"Glycoproteomics"
]
},
{
"id": "WVVNQAL",
"url": "https://omabrowser.org/oma/group/WVVNQAL/",
"database": "OMA",
"categories": [
"Protein Classification"
]
},
{
"id": "509027at2759",
"url": "http://www.orthodb.org/?query=509027at2759",
"database": "OrthoDB",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR11525",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11525",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR11525:SF0",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11525:SF0",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "1YQ7",
"url": "https://www.rcsb.org/structure/1YQ7",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1YV5",
"url": "https://www.rcsb.org/structure/1YV5",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "1ZW5",
"url": "https://www.rcsb.org/structure/1ZW5",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2F7M",
"url": "https://www.rcsb.org/structure/2F7M",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2F89",
"url": "https://www.rcsb.org/structure/2F89",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2F8C",
"url": "https://www.rcsb.org/structure/2F8C",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2F8Z",
"url": "https://www.rcsb.org/structure/2F8Z",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2F92",
"url": "https://www.rcsb.org/structure/2F92",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2F94",
"url": "https://www.rcsb.org/structure/2F94",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2F9K",
"url": "https://www.rcsb.org/structure/2F9K",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2OPM",
"url": "https://www.rcsb.org/structure/2OPM",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2OPN",
"url": "https://www.rcsb.org/structure/2OPN",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2QIS",
"url": "https://www.rcsb.org/structure/2QIS",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2RAH",
"url": "https://www.rcsb.org/structure/2RAH",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "2VF6",
"url": "https://www.rcsb.org/structure/2VF6",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3B7L",
"url": "https://www.rcsb.org/structure/3B7L",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3CP6",
"url": "https://www.rcsb.org/structure/3CP6",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3N1V",
"url": "https://www.rcsb.org/structure/3N1V",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3N1W",
"url": "https://www.rcsb.org/structure/3N1W",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3N3L",
"url": "https://www.rcsb.org/structure/3N3L",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3N45",
"url": "https://www.rcsb.org/structure/3N45",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3N46",
"url": "https://www.rcsb.org/structure/3N46",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3N49",
"url": "https://www.rcsb.org/structure/3N49",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3N5H",
"url": "https://www.rcsb.org/structure/3N5H",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3N5J",
"url": "https://www.rcsb.org/structure/3N5J",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3N6K",
"url": "https://www.rcsb.org/structure/3N6K",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3RYE",
"url": "https://www.rcsb.org/structure/3RYE",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3S4J",
"url": "https://www.rcsb.org/structure/3S4J",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4DEM",
"url": "https://www.rcsb.org/structure/4DEM",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4GA3",
"url": "https://www.rcsb.org/structure/4GA3",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4H5C",
"url": "https://www.rcsb.org/structure/4H5C",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4H5D",
"url": "https://www.rcsb.org/structure/4H5D",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4H5E",
"url": "https://www.rcsb.org/structure/4H5E",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4JVJ",
"url": "https://www.rcsb.org/structure/4JVJ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4KFA",
"url": "https://www.rcsb.org/structure/4KFA",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4KPD",
"url": "https://www.rcsb.org/structure/4KPD",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4KPJ",
"url": "https://www.rcsb.org/structure/4KPJ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4KQ5",
"url": "https://www.rcsb.org/structure/4KQ5",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4KQS",
"url": "https://www.rcsb.org/structure/4KQS",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4KQU",
"url": "https://www.rcsb.org/structure/4KQU",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4L2X",
"url": "https://www.rcsb.org/structure/4L2X",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4LFV",
"url": "https://www.rcsb.org/structure/4LFV",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4LPG",
"url": "https://www.rcsb.org/structure/4LPG",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4LPH",
"url": "https://www.rcsb.org/structure/4LPH",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4N1Z",
"url": "https://www.rcsb.org/structure/4N1Z",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4N9U",
"url": "https://www.rcsb.org/structure/4N9U",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4NFI",
"url": "https://www.rcsb.org/structure/4NFI",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4NFJ",
"url": "https://www.rcsb.org/structure/4NFJ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4NFK",
"url": "https://www.rcsb.org/structure/4NFK",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4NG6",
"url": "https://www.rcsb.org/structure/4NG6",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4NKE",
"url": "https://www.rcsb.org/structure/4NKE",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4NKF",
"url": "https://www.rcsb.org/structure/4NKF",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4NUA",
"url": "https://www.rcsb.org/structure/4NUA",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4OGU",
"url": "https://www.rcsb.org/structure/4OGU",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4P0V",
"url": "https://www.rcsb.org/structure/4P0V",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4P0W",
"url": "https://www.rcsb.org/structure/4P0W",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4P0X",
"url": "https://www.rcsb.org/structure/4P0X",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4PVX",
"url": "https://www.rcsb.org/structure/4PVX",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4PVY",
"url": "https://www.rcsb.org/structure/4PVY",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4Q23",
"url": "https://www.rcsb.org/structure/4Q23",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4QPF",
"url": "https://www.rcsb.org/structure/4QPF",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4QXS",
"url": "https://www.rcsb.org/structure/4QXS",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4RXA",
"url": "https://www.rcsb.org/structure/4RXA",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4XQR",
"url": "https://www.rcsb.org/structure/4XQR",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4XQS",
"url": "https://www.rcsb.org/structure/4XQS",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "4XQT",
"url": "https://www.rcsb.org/structure/4XQT",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5DGM",
"url": "https://www.rcsb.org/structure/5DGM",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5DGN",
"url": "https://www.rcsb.org/structure/5DGN",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5DGS",
"url": "https://www.rcsb.org/structure/5DGS",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5DIQ",
"url": "https://www.rcsb.org/structure/5DIQ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5DJP",
"url": "https://www.rcsb.org/structure/5DJP",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5DJR",
"url": "https://www.rcsb.org/structure/5DJR",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5DJV",
"url": "https://www.rcsb.org/structure/5DJV",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5JA0",
"url": "https://www.rcsb.org/structure/5JA0",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5JUZ",
"url": "https://www.rcsb.org/structure/5JUZ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5JV0",
"url": "https://www.rcsb.org/structure/5JV0",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5JV1",
"url": "https://www.rcsb.org/structure/5JV1",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5JV2",
"url": "https://www.rcsb.org/structure/5JV2",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5KSX",
"url": "https://www.rcsb.org/structure/5KSX",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "5YGI",
"url": "https://www.rcsb.org/structure/5YGI",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6N7Y",
"url": "https://www.rcsb.org/structure/6N7Y",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6N7Z",
"url": "https://www.rcsb.org/structure/6N7Z",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6N82",
"url": "https://www.rcsb.org/structure/6N82",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6N83",
"url": "https://www.rcsb.org/structure/6N83",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6OAG",
"url": "https://www.rcsb.org/structure/6OAG",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6OAH",
"url": "https://www.rcsb.org/structure/6OAH",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "PF00348",
"url": "http://pfam.xfam.org/family/PF00348",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "P14324",
"url": "https://pharos.nih.gov/targets/P14324",
"database": "PHAROS",
"categories": [
"Organism-specific"
]
},
{
"id": "PR_P14324",
"url": "http://purl.obolibrary.org/obo/PR_P14324",
"database": "PRO",
"categories": [
"Protein"
]
},
{
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "NP_001129293",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129293",
"database": "RefSeq",
"categories": [
"Protein"
]
},
{
"id": "19361",
"url": "https://www.rhea-db.org/rhea/19361",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "22408",
"url": "https://www.rhea-db.org/rhea/22408",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "A0A087WTP2",
"url": "https://www.uniprot.org/uniprot/A0A087WTP2",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A087WTP2-1",
"url": "https://www.uniprot.org/uniprot/A0A087WTP2-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A087WVN4",
"url": "https://www.uniprot.org/uniprot/A0A087WVN4",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A087WVN4-1",
"url": "https://www.uniprot.org/uniprot/A0A087WVN4-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A087X090",
"url": "https://www.uniprot.org/uniprot/A0A087X090",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A087X090-1",
"url": "https://www.uniprot.org/uniprot/A0A087X090-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A087X1D8",
"url": "https://www.uniprot.org/uniprot/A0A087X1D8",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A087X1D8-1",
"url": "https://www.uniprot.org/uniprot/A0A087X1D8-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P14324-1",
"url": "https://www.uniprot.org/uniprot/P14324-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P14324-2",
"url": "https://www.uniprot.org/uniprot/P14324-2",
"database": "UniProtKB",
"categories": [
"Protein"
]
}
],
"sequence": {
"sequence": "MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRALCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAIGGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRGQICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLDLLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLEMGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKEAEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK",
"length": 419,
"header": "sp|P14324-1|FPPS_HUMAN Isoform 1 of Farnesyl pyrophosphate synthase OS=Homo sapiens OX=9606 GN=FDPS PE=1 SV=4 CANONICAL=P14324-1"
},
"isoforms": [
{
"isoform_ac": "A0A087WTP2-1",
"url": "",
"sequence": {
"sequence": "MNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKESLALSPGLECDGVISACCNLHLLGSSDSPASAF",
"length": 80,
"header": "tr|A0A087WTP2-1|FPPS_HUMAN Computationally mapped isoform of Farnesyl pyrophosphate synthase OS=Homo sapiens OX=9606 GN=FDPS PE=1 SV=1 CANONICAL=P14324-1"
},
"locus": {
"chromosome": "1",
"start_pos": 155310434,
"end_pos": 155310065,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000474345.5",
"url": "https://www.ensembl.org/id/ENST00000474345.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000478032.1",
"url": "https://www.ensembl.org/id/ENSP00000478032.1"
}
]
}
},
{
"isoform_ac": "A0A087WVN4-1",
"url": "",
"sequence": {
"sequence": "MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRALCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAIGGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRGQICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLDLLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYL",
"length": 274,
"header": "tr|A0A087WVN4-1|FPPS_HUMAN Computationally mapped isoform of Farnesyl pyrophosphate synthase OS=Homo sapiens OX=9606 GN=FDPS PE=1 SV=1 CANONICAL=P14324-1"
},
"locus": {
"chromosome": "1",
"start_pos": 155318904,
"end_pos": 155309790,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000491013.5",
"url": "https://www.ensembl.org/id/ENST00000491013.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000479557.1",
"url": "https://www.ensembl.org/id/ENSP00000479557.1"
}
]
}
},
{
"isoform_ac": "A0A087X090-1",
"url": "",
"sequence": {
"sequence": "MDSSLTRRGQICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLDLLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLEMGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKEAEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK",
"length": 248,
"header": "tr|A0A087X090-1|FPPS_HUMAN Computationally mapped isoform of Farnesyl pyrophosphate synthase OS=Homo sapiens OX=9606 GN=FDPS PE=1 SV=1 CANONICAL=P14324-1"
},
"locus": {
"chromosome": "1",
"start_pos": 155320606,
"end_pos": 155317974,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000611010.4",
"url": "https://www.ensembl.org/id/ENST00000611010.4"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000483188.1",
"url": "https://www.ensembl.org/id/ENSP00000483188.1"
}
]
}
},
{
"isoform_ac": "A0A087X1D8-1",
"url": "",
"sequence": {
"sequence": "MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRALCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAIGGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDS",
"length": 174,
"header": "tr|A0A087X1D8-1|FPPS_HUMAN Computationally mapped isoform of Farnesyl pyrophosphate synthase OS=Homo sapiens OX=9606 GN=FDPS PE=1 SV=1 CANONICAL=P14324-1"
},
"locus": {
"chromosome": "1",
"start_pos": 155317982,
"end_pos": 155309790,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000465559.5",
"url": "https://www.ensembl.org/id/ENST00000465559.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000484099.1",
"url": "https://www.ensembl.org/id/ENSP00000484099.1"
}
]
}
},
{
"isoform_ac": "P14324-1",
"url": "",
"sequence": {
"sequence": "MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRALCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAIGGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRGQICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLDLLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLEMGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKEAEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK",
"length": 419,
"header": "sp|P14324-1|FPPS_HUMAN Isoform 1 of Farnesyl pyrophosphate synthase OS=Homo sapiens OX=9606 GN=FDPS PE=1 SV=4 CANONICAL=P14324-1"
},
"locus": {
"chromosome": "1",
"start_pos": 155320606,
"end_pos": 155309790,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000356657.10",
"url": "https://www.ensembl.org/id/ENST00000356657.10"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000349078.6",
"url": "https://www.ensembl.org/id/ENSP00000349078.6"
}
]
}
},
{
"isoform_ac": "P14324-2",
"url": "",
"sequence": {
"sequence": "MNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAIGGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRGQICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLDLLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLEMGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKEAEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK",
"length": 353,
"header": "sp|P14324-2|FPPS_HUMAN Isoform 2 of Farnesyl pyrophosphate synthase OS=Homo sapiens OX=9606 GN=FDPS PE=1 SV=4 CANONICAL=P14324-1"
},
"locus": {
"chromosome": "1",
"start_pos": 155320606,
"end_pos": 155310065,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000467076.5",
"url": "https://www.ensembl.org/id/ENST00000467076.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000480142.1",
"url": "https://www.ensembl.org/id/ENSP00000480142.1"
}
]
}
}
],
"glycosylation": [
{
"glytoucan_ac": "G49108TO",
"type": "O-linked",
"subtype": "O-GlcNAcylation",
"site_category": "reported_with_glycan",
"site_seq": "S",
"relation": "attached",
"comment": "O-GlcNAcylation",
"start_pos": 4,
"start_aa": "Ser",
"end_pos": 4,
"end_aa": "Ser",
"residue": "Ser",
"site_lbl": "Ser4",
"evidence": [
{
"id": "P14324",
"database": "O-GlcNAc Database",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P14324"
},
{
"id": "34019948",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/34019948"
},
{
"id": "34725712",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/34725712"
},
{
"id": "33465208",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/33465208"
},
{
"id": "P14324",
"database": "O-GlcNAc Atlas",
"url": "https://oglcnac.org/atlas/detail/P14324"
}
]
}
],
"phosphorylation": [],
"glycation": [],
"keywords": [
"enzyme",
"glycoprotein",
"glycoprotein_reported_with_glycan"
],
"publication": [
{
"title": "Human geranylgeranyl diphosphate synthase. cDNA cloning and expression.",
"journal": "The Journal of biological chemistry",
"date": "1999",
"authors": "Kuzuguchi T, Morita Y, Sagami I, Sagami H, Ogura K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "10026212",
"url": "https://glygen.org/publication/PubMed/10026212"
}
]
},
{
"title": "Identification of conserved cis-elements and transcription factors required for sterol-regulated transcription of stearoyl-CoA desaturase 1 and 2.",
"journal": "The Journal of biological chemistry",
"date": "1999",
"authors": "Tabor DE, Kim JB, Spiegelman BM, Edwards PA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "10400691",
"url": "https://glygen.org/publication/PubMed/10400691"
}
]
},
{
"title": "Alendronate is a specific, nanomolar inhibitor of farnesyl diphosphate synthase.",
"journal": "Archives of biochemistry and biophysics",
"date": "2000",
"authors": "Bergstrom JD, Bostedor RG, Masarachia PJ, Reszka AA, Rodan G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "10620343",
"url": "https://glygen.org/publication/PubMed/10620343"
}
]
},
{
"title": "Cloning, heterologous expression, and enzymological characterization of human squalene monooxygenase.",
"journal": "Archives of biochemistry and biophysics",
"date": "2000",
"authors": "Laden BP, Tang Y, Porter TD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "10666321",
"url": "https://glygen.org/publication/PubMed/10666321"
}
]
},
{
"title": "Sterol regulation of human fatty acid synthase promoter I requires nuclear factor-Y- and Sp-1-binding sites.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2000",
"authors": "Xiong S, Chirala SS, Wakil SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "10759542",
"url": "https://glygen.org/publication/PubMed/10759542"
}
]
},
{
"title": "Crystal structure of human squalene synthase. A key enzyme in cholesterol biosynthesis.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Pandit J, Danley DE, Schulte GK, Mazzalupo S, Pauly TA, Hayward CM, Hamanaka ES, Thompson JF, Harwood HJ Jr",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "10896663",
"url": "https://glygen.org/publication/PubMed/10896663"
}
]
},
{
"title": "Mutations in yeast ARV1 alter intracellular sterol distribution and are complemented by human ARV1.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Tinkelenberg AH, Liu Y, Alcantara F, Khan S, Guo Z, Bard M, Sturley SL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "11063737",
"url": "https://glygen.org/publication/PubMed/11063737"
}
]
},
{
"title": "Structure-activity relationships for inhibition of farnesyl diphosphate synthase in vitro and inhibition of bone resorption in vivo by nitrogen-containing bisphosphonates.",
"journal": "The Journal of pharmacology and experimental therapeutics",
"date": "2001",
"authors": "Dunford JE, Thompson K, Coxon FP, Luckman SP, Hahn FM, Poulter CD, Ebetino FH, Rogers MJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "11160603",
"url": "https://glygen.org/publication/PubMed/11160603"
}
]
},
{
"title": "Cloning and characterization of the human stearoyl-CoA desaturase gene promoter: transcriptional activation by sterol regulatory element binding protein and repression by polyunsaturated fatty acids and cholesterol.",
"journal": "Biochemical and biophysical research communications",
"date": "2001",
"authors": "Bene H, Lasky D, Ntambi JM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "11414710",
"url": "https://glygen.org/publication/PubMed/11414710"
}
]
},
{
"title": "Oncoviral bovine leukemia virus G4 and human T-cell leukemia virus type 1 p13(II) accessory proteins interact with farnesyl pyrophosphate synthetase.",
"journal": "J. Virol.",
"date": "2002",
"authors": "Lef\u00e8bvre Laurent, Vanderplasschen Alain, Ciminale Vincenzo, Heremans Hubertine, Dangoisse Olivier, Jauniaux Jean-Claude, Toussaint Jean-Fran\u00e7ois, Zelnik Vlado, Burny Ars\u00e8ne, Kettmann Richard, Willems Luc",
"evidence": [
{
"database": "UniProtKB",
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324"
}
],
"reference": [
{
"type": "PubMed",
"id": "11773414",
"url": "https://glygen.org/publication/PubMed/11773414"
}
]
},
{
"title": "SREBP-2 and NF-Y are involved in the transcriptional regulation of squalene epoxidase.",
"journal": "Biochemical and biophysical research communications",
"date": "2002",
"authors": "Nagai M, Sakakibara J, Nakamura Y, Gejyo F, Ono T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "12083769",
"url": "https://glygen.org/publication/PubMed/12083769"
}
]
},
{
"title": "Yeast cells lacking the ARV1 gene harbor defects in sphingolipid metabolism. Complementation by human ARV1.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Swain E, Stukey J, McDonough V, Germann M, Liu Y, Sturley SL, Nickels JT Jr",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "12145310",
"url": "https://glygen.org/publication/PubMed/12145310"
}
]
},
{
"title": "Transcriptional activities of nuclear SREBP-1a, -1c, and -2 to different target promoters of lipogenic and cholesterogenic genes.",
"journal": "Journal of lipid research",
"date": "2002",
"authors": "Amemiya-Kudo M, Shimano H, Hasty AH, Yahagi N, Yoshikawa T, Matsuzaka T, Okazaki H, Tamura Y, Iizuka Y, Ohashi K, Osuga J, Harada K, Gotoda T, Sato R, Kimura S, Ishibashi S, Yamada N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "12177166",
"url": "https://glygen.org/publication/PubMed/12177166"
}
]
},
{
"title": "Autosomal recessive HEM/Greenberg skeletal dysplasia is caused by 3 beta-hydroxysterol delta 14-reductase deficiency due to mutations in the lamin B receptor gene.",
"journal": "American journal of human genetics",
"date": "2003",
"authors": "Waterham HR, Koster J, Mooyer P, Noort Gv Gv, Kelley RI, Wilcox WR, Wanders RJ, Hennekam RC, Oosterwijk JC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "12618959",
"url": "https://glygen.org/publication/PubMed/12618959"
}
]
},
{
"title": "Acetyl-CoA carboxylase beta gene is regulated by sterol regulatory element-binding protein-1 in liver.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Oh SY, Park SK, Kim JW, Ahn YH, Park SW, Kim KS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "12764144",
"url": "https://glygen.org/publication/PubMed/12764144"
}
]
},
{
"title": "Closing the gap: identification of human 3-ketosteroid reductase, the last unknown enzyme of mammalian cholesterol biosynthesis.",
"journal": "Molecular endocrinology (Baltimore, Md.)",
"date": "2003",
"authors": "Marijanovic Z, Laubner D, Moller G, Gege C, Husen B, Adamski J, Breitling R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "12829805",
"url": "https://glygen.org/publication/PubMed/12829805"
}
]
},
{
"title": "Molecular cloning of human mevalonate kinase and identification of a missense mutation in the genetic disease mevalonic aciduria.",
"journal": "The Journal of biological chemistry",
"date": "1992",
"authors": "Schafer BL, Bishop RW, Kratunis VJ, Kalinowski SS, Mosley ST, Gibson KM, Tanaka RD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "1377680",
"url": "https://glygen.org/publication/PubMed/1377680"
}
]
},
{
"title": "Preputial gland tumor sterols. 3. A metabolic pathway from lanosterol to cholesterol.",
"journal": "The Journal of biological chemistry",
"date": "1960",
"authors": "KANDUTSCH AA, RUSSELL AE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "14404284",
"url": "https://glygen.org/publication/PubMed/14404284"
}
]
},
{
"title": "NSDHL, an enzyme involved in cholesterol biosynthesis, traffics through the Golgi and accumulates on ER membranes and on the surface of lipid droplets.",
"journal": "Human molecular genetics",
"date": "2003",
"authors": "Caldas H, Herman GE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "14506130",
"url": "https://glygen.org/publication/PubMed/14506130"
}
]
},
{
"title": "Phosphomevalonate kinase is a cytosolic protein in humans.",
"journal": "Journal of lipid research",
"date": "2004",
"authors": "Hogenboom S, Tuyp JJ, Espeel M, Koster J, Wanders RJ, Waterham HR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "14729858",
"url": "https://glygen.org/publication/PubMed/14729858"
}
]
},
{
"title": "Mevalonate kinase is a cytosolic enzyme in humans.",
"journal": "Journal of cell science",
"date": "2004",
"authors": "Hogenboom S, Tuyp JJ, Espeel M, Koster J, Wanders RJ, Waterham HR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "14730012",
"url": "https://glygen.org/publication/PubMed/14730012"
}
]
},
{
"title": "Farnesyl diphosphate synthase; regulation of product specificity.",
"journal": "Acta Biochim. Pol.",
"date": "2005",
"authors": "Szkopi\u0144ska Anna, P\u0142ochocka Danuta",
"evidence": [
{
"database": "UniProtKB",
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324"
}
],
"reference": [
{
"type": "PubMed",
"id": "15827605",
"url": "https://glygen.org/publication/PubMed/15827605"
}
]
},
{
"title": "Identification and functional characterization of a presqualene diphosphate phosphatase.",
"journal": "The Journal of biological chemistry",
"date": "2006",
"authors": "Fukunaga K, Arita M, Takahashi M, Morris AJ, Pfeffer M, Levy BD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "16464866",
"url": "https://glygen.org/publication/PubMed/16464866"
}
]
},
{
"title": "Phosphomevalonate kinase: functional investigation of the recombinant human enzyme.",
"journal": "Biochemistry",
"date": "2006",
"authors": "Herdendorf TJ, Miziorko HM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "16519518",
"url": "https://glygen.org/publication/PubMed/16519518"
}
]
},
{
"title": "The molecular mechanism of nitrogen-containing bisphosphonates as antiosteoporosis drugs.",
"journal": "Proc. Natl. Acad. Sci. U.S.A.",
"date": "2006",
"authors": "Kavanagh KL, Guo K, Dunford JE, Wu X, Knapp S, Ebetino FH, Rogers MJ, Russell RG, Oppermann U",
"evidence": [
{
"database": "UniProtKB",
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324"
},
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "16684881",
"url": "https://glygen.org/publication/PubMed/16684881"
}
]
},
{
"title": "Sterol dependent regulation of human TM7SF2 gene expression: role of the encoded 3beta-hydroxysterol Delta14-reductase in human cholesterol biosynthesis.",
"journal": "Biochimica et biophysica acta",
"date": "2006",
"authors": "Bennati AM, Castelli M, Della Fazia MA, Beccari T, Caruso D, Servillo G, Roberti R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "16784888",
"url": "https://glygen.org/publication/PubMed/16784888"
}
]
},
{
"title": "Structural basis for the exceptional in vivo efficacy of bisphosphonate drugs.",
"journal": "ChemMedChem",
"date": "2006",
"authors": "Rondeau Jean-Michel, Bitsch Francis, Bourgier Emmanuelle, Geiser Martin, Hemmig Rene, Kroemer Markus, Lehmann Sylvie, Ramage Paul, Rieffel Sebastien, Strauss Andr\u00e9, Green Jonathan R, Jahnke Wolfgang",
"evidence": [
{
"database": "UniProtKB",
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324"
}
],
"reference": [
{
"type": "PubMed",
"id": "16892359",
"url": "https://glygen.org/publication/PubMed/16892359"
}
]
},
{
"title": "Genistein downregulates SREBP-1 regulated gene expression by inhibiting site-1 protease expression in HepG2 cells.",
"journal": "The Journal of nutrition",
"date": "2007",
"authors": "Shin ES, Lee HH, Cho SY, Park HW, Lee SJ, Lee TR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "17449569",
"url": "https://glygen.org/publication/PubMed/17449569"
}
]
},
{
"title": "Histone deacetylase 3 down-regulates cholesterol synthesis through repression of lanosterol synthase gene expression.",
"journal": "The Journal of biological chemistry",
"date": "2007",
"authors": "Villagra A, Ulloa N, Zhang X, Yuan Z, Sotomayor E, Seto E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "17925399",
"url": "https://glygen.org/publication/PubMed/17925399"
}
]
},
{
"title": "The interferon-inducible protein viperin inhibits influenza virus release by perturbing lipid rafts.",
"journal": "Cell Host Microbe",
"date": "2007",
"authors": "Wang Xiuyan, Hinson Ella R, Cresswell Peter",
"evidence": [
{
"database": "UniProtKB",
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324"
}
],
"reference": [
{
"type": "PubMed",
"id": "18005724",
"url": "https://glygen.org/publication/PubMed/18005724"
}
]
},
{
"title": "Structure-activity relationships among the nitrogen containing bisphosphonates in clinical use and other analogues: time-dependent inhibition of human farnesyl pyrophosphate synthase.",
"journal": "Journal of medicinal chemistry",
"date": "2008",
"authors": "Dunford JE, Kwaasi AA, Rogers MJ, Barnett BL, Ebetino FH, Russell RG, Oppermann U, Kavanagh KL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "18327899",
"url": "https://glygen.org/publication/PubMed/18327899"
}
]
},
{
"title": "Microarray analyses of SREBP-1a and SREBP-1c target genes identify new regulatory pathways in muscle.",
"journal": "Physiological genomics",
"date": "2008",
"authors": "Rome S, Lecomte V, Meugnier E, Rieusset J, Debard C, Euthine V, Vidal H, Lefai E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "18559965",
"url": "https://glygen.org/publication/PubMed/18559965"
}
]
},
{
"title": "Genome-wide occupancy of SREBP1 and its partners NFY and SP1 reveals novel functional roles and combinatorial regulation of distinct classes of genes.",
"journal": "PLoS genetics",
"date": "2008",
"authors": "Reed BD, Charos AE, Szekely AM, Weissman SM, Snyder M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "18654640",
"url": "https://glygen.org/publication/PubMed/18654640"
}
]
},
{
"title": "Proto-oncogene FBI-1 (Pokemon) and SREBP-1 synergistically activate transcription of fatty-acid synthase gene (FASN).",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Choi WI, Jeon BN, Park H, Yoo JY, Kim YS, Koh DI, Kim MH, Kim YR, Lee CE, Kim KS, Osborne TF, Hur MW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "18682402",
"url": "https://glygen.org/publication/PubMed/18682402"
}
]
},
{
"title": "cDNA cloning, chromosome mapping and expression characterization of human geranylgeranyl pyrophosphate synthase.",
"journal": "Science in China. Series C, Life sciences",
"date": "2000",
"authors": "Zhao Y, Yu L, Gao J, Fu Q, Hua Y, Zhang H, Zhao S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "18726356",
"url": "https://glygen.org/publication/PubMed/18726356"
}
]
},
{
"title": "Design, synthesis, and biological evaluation of novel aminobisphosphonates possessing an in vivo antitumor activity through a gammadelta-T lymphocytes-mediated activation mechanism.",
"journal": "Journal of medicinal chemistry",
"date": "2008",
"authors": "Simoni D, Gebbia N, Invidiata FP, Eleopra M, Marchetti P, Rondanin R, Baruchello R, Provera S, Marchioro C, Tolomeo M, Marinelli L, Limongelli V, Novellino E, Kwaasi A, Dunford J, Buccheri S, Caccamo N, Dieli F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "18937434",
"url": "https://glygen.org/publication/PubMed/18937434"
}
]
},
{
"title": "Lipophilic bisphosphonates as dual farnesyl/geranylgeranyl diphosphate synthase inhibitors: an X-ray and NMR investigation.",
"journal": "J. Am. Chem. Soc.",
"date": "2009",
"authors": "Zhang Yonghui, Cao Rong, Yin Fenglin, Hudock Michael P, Guo Rey-Ting, Krysiak Kilannin, Mukherjee Sujoy, Gao Yi-Gui, Robinson Howard, Song Yongcheng, No Joo Hwan, Bergan Kyle, Leon Annette, Cass Lauren, Goddard Amanda, Chang Ting-Kai, Lin Fu-Yang, Van Beek Ermond, Papapoulos Socrates, Wang Andrew H-J, Kubo Tadahiko, Ochi Mitsuo, Mukkamala Dushyant, Oldfield Eric",
"evidence": [
{
"database": "UniProtKB",
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324"
}
],
"reference": [
{
"type": "PubMed",
"id": "19309137",
"url": "https://glygen.org/publication/PubMed/19309137"
}
]
},
{
"title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.",
"journal": "Science (New York, N.Y.)",
"date": "2009",
"authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M",
"evidence": [
{
"database": "UniProtKB",
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324"
}
],
"reference": [
{
"type": "PubMed",
"id": "19608861",
"url": "https://glygen.org/publication/PubMed/19608861"
}
]
},
{
"title": "Isolation and sequence of the human farnesyl pyrophosphate synthetase cDNA. Coordinate regulation of the mRNAs for farnesyl pyrophosphate synthetase, 3-hydroxy-3-methylglutaryl coenzyme A reductase, and 3-hydroxy-3-methylglutaryl coenzyme A synthase by phorbol ester.",
"journal": "J. Biol. Chem.",
"date": "1990",
"authors": "Wilkin DJ, Kutsunai SY, Edwards PA",
"evidence": [
{
"database": "UniProtKB",
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324"
},
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "1968462",
"url": "https://glygen.org/publication/PubMed/1968462"
}
]
},
{
"title": "Activation of TM7SF2 promoter by SREBP-2 depends on a new sterol regulatory element, a GC-box, and an inverted CCAAT-box.",
"journal": "Biochimica et biophysica acta",
"date": "2010",
"authors": "Schiavoni G, Bennati AM, Castelli M, Della Fazia MA, Beccari T, Servillo G, Roberti R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "20138239",
"url": "https://glygen.org/publication/PubMed/20138239"
}
]
},
{
"title": "Synthesis, chiral high performance liquid chromatographic resolution and enantiospecific activity of a potent new geranylgeranyl transferase inhibitor, 2-hydroxy-3-imidazo[1,2-a]pyridin-3-yl-2-phosphonopropionic acid.",
"journal": "Journal of medicinal chemistry",
"date": "2010",
"authors": "McKenna CE, Kashemirov BA, Blazewska KM, Mallard-Favier I, Stewart CA, Rojas J, Lundy MW, Ebetino FH, Baron RA, Dunford JE, Kirsten ML, Seabra MC, Bala JL, Marma MS, Rogers MJ, Coxon FP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "20394422",
"url": "https://glygen.org/publication/PubMed/20394422"
}
]
},
{
"title": "Sterol-regulatory-element-binding protein 2 and nuclear factor Y control human farnesyl diphosphate synthase expression and affect cell proliferation in hepatoblastoma cells.",
"journal": "The Biochemical journal",
"date": "2010",
"authors": "Ishimoto K, Tachibana K, Hanano I, Yamasaki D, Nakamura H, Kawai M, Urano Y, Tanaka T, Hamakubo T, Sakai J, Kodama T, Doi T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "20450493",
"url": "https://glygen.org/publication/PubMed/20450493"
}
]
},
{
"title": "Expression and regulation of GPAT isoforms in cultured human keratinocytes and rodent epidermis.",
"journal": "Journal of lipid research",
"date": "2010",
"authors": "Lu B, Jiang YJ, Kim P, Moser A, Elias PM, Grunfeld C, Feingold KR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "20719759",
"url": "https://glygen.org/publication/PubMed/20719759"
}
]
},
{
"title": "ELOVL1 production of C24 acyl-CoAs is linked to C24 sphingolipid synthesis.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2010",
"authors": "Ohno Y, Suto S, Yamanaka M, Mizutani Y, Mitsutake S, Igarashi Y, Sassa T, Kihara A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "20937905",
"url": "https://glygen.org/publication/PubMed/20937905"
}
]
},
{
"title": "Correlation between time-dependent inhibition of human farnesyl pyrophosphate synthase and blockade of mevalonate pathway by nitrogen-containing bisphosphonates in cultured cells.",
"journal": "Biochemical and biophysical research communications",
"date": "2011",
"authors": "Raikkonen J, Taskinen M, Dunford JE, Monkkonen H, Auriola S, Monkkonen J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "21420384",
"url": "https://glygen.org/publication/PubMed/21420384"
}
]
},
{
"title": "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features.",
"journal": "Mol. Cell. Proteomics",
"date": "2012",
"authors": "Bienvenut WV, Sumpton D, Martinez A, Lilla S, Espagne C, Meinnel T, Giglione C",
"evidence": [
{
"database": "UniProtKB",
"id": "A0A087WVN4",
"url": "https://www.uniprot.org/uniprot/A0A087WVN4"
}
],
"reference": [
{
"type": "PubMed",
"id": "22223895",
"url": "https://glygen.org/publication/PubMed/22223895"
}
]
},
{
"title": "Identification and functional characterization of human glycerol-3-phosphate acyltransferase 1 gene promoters.",
"journal": "Biochemical and biophysical research communications",
"date": "2012",
"authors": "Harada N, Fujimoto E, Okuyama M, Sakaue H, Nakaya Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "22634312",
"url": "https://glygen.org/publication/PubMed/22634312"
}
]
},
{
"title": "Promoter analysis of the DHCR24 (3beta-hydroxysterol Delta(24)-reductase) gene: characterization of SREBP (sterol-regulatory-element-binding protein)-mediated activation.",
"journal": "Bioscience reports",
"date": "2012",
"authors": "Daimiel LA, Fernandez-Suarez ME, Rodriguez-Acebes S, Crespo L, Lasuncion MA, Gomez-Coronado D, Martinez-Botas J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "23050906",
"url": "https://glygen.org/publication/PubMed/23050906"
}
]
},
{
"title": "Genomic variations of the mevalonate pathway in porokeratosis.",
"journal": "eLife",
"date": "2015",
"authors": "Zhang Z, Li C, Wu F, Ma R, Luan J, Yang F, Liu W, Wang L, Zhang S, Liu Y, Gu J, Hua W, Fan M, Peng H, Meng X, Song N, Bi X, Gu C, Zhang Z, Huang Q, Chen L, Xiang L, Xu J, Zheng Z, Jiang Z",
"evidence": [
{
"database": "UniProtKB",
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324"
}
],
"reference": [
{
"type": "PubMed",
"id": "26202976",
"url": "https://glygen.org/publication/PubMed/26202976"
}
]
},
{
"title": "Cloning, analysis, and bacterial expression of human farnesyl pyrophosphate synthetase and its regulation in Hep G2 cells.",
"journal": "Biochemistry",
"date": "1989",
"authors": "Sheares B T, White S S, Molowa D T, Chan K, Ding V D, Kroon P A, Bostedor R G, Karkas J D",
"evidence": [
{
"database": "UniProtKB",
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324"
}
],
"reference": [
{
"type": "PubMed",
"id": "2690933",
"url": "https://glygen.org/publication/PubMed/2690933"
}
]
},
{
"title": "Landscape of the regulatory elements for lysine 2-hydroxyisobutyrylation pathway.",
"journal": "Cell research",
"date": "2018",
"authors": "Huang H, Luo Z, Qi S, Huang J, Xu P, Wang X, Gao L, Li F, Wang J, Zhao W, Gu W, Chen Z, Dai L, Dai J, Zhao Y",
"evidence": [
{
"database": "UniProtKB",
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324"
}
],
"reference": [
{
"type": "PubMed",
"id": "29192674",
"url": "https://glygen.org/publication/PubMed/29192674"
}
]
},
{
"title": "Structure, catalysis, and inhibition mechanism of prenyltransferase.",
"journal": "IUBMB life",
"date": "2021",
"authors": "Chang HY, Cheng TH, Wang AH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "33246356",
"url": "https://glygen.org/publication/PubMed/33246356"
}
]
},
{
"title": "A new tandem enrichment strategy for the simultaneous profiling of O-GlcNAcylation and phosphorylation in RNA-binding proteome.",
"journal": "The Analyst",
"date": "2021",
"authors": "Fan Z, Li J, Liu T, Zhang Z, Qin W, Qian X",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P14324",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P14324"
},
{
"database": "O-GlcNAc Atlas",
"id": "P14324",
"url": "https://oglcnac.org/atlas/detail/P14324"
}
],
"reference": [
{
"type": "PubMed",
"id": "33465208",
"url": "https://glygen.org/publication/PubMed/33465208"
}
]
},
{
"title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.",
"journal": "Biochimica et biophysica acta. General subjects",
"date": "2021",
"authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P14324",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P14324"
}
],
"reference": [
{
"type": "PubMed",
"id": "34019948",
"url": "https://glygen.org/publication/PubMed/34019948"
}
]
},
{
"title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.",
"journal": "Analytical and bioanalytical chemistry",
"date": "2021",
"authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P14324",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P14324"
}
],
"reference": [
{
"type": "PubMed",
"id": "34725712",
"url": "https://glygen.org/publication/PubMed/34725712"
}
]
},
{
"title": "Novel missense mutations of MVK and FDPS gene in Chinese patients with disseminated superficial actinic porokeratosis.",
"journal": "Clinica chimica acta; international journal of clinical chemistry",
"date": "2021",
"authors": "Li L, Zuo N, Yang D, Zhang D, Feng Y, Li X",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001129293",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129293"
}
],
"reference": [
{
"type": "PubMed",
"id": "34751146",
"url": "https://glygen.org/publication/PubMed/34751146"
}
]
},
{
"title": "Towards an Improvement of Anticancer Activity of Benzyl Adenosine Analogs.",
"journal": "Molecules (Basel, Switzerland)",
"date": "2021",
"authors": "Covelli V, Grimaldi M, Randino R, Firoznezhad M, Proto MC, Simone V, Matteoli G, Gazzerro P, Bifulco M, D'Ursi AM, Rodriquez M",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001129293",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129293"
}
],
"reference": [
{
"type": "PubMed",
"id": "34885721",
"url": "https://glygen.org/publication/PubMed/34885721"
}
]
},
{
"title": "Farnesyl diphosphate synthase exacerbates nonalcoholic steatohepatitis via the activation of AHR-CD36 axis.",
"journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology",
"date": "2023-07",
"authors": "Liu Jun, Zhang Xinxin, Zhang Yufei, Qian Minyi, Yang Maohui, Yang Song, Wang Lirui",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001129293",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129293"
}
],
"reference": [
{
"type": "PubMed",
"id": "37310396",
"url": "https://glygen.org/publication/PubMed/37310396"
}
]
},
{
"title": "Enzymic conversion of squalene 2,3-oxide to lanosterol and cholesterol.",
"journal": "Journal of the American Chemical Society",
"date": "1966",
"authors": "Van Tamelen EE, Willett JD, Clayton RB, Lord KE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "5918048",
"url": "https://glygen.org/publication/PubMed/5918048"
}
]
},
{
"title": "Human fatty acid synthase: properties and molecular cloning.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1995",
"authors": "Jayakumar A, Tai MH, Huang WY, al-Feel W, Hsu M, Abu-Elheiga L, Chirala SS, Wakil SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "7567999",
"url": "https://glygen.org/publication/PubMed/7567999"
}
]
},
{
"title": "Sterol regulation of fatty acid synthase promoter. Coordinate feedback regulation of two major lipid pathways.",
"journal": "The Journal of biological chemistry",
"date": "1995",
"authors": "Bennett MK, Lopez JM, Sanchez HB, Osborne TF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "7592729",
"url": "https://glygen.org/publication/PubMed/7592729"
}
]
},
{
"title": "Human acetyl-CoA carboxylase: characterization, molecular cloning, and evidence for two isoforms.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1995",
"authors": "Abu-Elheiga L, Jayakumar A, Baldini A, Chirala SS, Wakil SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "7732023",
"url": "https://glygen.org/publication/PubMed/7732023"
}
]
},
{
"title": "Partial characterization of a cDNA for human stearoyl-CoA desaturase and changes in its mRNA expression in some normal and malignant tissues.",
"journal": "International journal of cancer",
"date": "1994",
"authors": "Li J, Ding SF, Habib NA, Fermor BF, Wood CB, Gilmour RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "7909540",
"url": "https://glygen.org/publication/PubMed/7909540"
}
]
},
{
"title": "Molecular cloning and nucleotide sequence of complementary DNA for human hepatic cytosolic acetoacetyl-coenzyme A thiolase.",
"journal": "Biochemical and biophysical research communications",
"date": "1994",
"authors": "Song XQ, Fukao T, Yamaguchi S, Miyazawa S, Hashimoto T, Orii T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "7911016",
"url": "https://glygen.org/publication/PubMed/7911016"
}
]
},
{
"title": "Human cytoplasmic 3-hydroxy-3-methylglutaryl coenzyme A synthase: expression, purification, and characterization of recombinant wild-type and Cys129 mutant enzymes.",
"journal": "Archives of biochemistry and biophysics",
"date": "1994",
"authors": "Rokosz LL, Boulton DA, Butkiewicz EA, Sanyal G, Cueto MA, Lachance PA, Hermes JD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "7913309",
"url": "https://glygen.org/publication/PubMed/7913309"
}
]
},
{
"title": "A human promyelocyte mRNA transiently induced by TPA is homologous to yeast IPP isomerase.",
"journal": "Genomics",
"date": "1994",
"authors": "Xuan JW, Kowalski J, Chambers AF, Denhardt DT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "8020941",
"url": "https://glygen.org/publication/PubMed/8020941"
}
]
},
{
"title": "Molecular cloning of cDNA encoding human lanosterol synthase.",
"journal": "Biological & pharmaceutical bulletin",
"date": "1995",
"authors": "Sung CK, Shibuya M, Sankawa U, Ebizuka Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "8593458",
"url": "https://glygen.org/publication/PubMed/8593458"
}
]
},
{
"title": "The ubiquitously expressed human CYP51 encodes lanosterol 14 alpha-demethylase, a cytochrome P450 whose expression is regulated by oxysterols.",
"journal": "Archives of biochemistry and biophysics",
"date": "1996",
"authors": "Stromstedt M, Rozman D, Waterman MR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "8619637",
"url": "https://glygen.org/publication/PubMed/8619637"
}
]
},
{
"title": "Molecular cloning and expression of the cDNAs encoding human and yeast mevalonate pyrophosphate decarboxylase.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Toth MJ, Huwyler L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "8626466",
"url": "https://glygen.org/publication/PubMed/8626466"
}
]
},
{
"title": "Transcriptional regulation of squalene epoxidase by sterols and inhibitors in HeLa cells.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Nakamura Y, Sakakibara J, Izumi T, Shibata A, Ono T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "8626488",
"url": "https://glygen.org/publication/PubMed/8626488"
}
]
},
{
"title": "A direct role for sterol regulatory element binding protein in activation of 3-hydroxy-3-methylglutaryl coenzyme A reductase gene.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Vallett SM, Sanchez HB, Rosenfeld JM, Osborne TF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "8647822",
"url": "https://glygen.org/publication/PubMed/8647822"
}
]
},
{
"title": "Characterization of yeast methyl sterol oxidase (ERG25) and identification of a human homologue.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Li L, Kaplan J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "8663358",
"url": "https://glygen.org/publication/PubMed/8663358"
}
]
},
{
"title": "Molecular cloning of human phosphomevalonate kinase and identification of a consensus peroxisomal targeting sequence.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Chambliss KL, Slaughter CA, Schreiner R, Hoffmann GF, Gibson KM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "8663599",
"url": "https://glygen.org/publication/PubMed/8663599"
}
]
},
{
"title": "Synergistic binding of sterol regulatory element-binding protein and NF-Y to the farnesyl diphosphate synthase promoter is critical for sterol-regulated expression of the gene.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Ericsson J, Jackson SM, Edwards PA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "8798690",
"url": "https://glygen.org/publication/PubMed/8798690"
}
]
},
{
"title": "Human isopentenyl diphosphate: dimethylallyl diphosphate isomerase: overproduction, purification, and characterization.",
"journal": "Archives of biochemistry and biophysics",
"date": "1996",
"authors": "Hahn FM, Xuan JW, Chambers AF, Poulter CD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "8806705",
"url": "https://glygen.org/publication/PubMed/8806705"
}
]
},
{
"title": "Molecular cloning and mapping of a human cDNA (SC5DL) encoding a protein homologous to fungal sterol-C5-desaturase.",
"journal": "Cytogenetics and cell genetics",
"date": "1996",
"authors": "Matsushima M, Inazawa J, Takahashi E, Suzumori K, Nakamura Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "8976377",
"url": "https://glygen.org/publication/PubMed/8976377"
}
]
},
{
"title": "Human acetyl-CoA carboxylase 2. Molecular cloning, characterization, chromosomal mapping, and evidence for two isoforms.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Abu-Elheiga L, Almarza-Ortega DB, Baldini A, Wakil SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "9099716",
"url": "https://glygen.org/publication/PubMed/9099716"
}
]
},
{
"title": "Enzymes of ketone body utilization in human tissues: protein and messenger RNA levels of succinyl-coenzyme A (CoA):3-ketoacid CoA transferase and mitochondrial and cytosolic acetoacetyl-CoA thiolases.",
"journal": "Pediatric research",
"date": "1997",
"authors": "Fukao T, Song XQ, Mitchell GA, Yamaguchi S, Sukegawa K, Orii T, Kondo N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "9380443",
"url": "https://glygen.org/publication/PubMed/9380443"
}
]
},
{
"title": "Multiple DNA elements for sterol regulatory element-binding protein and NF-Y are responsible for sterol-regulated transcription of the genes for human 3-hydroxy-3-methylglutaryl coenzyme A synthase and squalene synthase.",
"journal": "Journal of biochemistry",
"date": "1998",
"authors": "Inoue J, Sato R, Maeda M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "9604010",
"url": "https://glygen.org/publication/PubMed/9604010"
}
]
},
{
"title": "Mutations in the human sterol delta7-reductase gene at 11q12-13 cause Smith-Lemli-Opitz syndrome.",
"journal": "American journal of human genetics",
"date": "1998",
"authors": "Wassif CA, Maslen C, Kachilele-Linjewile S, Lin D, Linck LM, Connor WE, Steiner RD, Porter FD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "9634533",
"url": "https://glygen.org/publication/PubMed/9634533"
}
]
},
{
"title": "Human geranylgeranyl diphosphate synthase: isolation of the cDNA, chromosomal mapping and tissue expression.",
"journal": "Journal of lipid research",
"date": "1998",
"authors": "Ericsson J, Greene JM, Carter KC, Shell BK, Duan DR, Florence C, Edwards PA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-191273",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273"
}
],
"reference": [
{
"type": "PubMed",
"id": "9741684",
"url": "https://glygen.org/publication/PubMed/9741684"
}
]
},
{
"title": "Differential stimulation of cholesterol and unsaturated fatty acid biosynthesis in cells expressing individual nuclear sterol regulatory element-binding proteins.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Pai JT, Guryev O, Brown MS, Goldstein JL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2426168",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168"
}
],
"reference": [
{
"type": "PubMed",
"id": "9748295",
"url": "https://glygen.org/publication/PubMed/9748295"
}
]
}
],
"pathway": [
{
"id": "hsa:2224",
"name": "",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2224",
"resource": "KEGG Pathway"
},
{
"id": "R-HSA-191273",
"name": "Cholesterol biosynthesis",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191273",
"resource": "Reactome",
"description": "Cholesterol biosynthesis"
},
{
"id": "R-HSA-2426168",
"name": "Activation of gene expression by SREBF (SREBP)",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2426168",
"resource": "Reactome",
"description": "Activation of gene expression by SREBF (SREBP)"
}
],
"orthologs": [
{
"uniprot_canonical_ac": "P05369-1",
"protein_name": "Farnesyl pyrophosphate synthase",
"gene_name": "Fdps",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MNGDQKLDVHNQEKQNFIQHFSQIVKVLTEDELGHPEKGDAITRIKEVLEYNTVGGKYNRGLTVVQTFQELVEPRKQDAESLQRALTVGWCVELLQAFFLVLDDIMDSSYTRRGQICWYQKPGIGLDAINDALLLEAAIYRLLKFYCREQPYYLNLLELFLQSSYQTEIGQTLDLITAPQGQVDLGRYTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANALKILLEMGEFFQIQDDYLDLFGDPSVTGKVGTDIQDNKCSWLVVQCLLRATPQQRQILEENYGQKDPEKVARVKALYEELDLRSVFFKYEEDSYNRLKSLIEQCSAPLPPSIFLELANKIYKRRK",
"length": 353
},
"evidence": [
{
"id": "45926230",
"url": "http://www.informatics.jax.org/homology/45926230",
"database": "MGI"
}
],
"common_name": "Rat"
},
{
"uniprot_canonical_ac": "P08524-1",
"protein_name": "Farnesyl pyrophosphate synthase",
"gene_name": "ERG20",
"tax_id": 559292,
"organism": "Saccharomyces cerevisiae S288C",
"sequence": {
"sequence": "MASEKEIRRERFLNVFPKLVEELNASLLAYGMPKEACDWYAHSLNYNTPGGKLNRGLSVVDTYAILSNKTVEQLGQEEYEKVAILGWCIELLQAYFLVADDMMDKSITRRGQPCWYKVPEVGEIAINDAFMLEAAIYKLLKSHFRNEKYYIDITELFHEVTFQTELGQLMDLITAPEDKVDLSKFSLKKHSFIVTFKTAYYSFYLPVALAMYVAGITDEKDLKQARDVLIPLGEYFQIQDDYLDCFGTPEQIGKIGTDIQDNKCSWVINKALELASAEQRKTLDENYGKKDSVAEAKCKKIFNDLKIEQLYHEYEESIAKDLKAKISQVDESRGFKADVLTAFLNKVYKRSK",
"length": 352
},
"evidence": [
{
"id": "P14324",
"url": "https://omabrowser.org/oma/group/P14324/",
"database": "OMA"
}
],
"common_name": "Yeast"
},
{
"uniprot_canonical_ac": "Q7KN61-1",
"protein_name": "Farnesyl pyrophosphate synthase",
"gene_name": "Fpps",
"tax_id": 7227,
"organism": "Drosophila melanogaster",
"sequence": {
"sequence": "MFKLARMLLPQQRILASPLRLQRLISTSDEVNAEPIIKSMDTIGGLPTELVNEQKLKKTSRTLSTLQNHSVPIAARVTVSKDESRDFMAVFPDLVRDITTVTKAYNCSDAAKWFAQVLQYNVPRGKKNRGILTVLTYKNLVPTQDLTPENIKLAQYLGWCVEMLQSFFIISDDVMDNSTTRRGQPCWHKVENVGLTAINDALMIENAMYAILKKHFSHLDCYVALMELFHEITYITTCGQSLDQLNSNRCVSEFTMENYKAIVENKTAYYSFYLPFALALHLAGYKDAEAFRQSKTILLEMGNFFQVQDDFLDCFGNPEVTGKIGTDIQDNKCSWLAVVAMQRANVEQKQIMVDCYGKEEPAKVERVKELYKELGLPSTYAIFEEESYNMIKTHIQQTSRGVPHQTFLQILNKIYQRDS",
"length": 419
},
"evidence": [
{
"id": "P14324",
"url": "https://omabrowser.org/oma/group/P14324/",
"database": "OMA"
}
],
"common_name": "Fruit fly"
},
{
"uniprot_canonical_ac": "Q920E5-1",
"protein_name": "Farnesyl pyrophosphate synthase",
"gene_name": "Fdps",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MNGNQKLDAYNQEKQNFIQHFSQIVKVLTEKELGHPEIGDAIARLKEVLEYNALGGKYNRGLTVVQAFQELVEPKKQDAESLQRALTVGWCVELLQAFFLVSDDIMDSSLTRRGQICWYQKPGIGLDAINDALLLEASIYRLLKFYCREQPYYLNLLELFLQSSYQTEIGQTLDLMTAPQGHVDLGRYTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANALKILMEMGEFFQVQDDYLDLFGDPSVTGKVGTDIQDNKCSWLVVQCLLRASPQQRQILEENYGQKDPEKVARVKALYEALDLQSAFFKYEEDSYNRLKSLIEQCSAPLPPSIFMELANKIYKRRK",
"length": 353
},
"evidence": [
{
"id": "45926230",
"url": "http://www.informatics.jax.org/homology/45926230",
"database": "MGI"
},
{
"id": "P14324",
"url": "https://omabrowser.org/oma/group/P14324/",
"database": "OMA"
}
],
"common_name": "Mouse"
}
],
"go_annotation": {
"categories": [
{
"name": "Cellular Component",
"total": 4,
"go_terms": [
{
"name": "nucleoplasm",
"id": "GO:0005654",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654",
"evidence": [
{
"database": "UniProtKB",
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324"
}
],
"pmid": ""
},
{
"name": "cytosol",
"id": "GO:0005829",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829",
"evidence": [
{
"database": "UniProtKB",
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324"
}
],
"pmid": ""
},
{
"name": "cytoplasm",
"id": "GO:0005737",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737",
"evidence": [
{
"database": "UniProtKB",
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324"
}
],
"pmid": ""
},
{
"name": "membrane",
"id": "GO:0016020",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020",
"evidence": [
{
"database": "UniProtKB",
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324"
}
],
"pmid": ""
}
]
},
{
"name": "Molecular Function",
"total": 5,
"go_terms": [
{
"name": "transferase activity, transferring alkyl or aryl (other than methyl) groups",
"id": "GO:0016765",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016765",
"evidence": [
{
"database": "UniProtKB",
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324"
}
],
"pmid": ""
},
{
"name": "dimethylallyltranstransferase activity",
"id": "GO:0004161",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004161",
"evidence": [
{
"database": "UniProtKB",
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324"
}
],
"pmid": ""
},
{
"name": "geranyltranstransferase activity",
"id": "GO:0004337",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004337",
"evidence": [
{
"database": "UniProtKB",
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324"
}
],
"pmid": ""
},
{
"name": "RNA binding",
"id": "GO:0003723",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723",
"evidence": [
{
"database": "UniProtKB",
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324"
}
],
"pmid": ""
},
{
"name": "metal ion binding",
"id": "GO:0046872",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872",
"evidence": [
{
"database": "UniProtKB",
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324"
}
],
"pmid": ""
}
]
},
{
"name": "Biological Process",
"total": 4,
"go_terms": [
{
"name": "isoprenoid biosynthetic process",
"id": "GO:0008299",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008299",
"evidence": [
{
"database": "UniProtKB",
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324"
}
],
"pmid": ""
},
{
"name": "geranyl diphosphate biosynthetic process",
"id": "GO:0033384",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033384",
"evidence": [
{
"database": "UniProtKB",
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324"
}
],
"pmid": ""
},
{
"name": "farnesyl diphosphate biosynthetic process",
"id": "GO:0045337",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045337",
"evidence": [
{
"database": "UniProtKB",
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324"
}
],
"pmid": ""
},
{
"name": "cholesterol biosynthetic process",
"id": "GO:0006695",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006695",
"evidence": [
{
"database": "UniProtKB",
"id": "P14324",
"url": "https://www.uniprot.org/uniprot/P14324"
}
],
"pmid": ""
}
]
}
]
},
"pro_annotation": [],
"site_annotation": [],
"ptm_annotation": [],
"interactions": [],
"reactions": [
{
"id": "19361",
"name": "",
"equation": "(2E)-geranyl diphosphate + isopentenyl diphosphate = (2E,6E)-farnesyl diphosphate + diphosphate",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P05369-1",
"Q6F596-1",
"P14324-1",
"O95749-1",
"Q9WTN0-1",
"Q920E5-1",
"P08524-1",
"Q12051-1",
"Q54BK1-1",
"Q54XP1-1",
"Q55EU7-1",
"Q9NH03-1"
],
"evidence": [
{
"id": "19361",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/19361"
}
]
},
{
"id": "22408",
"name": "",
"equation": "dimethylallyl diphosphate + isopentenyl diphosphate = (2E)-geranyl diphosphate + diphosphate",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P05369-1",
"Q6F596-1",
"P14324-1",
"O95749-1",
"Q9WTN0-1",
"Q920E5-1",
"P08524-1",
"Q12051-1",
"Q54BK1-1",
"Q54XP1-1",
"Q55EU7-1",
"Q9NH03-1"
],
"evidence": [
{
"id": "22408",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/22408"
}
]
},
{
"id": "R-HSA-1655824",
"name": "Expression of Farnesyl Diphosphate Synthase (FDPS)",
"equation": "",
"summary": "The FDPS gene is transcribed to yield mRNA and the mRNA is translated to yield protein.",
"cellular_location": "cytosol, nucleoplasm",
"input_participant_list": [
"R-HSA-2393989"
],
"output_participant_list": [
"R-HSA-981566"
],
"enzyme_list": [
"P14324-1"
],
"evidence": [
{
"id": "R-HSA-1655824",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1655824"
}
]
},
{
"id": "R-HSA-191303",
"name": "FDPS dimer transfers IPPP to GPP",
"equation": "",
"summary": "Further condensation of an isopentenyl pyrophosphate (IPPP) with geranyl pyrophosphate (GPP) to form farnesyl pyrophosphate (FAPP) is catalyzed by the prenyltransferases FPP synthase and GGPP synthase (Kavanagh et al, 2006).",
"cellular_location": "cytosol",
"input_participant_list": [
"R-ALL-191362",
"R-ALL-191409"
],
"output_participant_list": [],
"enzyme_list": [
"P14324-1"
],
"evidence": [
{
"id": "R-HSA-191303",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191303"
}
]
},
{
"id": "R-HSA-191322",
"name": "FDPS dimer transfers IPPP to DMAPP",
"equation": "",
"summary": "The family of enzymes called prenyltransferases is involved in the biosynthesis of isoprenoids. Two members of this family are known to catalyse the sequential condensation of isopentenyl pyrophosphate (IPPP) to DMAPP: farnesyl pyrophosphate synthase dimer (FPPS dimer) and geranylgeranyl pyrophosphate synthetase hexamer (GGPPS hexamer) (Kavanaugh et al, 2006). Both enzymes utlise Mg2+ as cofactor (Chang et al. 2021).",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P14324-1"
],
"evidence": [
{
"id": "R-HSA-191322",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191322"
}
]
},
{
"id": "R-HSA-9717841",
"name": "holo-FDPS dimer binds NBPs",
"equation": "",
"summary": "The mevalonate pathway is responsible for the biosynthesis of all isoprenoids, metabolites that are vital for normal cellular functions. Two key isoprenoids, farnesyl pyrophosphate (FPP) and geranylgeranyl pyrophosphate (GGPP) are responsible for the post-translational prenylation of small GTP-binding proteins, and serve as the biosynthetic precursors to numerous other biomolecules. The downstream metabolite of FPP and GGPP is squalene, the precursor to steroids, bile acids, lipoproteins, and vitamin D.
Nitrogen-containing bisphosphonates (NBPs) are drugs used to treat diseases characterized by excessive bone resorption such as Paget's disease of bone, bone metastases, multiple myeloma (Simoni et al. 2008), and osteoporosis. NBPs act by inhibiting farnesyl pyrophosphate synthase (FDPS) involved in the mevalonate pathway (Bergstrom et al. 2000, Dunford et al. 2001, Dunford et al. 2008, R\u00e4ikk\u00f6nen et al. 2011). Inhibition of FDPS in osteoclasts prevents the biosynthesis of the isoprenoid lipids FPP and GGPP, which are essential for the post-translational farnesylation and geranylgeranylation of small GTPase signalling proteins. Loss of bone-resorptive activity and osteoclast apoptosis is primarily due to the loss of geranylgeranylated small GTPases (Review - Cremers et al. 2019). Approved NBPs include the second generation NBPs pamidronic acid and alendronic acid and the third generation NBPs ibandronic acid, zoledronic acid, minodronic acid and risedronate.",
"cellular_location": "cytosol",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P14324-1"
],
"evidence": [
{
"id": "R-HSA-9717841",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9717841"
}
]
}
],
"reaction_participants": [
{
"participant_id": "R-ALL-191362",
"participant_name": "IPPP [cytosol]",
"crossref": [
{
"id": "C00129",
"database": "COMPOUND",
"url": ""
},
{
"id": "16584",
"database": "ChEBI",
"url": ""
},
{
"id": "000008215654",
"database": "ZINC",
"url": ""
},
{
"id": "3048",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "HMDB0001347",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "C00129",
"database": "COMPOUND",
"url": ""
},
{
"id": "16584",
"database": "ChEBI",
"url": ""
},
{
"id": "000008215654",
"database": "ZINC",
"url": ""
},
{
"id": "3048",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "HMDB0001347",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "C00129",
"database": "COMPOUND",
"url": ""
},
{
"id": "16584",
"database": "ChEBI",
"url": ""
},
{
"id": "000008215654",
"database": "ZINC",
"url": ""
},
{
"id": "3048",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "HMDB0001347",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "000008215654",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0001347",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "C00129",
"database": "COMPOUND",
"url": ""
},
{
"id": "16584",
"database": "ChEBI",
"url": ""
},
{
"id": "3048",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "C00129",
"database": "COMPOUND",
"url": ""
},
{
"id": "16584",
"database": "ChEBI",
"url": ""
},
{
"id": "000008215654",
"database": "ZINC",
"url": ""
},
{
"id": "3048",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "HMDB0001347",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "000008215654",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0001347",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "C00129",
"database": "COMPOUND",
"url": ""
},
{
"id": "16584",
"database": "ChEBI",
"url": ""
},
{
"id": "3048",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "16584",
"database": "ChEBI",
"url": ""
},
{
"id": "3048",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "C00129",
"database": "COMPOUND",
"url": ""
},
{
"id": "000008215654",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0001347",
"database": "HMDB Metabolite",
"url": ""
}
]
},
{
"participant_id": "R-ALL-191409",
"participant_name": "GPP [cytosol]",
"crossref": [
{
"id": "17211",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0001285",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "C00341",
"database": "COMPOUND",
"url": ""
},
{
"id": "3051",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "000008215849",
"database": "ZINC",
"url": ""
},
{
"id": "C00341",
"database": "COMPOUND",
"url": ""
},
{
"id": "17211",
"database": "ChEBI",
"url": ""
},
{
"id": "000008215849",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0001285",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "3051",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "C00341",
"database": "COMPOUND",
"url": ""
},
{
"id": "17211",
"database": "ChEBI",
"url": ""
},
{
"id": "000008215849",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0001285",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "3051",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "C00341",
"database": "COMPOUND",
"url": ""
},
{
"id": "17211",
"database": "ChEBI",
"url": ""
},
{
"id": "000008215849",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0001285",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "3051",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "C00341",
"database": "COMPOUND",
"url": ""
},
{
"id": "17211",
"database": "ChEBI",
"url": ""
},
{
"id": "000008215849",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0001285",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "3051",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "HMDB0001285",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "17211",
"database": "ChEBI",
"url": ""
},
{
"id": "C00341",
"database": "COMPOUND",
"url": ""
},
{
"id": "3051",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "000008215849",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0001285",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "17211",
"database": "ChEBI",
"url": ""
},
{
"id": "C00341",
"database": "COMPOUND",
"url": ""
},
{
"id": "3051",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "000008215849",
"database": "ZINC",
"url": ""
}
]
},
{
"participant_id": "R-HSA-2393989",
"participant_name": "FDPS gene [nucleoplasm]",
"crossref": [
{
"id": "ENSG00000160752",
"database": "ENSEMBL",
"url": ""
}
]
},
{
"participant_id": "R-HSA-981566",
"participant_name": "FDPS [cytosol]",
"crossref": [
{
"id": "4KQ5",
"database": "PDB",
"url": ""
},
{
"id": "FPPS_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "NP_001129293.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENST00000447866",
"database": "Ensembl",
"url": ""
},
{
"id": "4P0W",
"database": "PDB",
"url": ""
},
{
"id": "NP_001229753.1",
"database": "RefSeq",
"url": ""
},
{
"id": "2.5.1.10",
"database": "IntEnz",
"url": ""
},
{
"id": "2VF6",
"database": "PDB",
"url": ""
},
{
"id": "4L2X",
"database": "PDB",
"url": ""
},
{
"id": "5DGS",
"database": "PDB",
"url": ""
},
{
"id": "6N7Y",
"database": "PDB",
"url": ""
},
{
"id": "5DGN",
"database": "PDB",
"url": ""
},
{
"id": "6N7Z",
"database": "PDB",
"url": ""
},
{
"id": "3N5H",
"database": "PDB",
"url": ""
},
{
"id": "4NKE",
"database": "PDB",
"url": ""
},
{
"id": "6OAG",
"database": "PDB",
"url": ""
},
{
"id": "6N83",
"database": "PDB",
"url": ""
},
{
"id": "4GA3",
"database": "PDB",
"url": ""
},
{
"id": "5CG5",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000368356",
"database": "Ensembl",
"url": ""
},
{
"id": "HMDBP00932",
"database": "HMDB Protein",
"url": ""
},
{
"id": "3N1W",
"database": "PDB",
"url": ""
},
{
"id": "5JA0",
"database": "PDB",
"url": ""
},
{
"id": "5DIQ",
"database": "PDB",
"url": ""
},
{
"id": "4LFV",
"database": "PDB",
"url": ""
},
{
"id": "1YQ7",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000356657",
"database": "Ensembl",
"url": ""
},
{
"id": "4XQS",
"database": "PDB",
"url": ""
},
{
"id": "4NKF",
"database": "PDB",
"url": ""
},
{
"id": "2OPN",
"database": "PDB",
"url": ""
},
{
"id": "3CP6",
"database": "PDB",
"url": ""
},
{
"id": "4Q23",
"database": "PDB",
"url": ""
},
{
"id": "3RYE",
"database": "PDB",
"url": ""
},
{
"id": "3N49",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000357340",
"database": "Ensembl",
"url": ""
},
{
"id": "1ZW5",
"database": "PDB",
"url": ""
},
{
"id": "6OAH",
"database": "PDB",
"url": ""
},
{
"id": "5JV0",
"database": "PDB",
"url": ""
},
{
"id": "P14324",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "4PVX",
"database": "PDB",
"url": ""
},
{
"id": "NP_001229754.1",
"database": "RefSeq",
"url": ""
},
{
"id": "4NG6",
"database": "PDB",
"url": ""
},
{
"id": "NP_001129294.1",
"database": "RefSeq",
"url": ""
},
{
"id": "5DJR",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000160752",
"database": "Ensembl",
"url": ""
},
{
"id": "4NUA",
"database": "PDB",
"url": ""
},
{
"id": "4H5D",
"database": "PDB",
"url": ""
},
{
"id": "4LPG",
"database": "PDB",
"url": ""
},
{
"id": "1YV5",
"database": "PDB",
"url": ""
},
{
"id": "P14324",
"database": "PRO",
"url": ""
},
{
"id": "NP_001995.1",
"database": "RefSeq",
"url": ""
},
{
"id": "4NFK",
"database": "PDB",
"url": ""
},
{
"id": "4KFA",
"database": "PDB",
"url": ""
},
{
"id": "6N82",
"database": "PDB",
"url": ""
},
{
"id": "23495",
"database": "Orphanet",
"url": ""
},
{
"id": "2F8Z",
"database": "PDB",
"url": ""
},
{
"id": "4DEM",
"database": "PDB",
"url": ""
},
{
"id": "3N5J",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000160752-FDPS",
"database": "HPA",
"url": ""
},
{
"id": "4P0X",
"database": "PDB",
"url": ""
},
{
"id": "4NFI",
"database": "PDB",
"url": ""
},
{
"id": "FPPS_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "2RAH",
"database": "PDB",
"url": ""
},
{
"id": "5KSX",
"database": "PDB",
"url": ""
},
{
"id": "4KPJ",
"database": "PDB",
"url": ""
},
{
"id": "4RXA",
"database": "PDB",
"url": ""
},
{
"id": "644",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "4KPD",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000160752",
"database": "OpenTargets",
"url": ""
},
{
"id": "4QPF",
"database": "PDB",
"url": ""
},
{
"id": "4KQU",
"database": "PDB",
"url": ""
},
{
"id": "4H5E",
"database": "PDB",
"url": ""
},
{
"id": "2F89",
"database": "PDB",
"url": ""
},
{
"id": "4H5C",
"database": "PDB",
"url": ""
},
{
"id": "P14324",
"database": "GeneCards",
"url": ""
},
{
"id": "3N45",
"database": "PDB",
"url": ""
},
{
"id": "5JV1",
"database": "PDB",
"url": ""
},
{
"id": "3N1V",
"database": "PDB",
"url": ""
},
{
"id": "4LPH",
"database": "PDB",
"url": ""
},
{
"id": "4KQS",
"database": "PDB",
"url": ""
},
{
"id": "4P0V",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000478235",
"database": "Ensembl",
"url": ""
},
{
"id": "4PVY",
"database": "PDB",
"url": ""
},
{
"id": "FPPS_HUMAN",
"database": "ZINC - Investigational",
"url": ""
},
{
"id": "5JUZ",
"database": "PDB",
"url": ""
},
{
"id": "5CG6",
"database": "PDB",
"url": ""
},
{
"id": "2F94",
"database": "PDB",
"url": ""
},
{
"id": "XP_005245019.1",
"database": "RefSeq",
"url": ""
},
{
"id": "3S4J",
"database": "PDB",
"url": ""
},
{
"id": "4XQR",
"database": "PDB",
"url": ""
},
{
"id": "4N1Z",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000349078",
"database": "Ensembl",
"url": ""
},
{
"id": "2F7M",
"database": "PDB",
"url": ""
},
{
"id": "P14324",
"database": "UniProt",
"url": ""
},
{
"id": "2QIS",
"database": "PDB",
"url": ""
},
{
"id": "3N6K",
"database": "PDB",
"url": ""
},
{
"id": "FPPS_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "ENSP00000480142",
"database": "Ensembl",
"url": ""
},
{
"id": "5YGI",
"database": "PDB",
"url": ""
},
{
"id": "3N3L",
"database": "PDB",
"url": ""
},
{
"id": "FPPS_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "ENST00000612683",
"database": "Ensembl",
"url": ""
},
{
"id": "2F9K",
"database": "PDB",
"url": ""
},
{
"id": "3N46",
"database": "PDB",
"url": ""
},
{
"id": "P14324",
"database": "ZINC target",
"url": ""
},
{
"id": "4QXS",
"database": "PDB",
"url": ""
},
{
"id": "FPPS_HUMAN",
"database": "ZINC - FDA approved",
"url": ""
},
{
"id": "4JVJ",
"database": "PDB",
"url": ""
},
{
"id": "5JV2",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000391755",
"database": "Ensembl",
"url": ""
},
{
"id": "5DJV",
"database": "PDB",
"url": ""
},
{
"id": "4OGU",
"database": "PDB",
"url": ""
},
{
"id": "5DJP",
"database": "PDB",
"url": ""
},
{
"id": "4XQT",
"database": "PDB",
"url": ""
},
{
"id": "4NFJ",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000467076",
"database": "Ensembl",
"url": ""
},
{
"id": "2OPM",
"database": "PDB",
"url": ""
},
{
"id": "3B7L",
"database": "PDB",
"url": ""
},
{
"id": "2F92",
"database": "PDB",
"url": ""
},
{
"id": "5DGM",
"database": "PDB",
"url": ""
},
{
"id": "XP_005245020.1",
"database": "RefSeq",
"url": ""
},
{
"id": "FPPS_HUMAN",
"database": "ZINC - World Drugs",
"url": ""
},
{
"id": "4N9U",
"database": "PDB",
"url": ""
},
{
"id": "2F8C",
"database": "PDB",
"url": ""
}
]
}
],
"reaction_enzymes": [
{
"uniprot_ac": "O95749",
"gene_name": "GGPS1",
"activity": [
{
"ec_number": "2.5.1.1",
"activity": "dimethylallyl diphosphate + isopentenyl diphosphate = (2E)-geranyl diphosphate + diphosphate.",
"evidence": [
{
"id": "O95749",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O95749"
}
]
},
{
"ec_number": "2.5.1.10",
"activity": "(2E)-geranyl diphosphate + isopentenyl diphosphate = (2E,6E)-farnesyl diphosphate + diphosphate.",
"evidence": [
{
"id": "O95749",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O95749"
}
]
},
{
"ec_number": "2.5.1.29",
"activity": "(2E,6E)-farnesyl diphosphate + isopentenyl diphosphate = (2E,6E,10E)-geranylgeranyl diphosphate + diphosphate.",
"evidence": [
{
"id": "O95749",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O95749"
}
]
},
{
"ec_number": "2.5.1.-",
"activity": "",
"evidence": [
{
"id": "O95749",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O95749"
}
]
}
]
},
{
"uniprot_ac": "P05369",
"gene_name": "Fdps",
"activity": [
{
"ec_number": "2.5.1.1",
"activity": "dimethylallyl diphosphate + isopentenyl diphosphate = (2E)-geranyl diphosphate + diphosphate.",
"evidence": [
{
"id": "P05369",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05369"
}
]
},
{
"ec_number": "2.5.1.10",
"activity": "(2E)-geranyl diphosphate + isopentenyl diphosphate = (2E,6E)-farnesyl diphosphate + diphosphate.",
"evidence": [
{
"id": "P05369",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05369"
}
]
},
{
"ec_number": "2.5.1.10",
"activity": "",
"evidence": [
{
"id": "P05369",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P05369"
}
]
}
]
},
{
"uniprot_ac": "P08524",
"gene_name": "ERG20",
"activity": [
{
"ec_number": "2.5.1.1",
"activity": "dimethylallyl diphosphate + isopentenyl diphosphate = (2E)-geranyl diphosphate + diphosphate.",
"evidence": [
{
"id": "P08524",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08524"
}
]
},
{
"ec_number": "2.5.1.10",
"activity": "(2E)-geranyl diphosphate + isopentenyl diphosphate = (2E,6E)-farnesyl diphosphate + diphosphate.",
"evidence": [
{
"id": "P08524",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08524"
}
]
},
{
"ec_number": "2.5.1.10",
"activity": "",
"evidence": [
{
"id": "P08524",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08524"
}
]
}
]
},
{
"uniprot_ac": "P14324",
"gene_name": "FDPS",
"activity": [
{
"ec_number": "2.5.1.1",
"activity": "dimethylallyl diphosphate + isopentenyl diphosphate = (2E)-geranyl diphosphate + diphosphate.",
"evidence": [
{
"id": "P14324",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14324"
}
]
},
{
"ec_number": "2.5.1.10",
"activity": "(2E)-geranyl diphosphate + isopentenyl diphosphate = (2E,6E)-farnesyl diphosphate + diphosphate.",
"evidence": [
{
"id": "P14324",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14324"
}
]
},
{
"ec_number": "2.5.1.10",
"activity": "",
"evidence": [
{
"id": "P14324",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P14324"
}
]
}
]
},
{
"uniprot_ac": "Q12051",
"gene_name": "BTS1",
"activity": [
{
"ec_number": "2.5.1.1",
"activity": "dimethylallyl diphosphate + isopentenyl diphosphate = (2E)-geranyl diphosphate + diphosphate.",
"evidence": [
{
"id": "Q12051",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12051"
}
]
},
{
"ec_number": "2.5.1.10",
"activity": "(2E)-geranyl diphosphate + isopentenyl diphosphate = (2E,6E)-farnesyl diphosphate + diphosphate.",
"evidence": [
{
"id": "Q12051",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12051"
}
]
},
{
"ec_number": "2.5.1.29",
"activity": "(2E,6E)-farnesyl diphosphate + isopentenyl diphosphate = (2E,6E,10E)-geranylgeranyl diphosphate + diphosphate.",
"evidence": [
{
"id": "Q12051",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12051"
}
]
},
{
"ec_number": "2.5.1.-",
"activity": "",
"evidence": [
{
"id": "Q12051",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12051"
}
]
}
]
},
{
"uniprot_ac": "Q54BK1",
"gene_name": "ggps1",
"activity": [
{
"ec_number": "2.5.1.1",
"activity": "dimethylallyl diphosphate + isopentenyl diphosphate = (2E)-geranyl diphosphate + diphosphate.",
"evidence": [
{
"id": "Q54BK1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54BK1"
}
]
},
{
"ec_number": "2.5.1.10",
"activity": "(2E)-geranyl diphosphate + isopentenyl diphosphate = (2E,6E)-farnesyl diphosphate + diphosphate.",
"evidence": [
{
"id": "Q54BK1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54BK1"
}
]
},
{
"ec_number": "2.5.1.29",
"activity": "(2E,6E)-farnesyl diphosphate + isopentenyl diphosphate = (2E,6E,10E)-geranylgeranyl diphosphate + diphosphate.",
"evidence": [
{
"id": "Q54BK1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54BK1"
}
]
},
{
"ec_number": "2.5.1.-",
"activity": "",
"evidence": [
{
"id": "Q54BK1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54BK1"
}
]
}
]
},
{
"uniprot_ac": "Q54XP1",
"gene_name": "",
"activity": [
{
"ec_number": "2.5.1.1",
"activity": "dimethylallyl diphosphate + isopentenyl diphosphate = (2E)-geranyl diphosphate + diphosphate.",
"evidence": [
{
"id": "Q54XP1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54XP1"
}
]
},
{
"ec_number": "2.5.1.10",
"activity": "(2E)-geranyl diphosphate + isopentenyl diphosphate = (2E,6E)-farnesyl diphosphate + diphosphate.",
"evidence": [
{
"id": "Q54XP1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54XP1"
}
]
},
{
"ec_number": "2.5.1.10",
"activity": "",
"evidence": [
{
"id": "Q54XP1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54XP1"
}
]
}
]
},
{
"uniprot_ac": "Q55EU7",
"gene_name": "",
"activity": [
{
"ec_number": "2.5.1.1",
"activity": "dimethylallyl diphosphate + isopentenyl diphosphate = (2E)-geranyl diphosphate + diphosphate.",
"evidence": [
{
"id": "Q55EU7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q55EU7"
}
]
},
{
"ec_number": "2.5.1.10",
"activity": "(2E)-geranyl diphosphate + isopentenyl diphosphate = (2E,6E)-farnesyl diphosphate + diphosphate.",
"evidence": [
{
"id": "Q55EU7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q55EU7"
}
]
},
{
"ec_number": "2.5.1.10",
"activity": "",
"evidence": [
{
"id": "Q55EU7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q55EU7"
}
]
}
]
},
{
"uniprot_ac": "Q6F596",
"gene_name": "Ggps1",
"activity": [
{
"ec_number": "2.5.1.1",
"activity": "dimethylallyl diphosphate + isopentenyl diphosphate = (2E)-geranyl diphosphate + diphosphate.",
"evidence": [
{
"id": "Q6F596",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6F596"
}
]
},
{
"ec_number": "2.5.1.10",
"activity": "(2E)-geranyl diphosphate + isopentenyl diphosphate = (2E,6E)-farnesyl diphosphate + diphosphate.",
"evidence": [
{
"id": "Q6F596",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6F596"
}
]
},
{
"ec_number": "2.5.1.29",
"activity": "(2E,6E)-farnesyl diphosphate + isopentenyl diphosphate = (2E,6E,10E)-geranylgeranyl diphosphate + diphosphate.",
"evidence": [
{
"id": "Q6F596",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6F596"
}
]
},
{
"ec_number": "2.5.1.-",
"activity": "",
"evidence": [
{
"id": "Q6F596",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6F596"
}
]
}
]
},
{
"uniprot_ac": "Q920E5",
"gene_name": "Fdps",
"activity": [
{
"ec_number": "2.5.1.1",
"activity": "dimethylallyl diphosphate + isopentenyl diphosphate = (2E)-geranyl diphosphate + diphosphate.",
"evidence": [
{
"id": "Q920E5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q920E5"
}
]
},
{
"ec_number": "2.5.1.10",
"activity": "(2E)-geranyl diphosphate + isopentenyl diphosphate = (2E,6E)-farnesyl diphosphate + diphosphate.",
"evidence": [
{
"id": "Q920E5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q920E5"
}
]
},
{
"ec_number": "2.5.1.10",
"activity": "",
"evidence": [
{
"id": "Q920E5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q920E5"
}
]
}
]
},
{
"uniprot_ac": "Q9NH03",
"gene_name": "fps",
"activity": [
{
"ec_number": "2.5.1.1",
"activity": "dimethylallyl diphosphate + isopentenyl diphosphate = (2E)-geranyl diphosphate + diphosphate.",
"evidence": [
{
"id": "Q9NH03",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9NH03"
}
]
},
{
"ec_number": "2.5.1.10",
"activity": "(2E)-geranyl diphosphate + isopentenyl diphosphate = (2E,6E)-farnesyl diphosphate + diphosphate.",
"evidence": [
{
"id": "Q9NH03",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9NH03"
}
]
},
{
"ec_number": "2.5.1.10",
"activity": "",
"evidence": [
{
"id": "Q9NH03",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9NH03"
}
]
}
]
},
{
"uniprot_ac": "Q9WTN0",
"gene_name": "Ggps1",
"activity": [
{
"ec_number": "2.5.1.1",
"activity": "dimethylallyl diphosphate + isopentenyl diphosphate = (2E)-geranyl diphosphate + diphosphate.",
"evidence": [
{
"id": "Q9WTN0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WTN0"
}
]
},
{
"ec_number": "2.5.1.10",
"activity": "(2E)-geranyl diphosphate + isopentenyl diphosphate = (2E,6E)-farnesyl diphosphate + diphosphate.",
"evidence": [
{
"id": "Q9WTN0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WTN0"
}
]
},
{
"ec_number": "2.5.1.29",
"activity": "(2E,6E)-farnesyl diphosphate + isopentenyl diphosphate = (2E,6E,10E)-geranylgeranyl diphosphate + diphosphate.",
"evidence": [
{
"id": "Q9WTN0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WTN0"
}
]
},
{
"ec_number": "2.5.1.-",
"activity": "",
"evidence": [
{
"id": "Q9WTN0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9WTN0"
}
]
}
]
}
],
"biomarkers": [],
"synthesized_glycans": [],
"cluster_types": [
{
"name": "isoformset.uniprotkb",
"label": "Isoforms"
},
{
"name": "homologset.mgi",
"label": "MGI Homologs"
},
{
"name": "homologset.oma",
"label": "OMA Homologs"
}
],
"sequence_features": {
"n_linked_sites": [],
"o_linked_sites": [
4
],
"snv_sites": [
4,
120,
173
],
"glycation_sites": [],
"phosphorylation_sites": [],
"sequon_annotation_sites": []
},
"section_stats": [
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 1
},
{
"field": "total_sites",
"count": 1
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 1
},
{
"field": "o_linked_glycan_sites",
"count": 1
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment",
"start_pos",
"start_aa",
"end_pos",
"end_aa",
"residue",
"site_lbl"
]
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 1
},
{
"field": "total_sites",
"count": 1
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 1
},
{
"field": "o_linked_glycan_sites",
"count": 1
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment",
"start_pos",
"start_aa",
"end_pos",
"end_aa",
"residue",
"site_lbl"
]
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv",
"table_stats": [
{
"field": "total",
"count": 3
},
{
"field": "total_sites",
"count": 3
}
],
"sort_fields": [
"start_pos",
"end_pos",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl"
]
},
{
"table_id": "snv_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_non_disease",
"table_stats": [
{
"field": "total",
"count": 3
},
{
"field": "total_sites",
"count": 3
}
],
"sort_fields": [
"start_pos",
"end_pos",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl"
]
},
{
"table_id": "publication",
"table_stats": [
{
"field": "total",
"count": 82
}
],
"sort_fields": [
"title",
"journal",
"date",
"authors"
]
}
]
}