{ "uniprot_canonical_ac": "P14210-1", "uniprot_ac": "P14210", "uniprot_id": "HGF_HUMAN", "mass": { "chemical_mass": 83134.0, "monoisotopic_mass": 83134.0 }, "refseq": { "ac": "NP_000592", "name": "hepatocyte growth factor isoform 1 preproprotein", "summary": "This gene encodes a protein that binds to the hepatocyte growth factor receptor to regulate cell growth, cell motility and morphogenesis in numerous cell and tissue types. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate alpha and beta chains, which form the mature heterodimer. This protein is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. This protein also plays a role in angiogenesis, tumorogenesis, and tissue regeneration. Although the encoded protein is a member of the peptidase S1 family of serine proteases, it lacks peptidase activity. Mutations in this gene are associated with nonsyndromic hearing loss. [provided by RefSeq, Nov 2015].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000592" }, "gene_names": [ { "name": "HGF", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P14210", "id": "P14210" }, { "name": "DFNB39; F-TCF; HGFB; HPTA; SF", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000592", "id": "NP_000592" }, { "name": "HGF", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000592", "id": "NP_000592" }, { "name": "HPTA", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P14210", "id": "P14210" } ], "protein_names": [ { "name": "Hepatocyte growth factor", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P14210" }, { "name": "Hepatopoietin-A", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P14210" }, { "name": "SF", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P14210" }, { "name": "Scatter factor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P14210" }, { "name": "fibroblast-derived tumor cytotoxic factor; lung fibroblast-derived mitogen; hepatopoietin-A; hepatocyte growth factor (hepapoietin A; scatter factor)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000592", "id": "NP_000592" }, { "name": "hepatocyte growth factor isoform 1 preproprotein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000592", "id": "NP_000592" } ], "function": [ { "annotation": "Immunohistochemical expression of the hepatocyte growth factor in chromophobe renal cell carcinoma. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000592", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000592" }, { "database": "PubMed", "id": "37170275", "url": "https://glygen.org/publication/PubMed/37170275" } ] }, { "annotation": "Intercellular Interactions Mediated by HGF And TGF-Beta Promote the 3D Spherical and Xenograft Growth of Liver Cancer Cells.", "evidence": [ { "database": "RefSeq", "id": "NP_000592", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000592" }, { "database": "PubMed", "id": "37642183", "url": "https://glygen.org/publication/PubMed/37642183" } ] }, { "annotation": "Potent mitogen for mature parenchymal hepatocyte cells, seems to be a hepatotrophic factor, and acts as a growth factor for a broad spectrum of tissues and cell types (PubMed:20624990). Activating ligand for the receptor tyrosine kinase MET by binding to it and promoting its dimerization (PubMed:20977675, PubMed:15167892). Activates MAPK signaling following TMPRSS13 cleavage and activation (PubMed:20977675).", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210#function" }, { "database": "PubMed", "id": "15167892", "url": "https://glygen.org/publication/PubMed/15167892" }, { "database": "PubMed", "id": "20624990", "url": "https://glygen.org/publication/PubMed/20624990" }, { "database": "PubMed", "id": "20977675", "url": "https://glygen.org/publication/PubMed/20977675" } ] }, { "annotation": "This gene encodes a protein that binds to the hepatocyte growth factor receptor to regulate cell growth, cell motility and morphogenesis in numerous cell and tissue types. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate alpha and beta chains, which form the mature heterodimer. This protein is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. This protein also plays a role in angiogenesis, tumorogenesis, and tissue regeneration. Although the encoded protein is a member of the peptidase S1 family of serine proteases, it lacks peptidase activity. Mutations in this gene are associated with nonsyndromic hearing loss. [provided by RefSeq, Nov 2015].", "evidence": [ { "database": "RefSeq", "id": "NP_000592", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000592" } ] }, { "annotation": "Translation of circHGF RNA encodes an HGF protein variant promoting glioblastoma growth through stimulation of c-MET.", "evidence": [ { "database": "RefSeq", "id": "NP_000592", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000592" }, { "database": "PubMed", "id": "37162666", "url": "https://glygen.org/publication/PubMed/37162666" } ] }, { "annotation": "USP11 potentiates HGF/AKT signaling and drives metastasis in hepatocellular carcinoma.", "evidence": [ { "database": "RefSeq", "id": "NP_000592", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000592" }, { "database": "PubMed", "id": "37973952", "url": "https://glygen.org/publication/PubMed/37973952" } ] } ], "disease": [ { "disease_id": "DOID:0110497", "recommended_name": { "id": "DOID:0110497", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110497", "name": "autosomal recessive nonsyndromic deafness 39", "description": "An autosomal recessive nonsyndromic deafness that is characterized by prelingual onset with severe to profound, downsloping hearing loss and has_material_basis_in mutation in the HGF gene on chromosome 7q21." }, "synonyms": [ { "id": "DOID:0110497", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110497", "name": "DFNB39", "description": "" }, { "id": "DOID:0110497", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110497", "name": "autosomal recessive deafness 39", "description": "" }, { "id": "MONDO:0012003", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012003", "name": "autosomal recessive nonsyndromic hearing loss 39", "description": "An autosomal recessive disorder caused by mutations in the HGF gene, encoding hepatocyte growth factor receptor. It is characterized by profound deafness." }, { "id": "MONDO:0012003", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012003", "name": "DFNB39", "description": "" }, { "id": "MONDO:0012003", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012003", "name": "HGF autosomal recessive nonsyndromic deafness", "description": "" }, { "id": "MONDO:0012003", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012003", "name": "autosomal recessive deafness 39", "description": "" }, { "id": "MONDO:0012003", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012003", "name": "autosomal recessive nonsyndromic deafness 39", "description": "" }, { "id": "MONDO:0012003", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012003", "name": "autosomal recessive nonsyndromic deafness caused by mutation in HGF", "description": "" }, { "id": "MONDO:0012003", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012003", "name": "autosomal recessive nonsyndromic deafness type 39", "description": "" }, { "id": "MONDO:0012003", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012003", "name": "deafness, autosomal recessive 39", "description": "" }, { "id": "MONDO:0012003", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012003", "name": "deafness, autosomal recessive type 39", "description": "" }, { "id": "MIM:608265", "resource": "MIM", "url": "https://www.omim.org/entry/608265", "name": "Deafness, autosomal recessive, 39", "description": "Deafness, autosomal recessive, 39" } ], "evidence": [ { "id": "608265", "database": "MIM", "url": "https://www.omim.org/entry/608265" } ] } ], "snv": [ { "evidence": [ { "id": "rs1406377447", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1406377447" }, { "id": "rs1406377447", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1406377447" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 104, "end_pos": 104, "sequence_org": "M", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSM->NST).", "chr_id": "7", "chr_pos": "81758748", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "M104", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P14210", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P14210" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 137, "end_pos": 137, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "K", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (KGT->NGT).", "chr_id": "7", "chr_pos": "81757260", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "K137", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P14210", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P14210" } ], "glycoeffect": [], "start_pos": 178, "end_pos": 178, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "Q", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "7", "chr_pos": "81752212", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "R178", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] }, { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs754659494", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754659494" }, { "id": "rs754659494", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754659494" }, { "id": "rs754659494", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754659494#frequency_tab" }, { "id": "rs754659494", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754659494" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 294, "end_pos": 294, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->YDT).", "chr_id": "7", "chr_pos": "81729765", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N294", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1289926169", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1289926169" }, { "id": "rs1289926169", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1289926169#frequency_tab" }, { "id": "rs1289926169", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1289926169" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 296, "end_pos": 296, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->NDA).", "chr_id": "7", "chr_pos": "81729759", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T296", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1410083247", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1410083247" }, { "id": "rs1410083247", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1410083247" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 296, "end_pos": 296, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->NDI).", "chr_id": "7", "chr_pos": "81729758", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T296", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs745555932", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745555932" }, { "id": "rs745555932", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745555932" }, { "id": "rs745555932", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745555932" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 384, "end_pos": 384, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DMS->NMS).", "chr_id": "7", "chr_pos": "81725908", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D384", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1365681296", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1365681296" }, { "id": "rs1365681296", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1365681296#frequency_tab" }, { "id": "rs1365681296", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1365681296" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 400, "end_pos": 400, "sequence_org": "M", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NYM->NYT).", "chr_id": "7", "chr_pos": "81720817", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "M400", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1392395915", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1392395915" }, { "id": "rs1392395915", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1392395915" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 402, "end_pos": 402, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->SLS).", "chr_id": "7", "chr_pos": "81720811", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N402", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1275169968", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1275169968" }, { "id": "rs1275169968", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1275169968#frequency_tab" }, { "id": "rs1275169968", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1275169968" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 438, "end_pos": 438, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NEN->NES).", "chr_id": "7", "chr_pos": "81717324", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N438", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs17855203", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs17855203" }, { "id": "rs17855203", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs17855203" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 43, "end_pos": 43, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KKS->NKS).", "chr_id": "7", "chr_pos": "81762832", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K43", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P14210", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P14210" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 476, "end_pos": 476, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->I).", "chr_id": "7", "chr_pos": "81711498", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "T476", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P14210", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P14210" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 655, "end_pos": 655, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "C", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NES->NEC).", "chr_id": "7", "chr_pos": "81705436", "ref_nt": "G", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "S655", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs780386537", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780386537" }, { "id": "rs780386537", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780386537" }, { "id": "rs780386537", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs780386537#frequency_tab" }, { "id": "rs780386537", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780386537" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 67, "end_pos": 67, "sequence_org": "A", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NTA->NTS).", "chr_id": "7", "chr_pos": "81762762", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A67", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs780386537", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780386537" }, { "id": "rs780386537", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780386537" }, { "id": "rs780386537", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs780386537#frequency_tab" }, { "id": "rs780386537", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780386537" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 67, "end_pos": 67, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NTA->NTT).", "chr_id": "7", "chr_pos": "81762762", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A67", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 494, "end_pos": 494, "sequence_org": "R", "sequence_mut": "Q", "comment": "Loss of activity due to absence of proteolytic cleavage.", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" }, { "database": "PubMed", "id": "1280830", "url": "https://glygen.org/publication/PubMed/1280830" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "71.83", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000019991", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000019991" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "56.79", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000019991", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000019991" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "64.09", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000019991", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000019991" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "65.77", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000019991", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000019991" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "75.24", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000019991", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000019991" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "76.62", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000019991", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000019991" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "57.47", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000019991", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000019991" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "71.95", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000019991", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000019991" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "77.94", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000019991", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000019991" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "67.09", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000019991", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000019991" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "89.94", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000019991", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000019991" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "74.04", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000019991", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000019991" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "76.48", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000019991", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000019991" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P14210", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14210" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P14210", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14210" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P14210", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14210" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P14210", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14210" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P14210", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14210" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P14210", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14210" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P14210", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14210" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P14210", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14210" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P14210", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14210" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P14210", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14210" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P14210", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14210" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P14210", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14210" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "common_name": "Human" } ], "gene": [ { "name": "HGF", "url": "https://www.uniprot.org/uniprot/P14210", "locus": { "chromosome": "7", "start_pos": 81699010, "end_pos": 81770438, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000019991", "url": "https://www.ensembl.org/id/ENSG00000019991" } ] } } ], "crossref": [ { "id": "ENSG00000019991", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000019991", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P14210", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P14210", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd00108", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00108", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd00129", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00129", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd00190", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00190", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL5479", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL5479", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "HGF", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=HGF", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "3082", "url": "https://www.ncbi.nlm.nih.gov/gene/3082", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "219", "url": "https://glyconnect.expasy.org/browser/proteins/219", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "4893", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4893", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P14210", "url": "https://www.ebi.ac.uk/intact/interactors/id:P14210*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000001", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000001", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001254", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001254", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001314", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001314", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003609", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003609", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009003", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009003", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013806", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013806", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018056", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018056", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024174", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024174", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027284", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027284", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038178", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038178", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043504", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043504", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:3082", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3082", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "142409", "url": "http://www.omim.org/entry/142409", "database": "MIM", "categories": [ "Other" ] }, { "id": "608265", "url": "http://www.omim.org/entry/608265", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P14210", "url": "https://www.nextprot.org/entry/NX_P14210", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "CNIKVCE", "url": "https://omabrowser.org/oma/group/CNIKVCE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "211181at2759", "url": "http://www.orthodb.org/?query=211181at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24261", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24261", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24261:SF7", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24261:SF7", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1BHT", "url": "https://www.rcsb.org/structure/1BHT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1GMN", "url": "https://www.rcsb.org/structure/1GMN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1GMO", "url": "https://www.rcsb.org/structure/1GMO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1GP9", "url": "https://www.rcsb.org/structure/1GP9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1NK1", "url": "https://www.rcsb.org/structure/1NK1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1SHY", "url": "https://www.rcsb.org/structure/1SHY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1SI5", "url": "https://www.rcsb.org/structure/1SI5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2HGF", "url": "https://www.rcsb.org/structure/2HGF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2QJ2", "url": "https://www.rcsb.org/structure/2QJ2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3HMS", "url": "https://www.rcsb.org/structure/3HMS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3HMT", "url": "https://www.rcsb.org/structure/3HMT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3HN4", "url": "https://www.rcsb.org/structure/3HN4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3MKP", "url": "https://www.rcsb.org/structure/3MKP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SP8", "url": "https://www.rcsb.org/structure/3SP8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4D3C", "url": "https://www.rcsb.org/structure/4D3C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4K3J", "url": "https://www.rcsb.org/structure/4K3J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4O3T", "url": "https://www.rcsb.org/structure/4O3T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4O3U", "url": "https://www.rcsb.org/structure/4O3U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5COE", "url": "https://www.rcsb.org/structure/5COE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5CP9", "url": "https://www.rcsb.org/structure/5CP9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5CS1", "url": "https://www.rcsb.org/structure/5CS1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5CS3", "url": "https://www.rcsb.org/structure/5CS3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5CS5", "url": "https://www.rcsb.org/structure/5CS5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5CS9", "url": "https://www.rcsb.org/structure/5CS9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5CSQ", "url": "https://www.rcsb.org/structure/5CSQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5CT1", "url": "https://www.rcsb.org/structure/5CT1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5CT2", "url": "https://www.rcsb.org/structure/5CT2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5CT3", "url": "https://www.rcsb.org/structure/5CT3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7MO7", "url": "https://www.rcsb.org/structure/7MO7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7MO8", "url": "https://www.rcsb.org/structure/7MO8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7MO9", "url": "https://www.rcsb.org/structure/7MO9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7MOA", "url": "https://www.rcsb.org/structure/7MOA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7MOB", "url": "https://www.rcsb.org/structure/7MOB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OCL", "url": "https://www.rcsb.org/structure/7OCL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OCM", "url": "https://www.rcsb.org/structure/7OCM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00024", "url": "http://pfam.xfam.org/family/PF00024", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00051", "url": "http://pfam.xfam.org/family/PF00051", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00089", "url": "http://pfam.xfam.org/family/PF00089", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P14210", "url": "https://pharos.nih.gov/targets/P14210", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000055402", "url": "https://proconsortium.org/app/entry/PR:000055402", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055403", "url": "https://proconsortium.org/app/entry/PR:000055403", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055404", "url": "https://proconsortium.org/app/entry/PR:000055404", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055405", "url": "https://proconsortium.org/app/entry/PR:000055405", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055406", "url": "https://proconsortium.org/app/entry/PR:000055406", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055407", "url": "https://proconsortium.org/app/entry/PR:000055407", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055408", "url": "https://proconsortium.org/app/entry/PR:000055408", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055409", "url": "https://proconsortium.org/app/entry/PR:000055409", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055410", "url": "https://proconsortium.org/app/entry/PR:000055410", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P14210", "url": "http://purl.obolibrary.org/obo/PR_P14210", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6806942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6806942", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6811558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811558", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8851805", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8851805", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8851907", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8851907", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8865999", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8865999", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8875513", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875513", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8875555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875555", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8875656", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875656", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8875791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875791", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000592", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000592", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P14210", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A0A2R8YEI1", "url": "https://www.uniprot.org/uniprot/A0A2R8YEI1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8YEI1-1", "url": "https://www.uniprot.org/uniprot/A0A2R8YEI1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JDP4", "url": "https://www.uniprot.org/uniprot/C9JDP4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JDP4-1", "url": "https://www.uniprot.org/uniprot/C9JDP4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JS80", "url": "https://www.uniprot.org/uniprot/C9JS80", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JS80-1", "url": "https://www.uniprot.org/uniprot/C9JS80-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9WSJ3", "url": "https://www.uniprot.org/uniprot/C9WSJ3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9WSJ3-1", "url": "https://www.uniprot.org/uniprot/C9WSJ3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9WSJ4", "url": "https://www.uniprot.org/uniprot/C9WSJ4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9WSJ4-1", "url": "https://www.uniprot.org/uniprot/C9WSJ4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P14210-1", "url": "https://www.uniprot.org/uniprot/P14210-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P14210-2", "url": "https://www.uniprot.org/uniprot/P14210-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P14210-3", "url": "https://www.uniprot.org/uniprot/P14210-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P14210-4", "url": "https://www.uniprot.org/uniprot/P14210-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P14210-5", "url": "https://www.uniprot.org/uniprot/P14210-5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P14210-6", "url": "https://www.uniprot.org/uniprot/P14210-6", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGSESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNMEDLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS", "length": 728, "header": "sp|P14210-1|HGF_HUMAN Isoform 1 of Hepatocyte growth factor OS=Homo sapiens OX=9606 GN=HGF PE=1 SV=2 CANONICAL=P14210-1" }, "isoforms": [ { "isoform_ac": "A0A2R8YEI1-1", "url": "", "sequence": { "sequence": "MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEGK", "length": 205, "header": "tr|A0A2R8YEI1-1|HGF_HUMAN Computationally mapped isoform of Hepatocyte growth factor OS=Homo sapiens OX=9606 GN=HGF PE=1 SV=1 CANONICAL=P14210-1" }, "locus": { "chromosome": "7", "start_pos": 81769971, "end_pos": 81752115, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000465234.2", "url": "https://www.ensembl.org/id/ENST00000465234.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000494355.1", "url": "https://www.ensembl.org/id/ENSP00000494355.1" } ] } }, { "isoform_ac": "C9JDP4-1", "url": "", "sequence": { "sequence": "MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVS", "length": 141, "header": "tr|C9JDP4-1|HGF_HUMAN Computationally mapped isoform of Hepatocyte growth factor OS=Homo sapiens OX=9606 GN=HGF PE=1 SV=1 CANONICAL=P14210-1" }, "locus": { "chromosome": "7", "start_pos": 81769971, "end_pos": 81757248, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000412881.5", "url": "https://www.ensembl.org/id/ENST00000412881.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000396307.1", "url": "https://www.ensembl.org/id/ENSP00000396307.1" } ] } }, { "isoform_ac": "C9JS80-1", "url": "", "sequence": { "sequence": "MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDL", "length": 118, "header": "tr|C9JS80-1|HGF_HUMAN Computationally mapped isoform of Hepatocyte growth factor OS=Homo sapiens OX=9606 GN=HGF PE=1 SV=1 CANONICAL=P14210-1" }, "locus": { "chromosome": "7", "start_pos": 81769971, "end_pos": 81758705, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000421558.1", "url": "https://www.ensembl.org/id/ENST00000421558.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000388592.1", "url": "https://www.ensembl.org/id/ENSP00000388592.1" } ] } }, { "isoform_ac": "C9WSJ3-1", "url": "", "sequence": { "sequence": "MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSGGDDCLVESTFYSIPFWGHNSAR", "length": 184, "header": "tr|C9WSJ3-1|HGF_HUMAN Computationally mapped isoform of Hepatocyte growth factor OS=Homo sapiens OX=9606 GN=HGF PE=1 SV=1 CANONICAL=P14210-1" }, "locus": { "chromosome": "7", "start_pos": 81769971, "end_pos": 81755994, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000354224.10", "url": "https://www.ensembl.org/id/ENST00000354224.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000346164.6", "url": "https://www.ensembl.org/id/ENSP00000346164.6" } ] } }, { "isoform_ac": "C9WSJ4-1", "url": "", "sequence": { "sequence": "MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHR", "length": 161, "header": "tr|C9WSJ4-1|HGF_HUMAN Computationally mapped isoform of Hepatocyte growth factor OS=Homo sapiens OX=9606 GN=HGF PE=1 SV=1 CANONICAL=P14210-1" }, "locus": { "chromosome": "7", "start_pos": 81769971, "end_pos": 81757188, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000643024.1", "url": "https://www.ensembl.org/id/ENST00000643024.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000496217.1", "url": "https://www.ensembl.org/id/ENSP00000496217.1" } ] } }, { "isoform_ac": "P14210-1", "url": "", "sequence": { "sequence": "MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGSESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNMEDLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS", "length": 728, "header": "sp|P14210-1|HGF_HUMAN Isoform 1 of Hepatocyte growth factor OS=Homo sapiens OX=9606 GN=HGF PE=1 SV=2 CANONICAL=P14210-1" }, "locus": { "chromosome": "7", "start_pos": 81769971, "end_pos": 81702584, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000222390.11", "url": "https://www.ensembl.org/id/ENST00000222390.11" }, { "database": "Ensembl Peptide", "id": "ENSP00000222390.5", "url": "https://www.ensembl.org/id/ENSP00000222390.5" } ] } }, { "isoform_ac": "P14210-2", "url": "", "sequence": { "sequence": "MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCET", "length": 290, "header": "sp|P14210-2|HGF_HUMAN Isoform 2 of Hepatocyte growth factor OS=Homo sapiens OX=9606 GN=HGF PE=1 SV=2 CANONICAL=P14210-1" }, "locus": { "chromosome": "7", "start_pos": 81769971, "end_pos": 81742945, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000444829.7", "url": "https://www.ensembl.org/id/ENST00000444829.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000389854.2", "url": "https://www.ensembl.org/id/ENSP00000389854.2" } ] } }, { "isoform_ac": "P14210-3", "url": "", "sequence": { "sequence": "MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGSESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNMEDLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS", "length": 723, "header": "sp|P14210-3|HGF_HUMAN Isoform 3 of Hepatocyte growth factor OS=Homo sapiens OX=9606 GN=HGF PE=1 SV=2 CANONICAL=P14210-1" }, "locus": { "chromosome": "7", "start_pos": 81769971, "end_pos": 81702584, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000457544.7", "url": "https://www.ensembl.org/id/ENST00000457544.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000391238.2", "url": "https://www.ensembl.org/id/ENSP00000391238.2" } ] } }, { "isoform_ac": "P14210-4", "url": "", "sequence": { "sequence": "MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKNMRDITWALN", "length": 296, "header": "sp|P14210-4|HGF_HUMAN Isoform 4 of Hepatocyte growth factor OS=Homo sapiens OX=9606 GN=HGF PE=1 SV=2 CANONICAL=P14210-1" }, "locus": {} }, { "isoform_ac": "P14210-5", "url": "", "sequence": { "sequence": "MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCET", "length": 285, "header": "sp|P14210-5|HGF_HUMAN Isoform 5 of Hepatocyte growth factor OS=Homo sapiens OX=9606 GN=HGF PE=1 SV=2 CANONICAL=P14210-1" }, "locus": { "chromosome": "7", "start_pos": 81769971, "end_pos": 81742945, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000453411.6", "url": "https://www.ensembl.org/id/ENST00000453411.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000408270.1", "url": "https://www.ensembl.org/id/ENSP00000408270.1" } ] } }, { "isoform_ac": "P14210-6", "url": "", "sequence": { "sequence": "MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEGK", "length": 210, "header": "sp|P14210-6|HGF_HUMAN Isoform 6 of Hepatocyte growth factor OS=Homo sapiens OX=9606 GN=HGF PE=1 SV=2 CANONICAL=P14210-1" }, "locus": { "chromosome": "7", "start_pos": 81769971, "end_pos": 81752115, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000423064.7", "url": "https://www.ensembl.org/id/ENST00000423064.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000413829.2", "url": "https://www.ensembl.org/id/ENSP00000413829.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G01543ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-294, N-402, T-476, N-566, N-653", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "P14210", "database": "UniCarbKB", "url": "" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" }, { "id": "1482348", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1482348" }, { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G52126RR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G57789QC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G60542VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: ASN-294 AND ASN-402 ; ASN-294 AND ASN-402", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "P14210", "database": "UniCarbKB", "url": "" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" }, { "id": "1482348", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1482348" }, { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G74239ZQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G77252PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-294, N-402, T-476, N-566, N-653", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "P14210", "database": "UniCarbKB", "url": "" }, { "id": "1482348", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1482348" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" }, { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" } ] }, { "glytoucan_ac": "G89664KV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G93656SY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine Complex", "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "P14210", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14210#ptm_processing" } ] }, { "glytoucan_ac": "G01543ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-294, N-402, T-476, N-566, N-653", "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "P14210", "database": "UniCarbKB", "url": "" }, { "id": "1482348", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1482348" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" }, { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G52126RR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G57789QC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G60542VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G74239ZQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G77252PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-294, N-402, T-476, N-566, N-653", "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "P14210", "database": "UniCarbKB", "url": "" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" }, { "id": "1482348", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1482348" }, { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" } ] }, { "glytoucan_ac": "G89664KV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G93656SY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine Complex", "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "P14210", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14210#ptm_processing" } ] }, { "glytoucan_ac": "G45637XA", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-294, N-402, T-476, N-566, N-653", "start_pos": 476, "start_aa": "Thr", "end_pos": 476, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr476", "evidence": [ { "id": "P14210", "database": "UniCarbKB", "url": "" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" }, { "id": "1482348", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1482348" }, { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" } ] }, { "glytoucan_ac": "G81006GJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 476, "start_aa": "Thr", "end_pos": 476, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr476", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "1482348", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1482348" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 476, "start_aa": "Thr", "end_pos": 476, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr476", "evidence": [ { "id": "P14210", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14210#ptm_processing" }, { "id": "1482348", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1482348" } ] }, { "glytoucan_ac": "G01543ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 566, "start_aa": "Asn", "end_pos": 566, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn566", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 566, "start_aa": "Asn", "end_pos": 566, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn566", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-294, N-402, T-476, N-566, N-653", "start_pos": 566, "start_aa": "Asn", "end_pos": 566, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn566", "evidence": [ { "id": "P14210", "database": "UniCarbKB", "url": "" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" }, { "id": "1482348", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1482348" }, { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 566, "start_aa": "Asn", "end_pos": 566, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn566", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 566, "start_aa": "Asn", "end_pos": 566, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn566", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G52126RR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 566, "start_aa": "Asn", "end_pos": 566, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn566", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 566, "start_aa": "Asn", "end_pos": 566, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn566", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G57789QC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 566, "start_aa": "Asn", "end_pos": 566, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn566", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 566, "start_aa": "Asn", "end_pos": 566, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn566", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G74239ZQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 566, "start_aa": "Asn", "end_pos": 566, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn566", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G77252PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-294, N-402, T-476, N-566, N-653", "start_pos": 566, "start_aa": "Asn", "end_pos": 566, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn566", "evidence": [ { "id": "P14210", "database": "UniCarbKB", "url": "" }, { "id": "1482348", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1482348" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" }, { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" } ] }, { "glytoucan_ac": "G89664KV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 566, "start_aa": "Asn", "end_pos": 566, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn566", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine Complex", "start_pos": 566, "start_aa": "Asn", "end_pos": 566, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn566", "evidence": [ { "id": "P14210", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14210#ptm_processing" } ] }, { "glytoucan_ac": "G01543ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 653, "start_aa": "Asn", "end_pos": 653, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn653", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 653, "start_aa": "Asn", "end_pos": 653, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn653", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G17689DH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-294, N-402, T-476, N-566, N-653", "start_pos": 653, "start_aa": "Asn", "end_pos": 653, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn653", "evidence": [ { "id": "P14210", "database": "UniCarbKB", "url": "" }, { "id": "1482348", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1482348" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" }, { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 653, "start_aa": "Asn", "end_pos": 653, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn653", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 653, "start_aa": "Asn", "end_pos": 653, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn653", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G52126RR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 653, "start_aa": "Asn", "end_pos": 653, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn653", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 653, "start_aa": "Asn", "end_pos": 653, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn653", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G57789QC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 653, "start_aa": "Asn", "end_pos": 653, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn653", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 653, "start_aa": "Asn", "end_pos": 653, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn653", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G74239ZQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 653, "start_aa": "Asn", "end_pos": 653, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn653", "evidence": [ { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "glytoucan_ac": "G77252PU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-294, N-402, T-476, N-566, N-653", "start_pos": 653, "start_aa": "Asn", "end_pos": 653, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn653", "evidence": [ { "id": "P14210", "database": "UniCarbKB", "url": "" }, { "id": "8407880", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8407880" }, { "id": "1482348", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1482348" }, { "id": "219", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/219" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine Complex", "start_pos": 653, "start_aa": "Asn", "end_pos": 653, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn653", "evidence": [ { "id": "P14210", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14210#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Cytokine biomarkers of COVID-19", "journal": "medRxiv", "date": "2020", "authors": "Deng H.J., Long Q.X., Liu B.Z., Ren J.H., Liao P., Qiu J.F., Tang X.J., Zhang Y., Tang N., Xu Y.Y., Mo Z., Chen J., Hu J.L., Huang A.L.", "evidence": [ { "database": "GlyGen", "id": "A0078", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "DOI", "id": "10.1101/2020.05.31.20118315", "url": "https://glygen.org/publication/DOI/10.1101/2020.05.31.20118315" } ] }, { "title": "Constitutive activation of Stat3 signaling confers resistance to apoptosis in human U266 myeloma cells.", "journal": "Immunity", "date": "1999", "authors": "Catlett-Falcone R, Landowski TH, Oshiro MM, Turkson J, Levitzki A, Savino R, Ciliberto G, Moscinski L, Fernandez-Luna JL, Nunez G, Dalton WS, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10023775", "url": "https://glygen.org/publication/PubMed/10023775" } ] }, { "title": "Activation of serum- and glucocorticoid-regulated protein kinase by agonists that activate phosphatidylinositide 3-kinase is mediated by 3-phosphoinositide-dependent protein kinase-1 (PDK1) and PDK2.", "journal": "The Biochemical journal", "date": "1999", "authors": "Kobayashi T, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "10191262", "url": "https://glygen.org/publication/PubMed/10191262" } ] }, { "title": "Crystal structure of the interleukin-4/receptor alpha chain complex reveals a mosaic binding interface.", "journal": "Cell", "date": "1999", "authors": "Hage T, Sebald W, Reinemer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10219247", "url": "https://glygen.org/publication/PubMed/10219247" } ] }, { "title": "Regulation of the germline immunoglobulin Cgamma1 promoter by CD40 ligand and IL-4: dual role for tandem NF-kappaB binding sites.", "journal": "Molecular immunology", "date": "1999", "authors": "Warren WD, Roberts KL, Linehan LA, Berton MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10369418", "url": "https://glygen.org/publication/PubMed/10369418" } ] }, { "title": "Two co-existing mechanisms for nuclear import of MAP kinase: passive diffusion of a monomer and active transport of a dimer.", "journal": "The EMBO journal", "date": "1999", "authors": "Adachi M, Fukuda M, Nishida E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "10508167", "url": "https://glygen.org/publication/PubMed/10508167" } ] }, { "title": "Functional synergism of STAT6 with either NF-kappa B or PU.1 to mediate IL-4-induced activation of IgE germline gene transcription.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Stutz AM, Woisetschlager M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10510379", "url": "https://glygen.org/publication/PubMed/10510379" } ] }, { "title": "HGF induces FAK activation and integrin-mediated adhesion in MTLn3 breast carcinoma cells.", "journal": "International journal of cancer", "date": "1999", "authors": "Beviglia L, Kramer RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081" } ], "reference": [ { "type": "PubMed", "id": "10521801", "url": "https://glygen.org/publication/PubMed/10521801" } ] }, { "title": "Activation of eotaxin gene transcription by NF-kappa B and STAT6 in human airway epithelial cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Matsukura S, Stellato C, Plitt JR, Bickel C, Miura K, Georas SN, Casolaro V, Schleimer RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10586089", "url": "https://glygen.org/publication/PubMed/10586089" } ] }, { "title": "Met-induced JNK activation is mediated by the adapter protein Crk and correlates with the Gab1 - Crk signaling complex formation.", "journal": "Oncogene", "date": "1999", "authors": "Garcia-Guzman M, Dolfi F, Zeh K, Vuori K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8875555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875555" } ], "reference": [ { "type": "PubMed", "id": "10618718", "url": "https://glygen.org/publication/PubMed/10618718" } ] }, { "title": "A novel positive feedback loop mediated by the docking protein Gab1 and phosphatidylinositol 3-kinase in epidermal growth factor receptor signaling.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Rodrigues GA, Falasca M, Zhang Z, Ong SH, Schlessinger J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8851907", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8851907" } ], "reference": [ { "type": "PubMed", "id": "10648629", "url": "https://glygen.org/publication/PubMed/10648629" } ] }, { "title": "Signaling of hepatocyte growth factor/scatter factor (HGF) to the small GTPase Rap1 via the large docking protein Gab1 and the adapter protein CRKL.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Sakkab D, Lewitzky M, Posern G, Schaeper U, Sachs M, Birchmeier W, Feller SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8875555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875555" } ], "reference": [ { "type": "PubMed", "id": "10753869", "url": "https://glygen.org/publication/PubMed/10753869" } ] }, { "title": "Signal transducer and activator of transcription 3 activates CCAAT enhancer-binding protein delta gene transcription in G0 growth-arrested mouse mammary epithelial cells and in involuting mouse mammary gland.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Hutt JA, O'Rourke JP, DeWille J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "10867011", "url": "https://glygen.org/publication/PubMed/10867011" } ] }, { "title": "A novel RalGEF-like protein, RGL3, as a candidate effector for rit and Ras.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Shao H, Andres DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "10869344", "url": "https://glygen.org/publication/PubMed/10869344" } ] }, { "title": "Coupling of Gab1 to c-Met, Grb2, and Shp2 mediates biological responses.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Schaeper U, Gehring NH, Fuchs KP, Sachs M, Kempkes B, Birchmeier W", "evidence": [ { "database": "Reactome", "id": "R-HSA-8875555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875555" } ], "reference": [ { "type": "PubMed", "id": "10871282", "url": "https://glygen.org/publication/PubMed/10871282" } ] }, { "title": "Flt3 ligand induces tyrosine phosphorylation of gab1 and gab2 and their association with shp-2, grb2, and PI3 kinase.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Zhang S, Broxmeyer HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "11027663", "url": "https://glygen.org/publication/PubMed/11027663" } ] }, { "title": "Characterization of IL-4 and IL-13 signals dependent on the human IL-13 receptor alpha chain 1: redundancy of requirement of tyrosine residue for STAT3 activation.", "journal": "International immunology", "date": "2000", "authors": "Umeshita-Suyama R, Sugimoto R, Akaiwa M, Arima K, Yu B, Wada M, Kuwano M, Nakajima K, Hamasaki N, Izuhara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11058569", "url": "https://glygen.org/publication/PubMed/11058569" } ] }, { "title": "A stat-responsive element in the promoter of the episialin/MUC1 gene is involved in its overexpression in carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Gaemers IC, Vos HL, Volders HH, van der Valk SW, Hilkens J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11084045", "url": "https://glygen.org/publication/PubMed/11084045" } ] }, { "title": "Flt3 mutations from patients with acute myeloid leukemia induce transformation of 32D cells mediated by the Ras and STAT5 pathways.", "journal": "Blood", "date": "2000", "authors": "Mizuki M, Fenski R, Halfter H, Matsumura I, Schmidt R, Muller C, Gruning W, Kratz-Albers K, Serve S, Steur C, Buchner T, Kienast J, Kanakura Y, Berdel WE, Serve H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "11090077", "url": "https://glygen.org/publication/PubMed/11090077" } ] }, { "title": "Direct regulation of pituitary proopiomelanocortin by STAT3 provides a novel mechanism for immuno-neuroendocrine interfacing.", "journal": "The Journal of clinical investigation", "date": "2000", "authors": "Bousquet C, Zatelli MC, Melmed S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11104795", "url": "https://glygen.org/publication/PubMed/11104795" } ] }, { "title": "Suppression of signal transducer and activator of transcription 3-dependent B lymphocyte terminal differentiation by BCL-6.", "journal": "The Journal of experimental medicine", "date": "2000", "authors": "Reljic R, Wagner SD, Peakman LJ, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11120780", "url": "https://glygen.org/publication/PubMed/11120780" } ] }, { "title": "Crystal structure and functional analysis of Ras binding to its effector phosphoinositide 3-kinase gamma.", "journal": "Cell", "date": "2000", "authors": "Pacold ME, Suire S, Perisic O, Lara-Gonzalez S, Davis CT, Walker EH, Hawkins PT, Stephens L, Eccleston JF, Williams RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "11136978", "url": "https://glygen.org/publication/PubMed/11136978" } ] }, { "title": "A switch from p130Cas/Crk to Gab1/Crk signaling correlates with anchorage independent growth and JNK activation in cells transformed by the Met receptor oncoprotein.", "journal": "Oncogene", "date": "2000", "authors": "Lamorte L, Kamikura DM, Park M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8875555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875555" } ], "reference": [ { "type": "PubMed", "id": "11146548", "url": "https://glygen.org/publication/PubMed/11146548" } ] }, { "title": "Thrombin regulates vascular smooth muscle cell growth and heat shock proteins via the JAK-STAT pathway.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Madamanchi NR, Li S, Patterson C, Runge MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11278437", "url": "https://glygen.org/publication/PubMed/11278437" } ] }, { "title": "Co-operative effect of c-Src tyrosine kinase and Stat3 in activation of hepatocyte growth factor expression in mammary carcinoma cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Hung W, Elliott B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11278729", "url": "https://glygen.org/publication/PubMed/11278729" } ] }, { "title": "A novel potential effector of M-Ras and p21 Ras negatively regulates p21 Ras-mediated gene induction and cell growth.", "journal": "Oncogene", "date": "2001", "authors": "Ehrhardt GR, Korherr C, Wieler JS, Knaus M, Schrader JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "11313946", "url": "https://glygen.org/publication/PubMed/11313946" } ] }, { "title": "Phosphotyrosines 627 and 659 of Gab1 constitute a bisphosphoryl tyrosine-based activation motif (BTAM) conferring binding and activation of SHP2.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Cunnick JM, Mei L, Doupnik CA, Wu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8865999", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8865999" } ], "reference": [ { "type": "PubMed", "id": "11323411", "url": "https://glygen.org/publication/PubMed/11323411" } ] }, { "title": "c-Jun and c-Fos cooperate with STAT3 in IL-6-induced transactivation of the IL-6 respone element (IRE).", "journal": "Cytokine", "date": "2001", "authors": "Schuringa JJ, Timmer H, Luttickhuizen D, Vellenga E, Kruijer W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11356008", "url": "https://glygen.org/publication/PubMed/11356008" } ] }, { "title": "Stat3-mediated Myc expression is required for Src transformation and PDGF-induced mitogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Bowman T, Broome MA, Sinibaldi D, Wharton W, Pledger WJ, Sedivy JM, Irby R, Yeatman T, Courtneidge SA, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11404481", "url": "https://glygen.org/publication/PubMed/11404481" } ] }, { "title": "Human thymic stromal lymphopoietin preferentially stimulates myeloid cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Reche PA, Soumelis V, Gorman DM, Clifford T, Liu Mr, Travis M, Zurawski SM, Johnston J, Liu YJ, Spits H, de Waal Malefyt R, Kastelein RA, Bazan JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "11418668", "url": "https://glygen.org/publication/PubMed/11418668" } ] }, { "title": "Cooperation between STAT3 and c-jun suppresses Fas transcription.", "journal": "Molecular cell", "date": "2001", "authors": "Ivanov VN, Bhoumik A, Krasilnikov M, Raz R, Owen-Schaub LB, Levy D, Horvath CM, Ronai Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11463377", "url": "https://glygen.org/publication/PubMed/11463377" } ] }, { "title": "Evidence for existence of a nuclear pore complex-mediated, cytosol-independent pathway of nuclear translocation of ERK MAP kinase in permeabilized cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Matsubayashi Y, Fukuda M, Nishida E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "11546808", "url": "https://glygen.org/publication/PubMed/11546808" } ] }, { "title": "Cutting edge: Identification of a hybrid cytokine consisting of IL-7 and the beta-chain of the hepatocyte growth factor/scatter factor.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Lai L, Goldschneider I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "11564764", "url": "https://glygen.org/publication/PubMed/11564764" } ] }, { "title": "PEA-15 mediates cytoplasmic sequestration of ERK MAP kinase.", "journal": "Developmental cell", "date": "2001", "authors": "Formstecher E, Ramos JW, Fauquet M, Calderwood DA, Hsieh JC, Canton B, Nguyen XT, Barnier JV, Camonis J, Ginsberg MH, Chneiweiss H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "11702783", "url": "https://glygen.org/publication/PubMed/11702783" } ] }, { "title": "The IL-7 receptor controls the accessibility of the TCRgamma locus by Stat5 and histone acetylation.", "journal": "Immunity", "date": "2001", "authors": "Ye SK, Agata Y, Lee HC, Kurooka H, Kitamura T, Shimizu A, Honjo T, Ikuta K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "11728342", "url": "https://glygen.org/publication/PubMed/11728342" } ] }, { "title": "Mutation of the c-Cbl TKB domain binding site on the Met receptor tyrosine kinase converts it into a transforming protein.", "journal": "Molecular cell", "date": "2001", "authors": "Peschard P, Fournier TM, Lamorte L, Naujokas MA, Band H, Langdon WY, Park M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "11741535", "url": "https://glygen.org/publication/PubMed/11741535" } ] }, { "title": "Rac1 and RhoG promote cell survival by the activation of PI3K and Akt, independently of their ability to stimulate JNK and NF-kappaB.", "journal": "Oncogene", "date": "2002", "authors": "Murga C, Zohar M, Teramoto H, Gutkind JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "11803464", "url": "https://glygen.org/publication/PubMed/11803464" } ] }, { "title": "Requirement of Stat3 signaling for HGF/SF-Met mediated tumorigenesis.", "journal": "Oncogene", "date": "2002", "authors": "Zhang YW, Wang LM, Jove R, Vande Woude GF", "evidence": [ { "database": "Reactome", "id": "R-HSA-8875791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875791" } ], "reference": [ { "type": "PubMed", "id": "11803465", "url": "https://glygen.org/publication/PubMed/11803465" } ] }, { "title": "The endophilin-CIN85-Cbl complex mediates ligand-dependent downregulation of c-Met.", "journal": "Nature", "date": "2002", "authors": "Petrelli A, Gilestro GF, Lanzardo S, Comoglio PM, Migone N, Giordano S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "11894096", "url": "https://glygen.org/publication/PubMed/11894096" } ] }, { "title": "Constitutive Stat3 activity up-regulates VEGF expression and tumor angiogenesis.", "journal": "Oncogene", "date": "2002", "authors": "Niu G, Wright KL, Huang M, Song L, Haura E, Turkson J, Zhang S, Wang T, Sinibaldi D, Coppola D, Heller R, Ellis LM, Karras J, Bromberg J, Pardoll D, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "11960372", "url": "https://glygen.org/publication/PubMed/11960372" } ] }, { "title": "Crk adapter proteins promote an epithelial-mesenchymal-like transition and are required for HGF-mediated cell spreading and breakdown of epithelial adherens junctions.", "journal": "Molecular biology of the cell", "date": "2002", "authors": "Lamorte L, Royal I, Naujokas M, Park M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8875555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875555" } ], "reference": [ { "type": "PubMed", "id": "12006644", "url": "https://glygen.org/publication/PubMed/12006644" } ] }, { "title": "ERK2 enters the nucleus by a carrier-independent mechanism.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Whitehurst AW, Wilsbacher JL, You Y, Luby-Phelps K, Moore MS, Cobb MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "12032311", "url": "https://glygen.org/publication/PubMed/12032311" } ] }, { "title": "The phosphatidylinositol 3-Kinase AKT pathway in human cancer.", "journal": "Nature reviews. Cancer", "date": "2002", "authors": "Vivanco I, Sawyers CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "12094235", "url": "https://glygen.org/publication/PubMed/12094235" } ] }, { "title": "Activation of phosphoinositide 3-kinase gamma by Ras.", "journal": "Current biology : CB", "date": "2002", "authors": "Suire S, Hawkins P, Stephens L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "12121613", "url": "https://glygen.org/publication/PubMed/12121613" } ] }, { "title": "Crk synergizes with epidermal growth factor for epithelial invasion and morphogenesis and is required for the met morphogenic program.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Lamorte L, Rodrigues S, Naujokas M, Park M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8875555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875555" } ], "reference": [ { "type": "PubMed", "id": "12138161", "url": "https://glygen.org/publication/PubMed/12138161" } ] }, { "title": "Activation of Ras/Erk pathway by a novel MET-interacting protein RanBPM.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Wang D, Li Z, Messing EM, Wu G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8851805", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8851805" } ], "reference": [ { "type": "PubMed", "id": "12147692", "url": "https://glygen.org/publication/PubMed/12147692" } ] }, { "title": "Multiple phosphoinositide 3-kinase-dependent steps in activation of protein kinase B.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Scheid MP, Marignani PA, Woodgett JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "12167717", "url": "https://glygen.org/publication/PubMed/12167717" } ] }, { "title": "Pre-pro-B cell growth-stimulating factor (PPBSF) upregulates IL-7Ralpha chain expression and enables pro-B cells to respond to monomeric IL-7.", "journal": "Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research", "date": "2002", "authors": "Wei C, Lai L, Goldschneider I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "12184921", "url": "https://glygen.org/publication/PubMed/12184921" } ] }, { "title": "IL-13 signal transduction in human monocytes: phosphorylation of receptor components, association with Jaks, and phosphorylation/activation of Stats.", "journal": "Journal of leukocyte biology", "date": "2002", "authors": "Roy B, Bhattacharjee A, Xu B, Ford D, Maizel AL, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12223527", "url": "https://glygen.org/publication/PubMed/12223527" } ] }, { "title": "Expression of the suppressor of cytokine signaling-5 (SOCS5) negatively regulates IL-4-dependent STAT6 activation and Th2 differentiation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Seki Y, Hayashi K, Matsumoto A, Seki N, Tsukada J, Ransom J, Naka T, Kishimoto T, Yoshimura A, Kubo M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12242343", "url": "https://glygen.org/publication/PubMed/12242343" } ] }, { "title": "c-Cbl is involved in Met signaling in B cells and mediates hepatocyte growth factor-induced receptor ubiquitination.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2002", "authors": "Taher TE, Tjin EP, Beuling EA, Borst J, Spaargaren M, Pals ST", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "12244174", "url": "https://glygen.org/publication/PubMed/12244174" } ] }, { "title": "Hepatocyte growth factor receptor tyrosine kinase met is a substrate of the receptor protein-tyrosine phosphatase DEP-1.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Palka HL, Park M, Tonks NK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "12475979", "url": "https://glygen.org/publication/PubMed/12475979" } ] }, { "title": "STAM and Hrs are subunits of a multivalent ubiquitin-binding complex on early endosomes.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Bache KG, Raiborg C, Mehlum A, Stenmark H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "12551915", "url": "https://glygen.org/publication/PubMed/12551915" } ] }, { "title": "Independent and cooperative activation of chromosomal c-fos promoter by STAT3.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Yang E, Lerner L, Besser D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12600988", "url": "https://glygen.org/publication/PubMed/12600988" } ] }, { "title": "Endosomal dynamics of Met determine signaling output.", "journal": "Molecular biology of the cell", "date": "2003", "authors": "Hammond DE, Carter S, McCullough J, Urbe S, Vande Woude G, Clague MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "12686592", "url": "https://glygen.org/publication/PubMed/12686592" } ] }, { "title": "Hypoxia promotes invasive growth by transcriptional activation of the met protooncogene.", "journal": "Cancer cell", "date": "2003", "authors": "Pennacchietti S, Michieli P, Galluzzo M, Mazzone M, Giordano S, Comoglio PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6806942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6806942" } ], "reference": [ { "type": "PubMed", "id": "12726861", "url": "https://glygen.org/publication/PubMed/12726861" } ] }, { "title": "Grb2-independent recruitment of Gab1 requires the C-terminal lobe and structural integrity of the Met receptor kinase domain.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Lock LS, Frigault MM, Saucier C, Park M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8851907", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8851907" } ], "reference": [ { "type": "PubMed", "id": "12766170", "url": "https://glygen.org/publication/PubMed/12766170" } ] }, { "title": "Threonine 308 phosphorylated form of Akt translocates to the nucleus of PC12 cells under nerve growth factor stimulation and associates with the nuclear matrix protein nucleolin.", "journal": "Journal of cellular physiology", "date": "2003", "authors": "Borgatti P, Martelli AM, Tabellini G, Bellacosa A, Capitani S, Neri LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "12767043", "url": "https://glygen.org/publication/PubMed/12767043" } ] }, { "title": "A functional domain in the heavy chain of scatter factor/hepatocyte growth factor binds the c-Met receptor and induces cell dissociation but not mitogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Hartmann G, Naldini L, Weidner KM, Sachs M, Vigna E, Comoglio PM, Birchmeier W", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" }, { "database": "Reactome", "id": "R-HSA-6806942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6806942" } ], "reference": [ { "type": "PubMed", "id": "1280830", "url": "https://glygen.org/publication/PubMed/1280830" } ] }, { "title": "STATs dimerize in the absence of phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Braunstein J, Brutsaert S, Olson R, Schindler C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "12832402", "url": "https://glygen.org/publication/PubMed/12832402" } ] }, { "title": "Expression of the Wdr9 gene and protein products during mouse development.", "journal": "Developmental dynamics : an official publication of the American Association of Anatomists", "date": "2003", "authors": "Huang H, Rambaldi I, Daniels E, Featherstone M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "12889071", "url": "https://glygen.org/publication/PubMed/12889071" } ] }, { "title": "Structure-function analysis of hepatocyte growth factor: identification of variants that lack mitogenic activity yet retain high affinity receptor binding.", "journal": "EMBO J.", "date": "1992", "authors": "Lokker N A, Mark M R, Luis E A, Bennett G L, Robbins K A, Baker J B, Godowski P J", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "reference": [ { "type": "PubMed", "id": "1321034", "url": "https://glygen.org/publication/PubMed/1321034" } ] }, { "title": "Regulation of protein serine-threonine phosphatase type-2A by tyrosine phosphorylation.", "journal": "Science (New York, N.Y.)", "date": "1992", "authors": "Chen J, Martin BL, Brautigan DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811558" } ], "reference": [ { "type": "PubMed", "id": "1325671", "url": "https://glygen.org/publication/PubMed/1325671" } ] }, { "title": "Isolation of dense granules from human platelets.", "journal": "Methods in enzymology", "date": "1992", "authors": "Fukami MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "1435334", "url": "https://glygen.org/publication/PubMed/1435334" } ] }, { "title": "A novel small molecule met inhibitor induces apoptosis in cells transformed by the oncogenic TPR-MET tyrosine kinase.", "journal": "Cancer research", "date": "2003", "authors": "Sattler M, Pride YB, Ma P, Gramlich JL, Chu SC, Quinnan LA, Shirazian S, Liang C, Podar K, Christensen JG, Salgia R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "14500382", "url": "https://glygen.org/publication/PubMed/14500382" } ] }, { "title": "PEA-15 binding to ERK1/2 MAPKs is required for its modulation of integrin activation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Chou FL, Hill JM, Hsieh JC, Pouyssegur J, Brunet A, Glading A, Uberall F, Ramos JW, Werner MH, Ginsberg MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "14506247", "url": "https://glygen.org/publication/PubMed/14506247" } ] }, { "title": "Prevention of organ allograft rejection by a specific Janus kinase 3 inhibitor.", "journal": "Science (New York, N.Y.)", "date": "2003", "authors": "Changelian PS, Flanagan ME, Ball DJ, Kent CR, Magnuson KS, Martin WH, Rizzuti BJ, Sawyer PS, Perry BD, Brissette WH, McCurdy SP, Kudlacz EM, Conklyn MJ, Elliott EA, Koslov ER, Fisher MB, Strelevitz TJ, Yoon K, Whipple DA, Sun J, Munchhof MJ, Doty JL, Casavant JM, Blumenkopf TA, Hines M, Brown MF, Lillie BM, Subramanyam C, Shang-Poa C, Milici AJ, Beckius GE, Moyer JD, Su C, Woodworth TG, Gaweco AS, Beals CR, Littman BH, Fisher DA, Smith JF, Zagouras P, Magna HA, Saltarelli MJ, Johnson KS, Nelms LF, Des Etages SG, Hayes LS, Kawabata TT, Finco-Kent D, Baker DL, Larson M, Si MS, Paniagua R, Higgins J, Holm B, Reitz B, Zhou YJ, Morris RE, O'Shea JJ, Borie DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "14593182", "url": "https://glygen.org/publication/PubMed/14593182" } ] }, { "title": "A selective small molecule inhibitor of c-Met kinase inhibits c-Met-dependent phenotypes in vitro and exhibits cytoreductive antitumor activity in vivo.", "journal": "Cancer research", "date": "2003", "authors": "Christensen JG, Schreck R, Burrows J, Kuruganti P, Chan E, Le P, Chen J, Wang X, Ruslim L, Blake R, Lipson KE, Ramphal J, Do S, Cui JJ, Cherrington JM, Mendel DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "14612533", "url": "https://glygen.org/publication/PubMed/14612533" } ] }, { "title": "Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.", "journal": "Blood", "date": "2004", "authors": "Coppinger JA, Cagney G, Toomey S, Kislinger T, Belton O, McRedmond JP, Cahill DJ, Emili A, Fitzgerald DJ, Maguire PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "14630798", "url": "https://glygen.org/publication/PubMed/14630798" } ] }, { "title": "IL-4 and IL-13 induce SOCS-1 gene expression in A549 cells by three functional STAT6-binding motifs located upstream of the transcription initiation site.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Hebenstreit D, Luft P, Schmiedlechner A, Regl G, Frischauf AM, Aberger F, Duschl A, Horejs-Hoeck J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "14634100", "url": "https://glygen.org/publication/PubMed/14634100" } ] }, { "title": "A novel MET-interacting protein shares high sequence similarity with RanBPM, but fails to stimulate MET-induced Ras/Erk signaling.", "journal": "Biochemical and biophysical research communications", "date": "2004", "authors": "Wang D, Li Z, Schoen SR, Messing EM, Wu G", "evidence": [ { "database": "Reactome", "id": "R-HSA-8851805", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8851805" } ], "reference": [ { "type": "PubMed", "id": "14684163", "url": "https://glygen.org/publication/PubMed/14684163" } ] }, { "title": "The death effector domain protein PEA-15 prevents nuclear entry of ERK2 by inhibiting required interactions.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Whitehurst AW, Robinson FL, Moore MS, Cobb MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "14707138", "url": "https://glygen.org/publication/PubMed/14707138" } ] }, { "title": "Stat3 enhances vimentin gene expression by binding to the antisilencer element and interacting with the repressor protein, ZBP-89.", "journal": "Oncogene", "date": "2004", "authors": "Wu Y, Diab I, Zhang X, Izmailova ES, Zehner ZE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "14712222", "url": "https://glygen.org/publication/PubMed/14712222" } ] }, { "title": "Hepatocyte growth factor is linked by O-glycosylated oligosaccharide on the alpha chain.", "journal": "Biochemical and biophysical research communications", "date": "1992", "authors": "Shimizu N, Hara H, Sogabe T, Sakai H, Ihara I, Inoue H, Nakamura T, Shimizu S", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210#ptm_processing" }, { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" }, { "database": "UniCarbKB", "id": "P14210", "url": "" }, { "database": "GlyConnect", "id": "219", "url": "https://glyconnect.expasy.org/browser/proteins/219" } ], "reference": [ { "type": "PubMed", "id": "1482348", "url": "https://glygen.org/publication/PubMed/1482348" } ] }, { "title": "Stat3 activation regulates the expression of matrix metalloproteinase-2 and tumor invasion and metastasis.", "journal": "Oncogene", "date": "2004", "authors": "Xie TX, Wei D, Liu M, Gao AC, Ali-Osman F, Sawaya R, Huang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15116091", "url": "https://glygen.org/publication/PubMed/15116091" } ] }, { "title": "A conserved DpYR motif in the juxtamembrane domain of the Met receptor family forms an atypical c-Cbl/Cbl-b tyrosine kinase binding domain binding site required for suppression of oncogenic activation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Peschard P, Ishiyama N, Lin T, Lipkowitz S, Park M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "15123609", "url": "https://glygen.org/publication/PubMed/15123609" } ] }, { "title": "Crystal structure of the HGF beta-chain in complex with the Sema domain of the Met receptor.", "journal": "The EMBO journal", "date": "2004", "authors": "Stamos J, Lazarus RA, Yao X, Kirchhofer D, Wiesmann C", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" }, { "database": "Reactome", "id": "R-HSA-6806942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6806942" } ], "reference": [ { "type": "PubMed", "id": "15167892", "url": "https://glygen.org/publication/PubMed/15167892" } ] }, { "title": "Structural and functional basis of the serine protease-like hepatocyte growth factor beta-chain in Met binding and signaling.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kirchhofer D, Yao X, Peek M, Eigenbrot C, Lipari MT, Billeci KL, Maun HR, Moran P, Santell L, Wiesmann C, Lazarus RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6806942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6806942" } ], "reference": [ { "type": "PubMed", "id": "15218027", "url": "https://glygen.org/publication/PubMed/15218027" } ] }, { "title": "STAT-1 is activated by IL-4 and IL-13 in multiple cell types.", "journal": "Molecular immunology", "date": "2004", "authors": "Wang IM, Lin H, Goldman SJ, Kobayashi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15261459", "url": "https://glygen.org/publication/PubMed/15261459" } ] }, { "title": "The nucleotide transporter MRP4 (ABCC4) is highly expressed in human platelets and present in dense granules, indicating a role in mediator storage.", "journal": "Blood", "date": "2004", "authors": "Jedlitschky G, Tirschmann K, Lubenow LE, Nieuwenhuis HK, Akkerman JW, Greinacher A, Kroemer HK", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "15297306", "url": "https://glygen.org/publication/PubMed/15297306" } ] }, { "title": "Oligomerization-dependent changes in the thermodynamic properties of the TPR-MET receptor tyrosine kinase.", "journal": "Biochemistry", "date": "2004", "authors": "Hays JL, Watowich SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6806942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6806942" } ], "reference": [ { "type": "PubMed", "id": "15301554", "url": "https://glygen.org/publication/PubMed/15301554" } ] }, { "title": "MUC20 suppresses the hepatocyte growth factor-induced Grb2-Ras pathway by binding to a multifunctional docking site of met.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Higuchi T, Orita T, Katsuya K, Yamasaki Y, Akiyama K, Li H, Yamamoto T, Saito Y, Nakamura M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8851805", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8851805" } ], "reference": [ { "type": "PubMed", "id": "15314156", "url": "https://glygen.org/publication/PubMed/15314156" } ] }, { "title": "Hepsin promotes prostate cancer progression and metastasis.", "journal": "Cancer cell", "date": "2004", "authors": "Klezovitch O, Chevillet J, Mirosevich J, Roberts RL, Matusik RJ, Vasioukhin V", "evidence": [ { "database": "Reactome", "id": "R-HSA-6806942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6806942" } ], "reference": [ { "type": "PubMed", "id": "15324701", "url": "https://glygen.org/publication/PubMed/15324701" } ] }, { "title": "Activation of PI3K is indispensable for interleukin 7-mediated viability, proliferation, glucose use, and growth of T cell acute lymphoblastic leukemia cells.", "journal": "The Journal of experimental medicine", "date": "2004", "authors": "Barata JT, Silva A, Brandao JG, Nadler LM, Cardoso AA, Boussiotis VA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "15353558", "url": "https://glygen.org/publication/PubMed/15353558" } ] }, { "title": "Phosphorylation of Grb2-associated binder 2 on serine 623 by ERK MAPK regulates its association with the phosphatase SHP-2 and decreases STAT5 activation.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Arnaud M, Crouin C, Deon C, Loyaux D, Bertoglio J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "15356145", "url": "https://glygen.org/publication/PubMed/15356145" } ] }, { "title": "Nuclear localization and regulation of erk- and rsk-encoded protein kinases.", "journal": "Molecular and cellular biology", "date": "1992", "authors": "Chen RH, Sarnecki C, Blenis J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "1545823", "url": "https://glygen.org/publication/PubMed/1545823" } ] }, { "title": "Live Cell Imaging of ERK and MEK: simple binding equilibrium explains the regulated nucleocytoplasmic distribution of ERK.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Burack WR, Shaw AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "15546878", "url": "https://glygen.org/publication/PubMed/15546878" } ] }, { "title": "STAT6 transcription factor binding sites with mismatches within the canonical 5'-TTC...GAA-3' motif involved in regulation of delta- and mu-opioid receptors.", "journal": "Journal of neurochemistry", "date": "2004", "authors": "Borner C, Woltje M, Hollt V, Kraus J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15584925", "url": "https://glygen.org/publication/PubMed/15584925" } ] }, { "title": "Conformational lability in serine protease active sites: structures of hepatocyte growth factor activator (HGFA) alone and with the inhibitory domain from HGFA inhibitor-1B.", "journal": "Journal of molecular biology", "date": "2005", "authors": "Shia S, Stamos J, Kirchhofer D, Fan B, Wu J, Corpuz RT, Santell L, Lazarus RA, Eigenbrot C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6806942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6806942" } ], "reference": [ { "type": "PubMed", "id": "15713485", "url": "https://glygen.org/publication/PubMed/15713485" } ] }, { "title": "Phosphorylation and regulation of Akt/PKB by the rictor-mTOR complex.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Sarbassov DD, Guertin DA, Ali SM, Sabatini DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "15718470", "url": "https://glygen.org/publication/PubMed/15718470" } ] }, { "title": "Stat5 mediates the IL-7-induced accessibility of a representative D-Distal VH gene.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Stanton ML, Brodeur PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "15749844", "url": "https://glygen.org/publication/PubMed/15749844" } ] }, { "title": "Hepsin activates pro-hepatocyte growth factor and is inhibited by hepatocyte growth factor activator inhibitor-1B (HAI-1B) and HAI-2.", "journal": "FEBS letters", "date": "2005", "authors": "Kirchhofer D, Peek M, Lipari MT, Billeci K, Fan B, Moran P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6806942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6806942" } ], "reference": [ { "type": "PubMed", "id": "15792801", "url": "https://glygen.org/publication/PubMed/15792801" } ] }, { "title": "Aberrant Stat3 signaling by interleukin-4 in malignant glioma cells: involvement of IL-13Ralpha2.", "journal": "Cancer research", "date": "2005", "authors": "Rahaman SO, Vogelbaum MA, Haque SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15805299", "url": "https://glygen.org/publication/PubMed/15805299" } ] }, { "title": "Growth factors induce differential phosphorylation profiles of the Hrs-STAM complex: a common node in signalling networks with signal-specific properties.", "journal": "The Biochemical journal", "date": "2005", "authors": "Row PE, Clague MJ, Urbe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "15828871", "url": "https://glygen.org/publication/PubMed/15828871" } ] }, { "title": "PI 3-kinase p110beta: a new target for antithrombotic therapy.", "journal": "Nature medicine", "date": "2005", "authors": "Jackson SP, Schoenwaelder SM, Goncalves I, Nesbitt WS, Yap CL, Wright CE, Kenche V, Anderson KE, Dopheide SM, Yuan Y, Sturgeon SA, Prabaharan H, Thompson PE, Smith GD, Shepherd PR, Daniele N, Kulkarni S, Abbott B, Saylik D, Jones C, Lu L, Giuliano S, Hughan SC, Angus JA, Robertson AD, Salem HH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "15834429", "url": "https://glygen.org/publication/PubMed/15834429" } ] }, { "title": "Activation of the c-Met receptor complex in fibroblasts drives invasive cell behavior by signaling through transcription factor STAT3.", "journal": "Journal of cellular biochemistry", "date": "2005", "authors": "Cramer A, Kleiner S, Westermann M, Meissner A, Lange A, Friedrich K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8875791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875791" } ], "reference": [ { "type": "PubMed", "id": "15838885", "url": "https://glygen.org/publication/PubMed/15838885" } ] }, { "title": "Gene expression alterations of human peripheral blood monocytes induced by medium-term treatment with the TH2-cytokines interleukin-4 and -13.", "journal": "Cytokine", "date": "2005", "authors": "Chaitidis P, O'Donnell V, Kuban RJ, Bermudez-Fajardo A, Ungethuem U, Kuhn H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15869882", "url": "https://glygen.org/publication/PubMed/15869882" } ] }, { "title": "Nuclear interaction of EGFR and STAT3 in the activation of the iNOS/NO pathway.", "journal": "Cancer cell", "date": "2005", "authors": "Lo HW, Hsu SC, Ali-Seyed M, Gunduz M, Xia W, Wei Y, Bartholomeusz G, Shih JY, Hung MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "15950906", "url": "https://glygen.org/publication/PubMed/15950906" } ] }, { "title": "Targeting Stat3 blocks both HIF-1 and VEGF expression induced by multiple oncogenic growth signaling pathways.", "journal": "Oncogene", "date": "2005", "authors": "Xu Q, Briggs J, Park S, Niu G, Kortylewski M, Zhang S, Gritsko T, Turkson J, Kay H, Semenza GL, Cheng JQ, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16007214", "url": "https://glygen.org/publication/PubMed/16007214" } ] }, { "title": "STAT3-mediated transcription of Bcl-2, Mcl-1 and c-IAP2 prevents apoptosis in polyamine-depleted cells.", "journal": "The Biochemical journal", "date": "2005", "authors": "Bhattacharya S, Ray RM, Johnson LR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16048438", "url": "https://glygen.org/publication/PubMed/16048438" } ] }, { "title": "Role of Stat3 in regulating p53 expression and function.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Niu G, Wright KL, Ma Y, Wright GM, Huang M, Irby R, Briggs J, Karras J, Cress WD, Pardoll D, Jove R, Chen J, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16107692", "url": "https://glygen.org/publication/PubMed/16107692" } ] }, { "title": "Listeria hijacks the clathrin-dependent endocytic machinery to invade mammalian cells.", "journal": "Nature cell biology", "date": "2005", "authors": "Veiga E, Cossart P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "16113677", "url": "https://glygen.org/publication/PubMed/16113677" } ] }, { "title": "Requirement of STAT3 activation for maximal collagenase-1 (MMP-1) induction by epidermal growth factor and malignant characteristics in T24 bladder cancer cells.", "journal": "Oncogene", "date": "2006", "authors": "Itoh M, Murata T, Suzuki T, Shindoh M, Nakajima K, Imai K, Yoshida K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16205632", "url": "https://glygen.org/publication/PubMed/16205632" } ] }, { "title": "Met/Hepatocyte growth factor receptor ubiquitination suppresses transformation and is required for Hrs phosphorylation.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Abella JV, Peschard P, Naujokas MA, Lin T, Saucier C, Urbe S, Park M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "16227611", "url": "https://glygen.org/publication/PubMed/16227611" } ] }, { "title": "Essential role of STAT3 in cytokine-driven NF-kappaB-mediated serum amyloid A gene expression.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2005", "authors": "Hagihara K, Nishikawa T, Sugamata Y, Song J, Isobe T, Taga T, Yoshizaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16236134", "url": "https://glygen.org/publication/PubMed/16236134" } ] }, { "title": "The oncogenic properties of mutant p110alpha and p110beta phosphatidylinositol 3-kinases in human mammary epithelial cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Zhao JJ, Liu Z, Wang L, Shin E, Loda MF, Roberts TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "16339315", "url": "https://glygen.org/publication/PubMed/16339315" } ] }, { "title": "Persistent activation of stat3 signaling induces survivin gene expression and confers resistance to apoptosis in human breast cancer cells.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2006", "authors": "Gritsko T, Williams A, Turkson J, Kaneko S, Bowman T, Huang M, Nam S, Eweis I, Diaz N, Sullivan D, Yoder S, Enkemann S, Eschrich S, Lee JH, Beam CA, Cheng J, Minton S, Muro-Cacho CA, Jove R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16397018", "url": "https://glygen.org/publication/PubMed/16397018" } ] }, { "title": "A novel activating function of c-Src and Stat3 on HGF transcription in mammary carcinoma cells.", "journal": "Oncogene", "date": "2006", "authors": "Wojcik EJ, Sharifpoor S, Miller NA, Wright TG, Watering R, Tremblay EA, Swan K, Mueller CR, Elliott BE", "evidence": [ { "database": "Reactome", "id": "R-HSA-8875791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875791" } ], "reference": [ { "type": "PubMed", "id": "16407846", "url": "https://glygen.org/publication/PubMed/16407846" } ] }, { "title": "SOCS1: a potent and multifaceted regulator of cytokines and cell-mediated inflammation.", "journal": "Tissue antigens", "date": "2006", "authors": "Davey GM, Heath WR, Starr R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16451196", "url": "https://glygen.org/publication/PubMed/16451196" } ] }, { "title": "B56-containing PP2A dephosphorylate ERK and their activity is controlled by the early gene IEX-1 and ERK.", "journal": "The EMBO journal", "date": "2006", "authors": "Letourneux C, Rocher G, Porteu F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811558" } ], "reference": [ { "type": "PubMed", "id": "16456541", "url": "https://glygen.org/publication/PubMed/16456541" } ] }, { "title": "Cyclin D1 is transcriptionally regulated by and required for transformation by activated signal transducer and activator of transcription 3.", "journal": "Cancer research", "date": "2006", "authors": "Leslie K, Lang C, Devgan G, Azare J, Berishaj M, Gerald W, Kim YB, Paz K, Darnell JE, Albanese C, Sakamaki T, Pestell R, Bromberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16510571", "url": "https://glygen.org/publication/PubMed/16510571" } ] }, { "title": "Structural basis of hepatocyte growth factor/scatter factor and MET signalling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Gherardi E, Sandin S, Petoukhov MV, Finch J, Youles ME, Ofverstedt LG, Miguel RN, Blundell TL, Vande Woude GF, Skoglund U, Svergun DI", "evidence": [ { "database": "Reactome", "id": "R-HSA-6806942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6806942" } ], "reference": [ { "type": "PubMed", "id": "16537482", "url": "https://glygen.org/publication/PubMed/16537482" } ] }, { "title": "Signaling mechanisms, interaction partners, and target genes of STAT6.", "journal": "Cytokine & growth factor reviews", "date": "2006", "authors": "Hebenstreit D, Wirnsberger G, Horejs-Hoeck J, Duschl A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16540365", "url": "https://glygen.org/publication/PubMed/16540365" } ] }, { "title": "Identification of the major autophosphorylation site of the Met/hepatocyte growth factor receptor tyrosine kinase.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Ferracini R, Longati P, Naldini L, Vigna E, Comoglio PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6806942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6806942" } ], "reference": [ { "type": "PubMed", "id": "1655790", "url": "https://glygen.org/publication/PubMed/1655790" } ] }, { "title": "Loss of SOCS3 in T helper cells resulted in reduced immune responses and hyperproduction of interleukin 10 and transforming growth factor-beta 1.", "journal": "The Journal of experimental medicine", "date": "2006", "authors": "Kinjyo I, Inoue H, Hamano S, Fukuyama S, Yoshimura T, Koga K, Takaki H, Himeno K, Takaesu G, Kobayashi T, Yoshimura A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "16606674", "url": "https://glygen.org/publication/PubMed/16606674" } ] }, { "title": "Roles of tyrosine 589 and 591 in STAT5 activation and transformation mediated by FLT3-ITD.", "journal": "Blood", "date": "2006", "authors": "Rocnik JL, Okabe R, Yu JC, Lee BH, Giese N, Schenkein DP, Gilliland DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "16627759", "url": "https://glygen.org/publication/PubMed/16627759" } ] }, { "title": "A pharmacological map of the PI3-K family defines a role for p110alpha in insulin signaling.", "journal": "Cell", "date": "2006", "authors": "Knight ZA, Gonzalez B, Feldman ME, Zunder ER, Goldenberg DD, Williams O, Loewith R, Stokoe D, Balla A, Toth B, Balla T, Weiss WA, Williams RL, Shokat KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "16647110", "url": "https://glygen.org/publication/PubMed/16647110" } ] }, { "title": "Identification of Y589 and Y599 in the juxtamembrane domain of Flt3 as ligand-induced autophosphorylation sites involved in binding of Src family kinases and the protein tyrosine phosphatase SHP2.", "journal": "Blood", "date": "2006", "authors": "Heiss E, Masson K, Sundberg C, Pedersen M, Sun J, Bengtsson S, Ronnstrand L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "16684964", "url": "https://glygen.org/publication/PubMed/16684964" } ] }, { "title": "Clinical significance of circulating hepatocyte growth factor, a new risk marker of carotid atherosclerosis in patients with Type 2 diabetes.", "journal": "Diabetic medicine : a journal of the British Diabetic Association", "date": "2006", "authors": "Satani K, Konya H, Hamaguchi T, Umehara A, Katsuno T, Ishikawa T, Kohri K, Hasegawa Y, Suehiro A, Kakishita E, Namba M", "evidence": [ { "database": "GlyGen", "id": "A0078", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "16759302", "url": "https://glygen.org/publication/PubMed/16759302" } ] }, { "title": "Direct interaction of focal adhesion kinase (FAK) with Met is required for FAK to promote hepatocyte growth factor-induced cell invasion.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Chen SY, Chen HC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081" } ], "reference": [ { "type": "PubMed", "id": "16782899", "url": "https://glygen.org/publication/PubMed/16782899" } ] }, { "title": "Adaptor molecule Crk is required for sustained phosphorylation of Grb2-associated binder 1 and hepatocyte growth factor-induced cell motility of human synovial sarcoma cell lines.", "journal": "Molecular cancer research : MCR", "date": "2006", "authors": "Watanabe T, Tsuda M, Makino Y, Ichihara S, Sawa H, Minami A, Mochizuki N, Nagashima K, Tanaka S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8875555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875555" } ], "reference": [ { "type": "PubMed", "id": "16849525", "url": "https://glygen.org/publication/PubMed/16849525" } ] }, { "title": "Association of p21ras with phosphatidylinositol 3-kinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Sjolander A, Yamamoto K, Huber BE, Lapetina EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "1716764", "url": "https://glygen.org/publication/PubMed/1716764" } ] }, { "title": "LRIG1 is a novel negative regulator of the Met receptor and opposes Met and Her2 synergy.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Shattuck DL, Miller JK, Laederich M, Funes M, Petersen H, Carraway KL 3rd, Sweeney C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "17178829", "url": "https://glygen.org/publication/PubMed/17178829" } ] }, { "title": "Inhibition of B56-containing protein phosphatase 2As by the early response gene IEX-1 leads to control of Akt activity.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Rocher G, Letourneux C, Lenormand P, Porteu F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811558" } ], "reference": [ { "type": "PubMed", "id": "17200115", "url": "https://glygen.org/publication/PubMed/17200115" } ] }, { "title": "Identification of a competitive HGF antagonist encoded by an alternative transcript.", "journal": "Science", "date": "1991", "authors": "Chan A M, Rubin J S, Bottaro D P, Hirschfield D W, Chedid M, Aaronson S A", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "reference": [ { "type": "PubMed", "id": "1720571", "url": "https://glygen.org/publication/PubMed/1720571" } ] }, { "title": "A novel tyrosine kinase switch is a mechanism of imatinib resistance in gastrointestinal stromal tumors.", "journal": "Oncogene", "date": "2007", "authors": "Mahadevan D, Cooke L, Riley C, Swart R, Simons B, Della Croce K, Wisner L, Iorio M, Shakalya K, Garewal H, Nagle R, Bearss D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "17325667", "url": "https://glygen.org/publication/PubMed/17325667" } ] }, { "title": "Diverse effects of Stat1 on the regulation of hsp90alpha gene under heat shock.", "journal": "Journal of cellular biochemistry", "date": "2007", "authors": "Chen XS, Zhang Y, Wang JS, Li XY, Cheng XK, Zhang Y, Wu NH, Shen YF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17427945", "url": "https://glygen.org/publication/PubMed/17427945" } ] }, { "title": "IL-13 induces expression of CD36 in human monocytes through PPARgamma activation.", "journal": "European journal of immunology", "date": "2007", "authors": "Berry A, Balard P, Coste A, Olagnier D, Lagane C, Authier H, Benoit-Vical F, Lepert JC, Seguela JP, Magnaval JF, Chambon P, Metzger D, Desvergne B, Wahli W, Auwerx J, Pipy B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17458857", "url": "https://glygen.org/publication/PubMed/17458857" } ] }, { "title": "An orally available small-molecule inhibitor of c-Met, PF-2341066, exhibits cytoreductive antitumor efficacy through antiproliferative and antiangiogenic mechanisms.", "journal": "Cancer research", "date": "2007", "authors": "Zou HY, Li Q, Lee JH, Arango ME, McDonnell SR, Yamazaki S, Koudriakova TB, Alton G, Cui JJ, Kung PP, Nambu MD, Los G, Bender SL, Mroczkowski B, Christensen JG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "17483355", "url": "https://glygen.org/publication/PubMed/17483355" } ] }, { "title": "Fra-1 and Stat3 synergistically regulate activation of human MMP-9 gene.", "journal": "Molecular immunology", "date": "2008", "authors": "Song Y, Qian L, Song S, Chen L, Zhang Y, Yuan G, Zhang H, Xia Q, Hu M, Yu M, Shi M, Jiang Z, Guo N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "17572495", "url": "https://glygen.org/publication/PubMed/17572495" } ] }, { "title": "Structural basis for the autoinhibition of focal adhesion kinase.", "journal": "Cell", "date": "2007", "authors": "Lietha D, Cai X, Ceccarelli DF, Li Y, Schaller MD, Eck MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081" } ], "reference": [ { "type": "PubMed", "id": "17574028", "url": "https://glygen.org/publication/PubMed/17574028" } ] }, { "title": "Mechanism of two classes of cancer mutations in the phosphoinositide 3-kinase catalytic subunit.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Miled N, Yan Y, Hon WC, Perisic O, Zvelebil M, Inbar Y, Schneidman-Duhovny D, Wolfson HJ, Backer JM, Williams RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "17626883", "url": "https://glygen.org/publication/PubMed/17626883" } ] }, { "title": "Distinct requirements for Gab1 in Met and EGF receptor signaling in vivo.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Schaeper U, Vogel R, Chmielowiec J, Huelsken J, Rosario M, Birchmeier W", "evidence": [ { "database": "Reactome", "id": "R-HSA-8865999", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8865999" } ], "reference": [ { "type": "PubMed", "id": "17881575", "url": "https://glygen.org/publication/PubMed/17881575" } ] }, { "title": "A novel activating role of SRC and STAT3 on HGF transcription in human breast cancer cells.", "journal": "Molecular cancer", "date": "2007", "authors": "Sam MR, Elliott BE, Mueller CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8875791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875791" } ], "reference": [ { "type": "PubMed", "id": "17967179", "url": "https://glygen.org/publication/PubMed/17967179" } ] }, { "title": "Oncogenic signaling of class I PI3K isoforms.", "journal": "Oncogene", "date": "2008", "authors": "Denley A, Kang S, Karst U, Vogt PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "17998941", "url": "https://glygen.org/publication/PubMed/17998941" } ] }, { "title": "The structure of a human p110alpha/p85alpha complex elucidates the effects of oncogenic PI3Kalpha mutations.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Huang CH, Mandelker D, Schmidt-Kittler O, Samuels Y, Velculescu VE, Kinzler KW, Vogelstein B, Gabelli SB, Amzel LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "18079394", "url": "https://glygen.org/publication/PubMed/18079394" } ] }, { "title": "Molecular and structural basis of cytokine receptor pleiotropy in the interleukin-4/13 system.", "journal": "Cell", "date": "2008", "authors": "LaPorte SL, Juo ZS, Vaclavikova J, Colf LA, Qi X, Heller NM, Keegan AD, Garcia KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18243101", "url": "https://glygen.org/publication/PubMed/18243101" } ] }, { "title": "A broad-spectrum human lung fibroblast-derived mitogen is a variant of hepatocyte growth factor.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1991", "authors": "Rubin J S, Chan A M, Bottaro D P, Burgess W H, Taylor W G, Cech A C, Hirschfield D W, Wong J, Miki T, Finch P W", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "reference": [ { "type": "PubMed", "id": "1824873", "url": "https://glygen.org/publication/PubMed/1824873" } ] }, { "title": "An alternatively processed mRNA generated from human hepatocyte growth factor gene.", "journal": "Eur. J. Biochem.", "date": "1991", "authors": "Miyazawa K, Kitamura A, Naka D, Kitamura N", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "reference": [ { "type": "PubMed", "id": "1826653", "url": "https://glygen.org/publication/PubMed/1826653" } ] }, { "title": "Identification of the N-terminal residue of the heavy chain of both native and recombinant human hepatocyte growth factor.", "journal": "Biochemical and biophysical research communications", "date": "1991", "authors": "Yoshiyama Y, Arakaki N, Naka D, Takahashi K, Hirono S, Kondo J, Nakayama H, Gohda E, Kitamura N, Tsubouchi H, et al.", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "reference": [ { "type": "PubMed", "id": "1826837", "url": "https://glygen.org/publication/PubMed/1826837" } ] }, { "title": "Evidence for the identity of human scatter factor and human hepatocyte growth factor.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1991", "authors": "Weidner K M, Arakaki N, Hartmann G, Vandekerckhove J, Weingart S, Rieder H, Fonatsch C, Tsubouchi H, Hishida T, Daikuhara Y", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "reference": [ { "type": "PubMed", "id": "1831266", "url": "https://glygen.org/publication/PubMed/1831266" } ] }, { "title": "Organization of the human hepatocyte growth factor-encoding gene.", "journal": "Gene", "date": "1991", "authors": "Seki T, Hagiya M, Shimonishi M, Nakamura T, Shimizu S", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "reference": [ { "type": "PubMed", "id": "1831432", "url": "https://glygen.org/publication/PubMed/1831432" } ] }, { "title": "Mutations in the catalytic subunit of class IA PI3K confer leukemogenic potential to hematopoietic cells.", "journal": "Oncogene", "date": "2008", "authors": "Horn S, Bergholz U, Jucker M, McCubrey JA, Trumper L, Stocking C, Basecke J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "18317450", "url": "https://glygen.org/publication/PubMed/18317450" } ] }, { "title": "Structural organization and the transcription initiation site of the human hepatocyte growth factor gene.", "journal": "Biochemistry", "date": "1991", "authors": "Miyazawa K, Kitamura A, Kitamura N", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "reference": [ { "type": "PubMed", "id": "1832556", "url": "https://glygen.org/publication/PubMed/1832556" } ] }, { "title": "Twist is transcriptionally induced by activation of STAT3 and mediates STAT3 oncogenic function.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Cheng GZ, Zhang WZ, Sun M, Wang Q, Coppola D, Mansour M, Xu LM, Costanzo C, Cheng JQ, Wang LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18353781", "url": "https://glygen.org/publication/PubMed/18353781" } ] }, { "title": "Regulation of Sox2 by STAT3 initiates commitment to the neural precursor cell fate.", "journal": "Stem cells and development", "date": "2008", "authors": "Foshay KM, Gallicano GI", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18447642", "url": "https://glygen.org/publication/PubMed/18447642" } ] }, { "title": "Essential roles of PI(3)K-p110beta in cell growth, metabolism and tumorigenesis.", "journal": "Nature", "date": "2008", "authors": "Jia S, Liu Z, Zhang S, Liu P, Zhang L, Lee SH, Zhang J, Signoretti S, Loda M, Roberts TM, Zhao JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "18594509", "url": "https://glygen.org/publication/PubMed/18594509" } ] }, { "title": "Identification and characterization of NVP-BEZ235, a new orally available dual phosphatidylinositol 3-kinase/mammalian target of rapamycin inhibitor with potent in vivo antitumor activity.", "journal": "Molecular cancer therapeutics", "date": "2008", "authors": "Maira SM, Stauffer F, Brueggen J, Furet P, Schnell C, Fritsch C, Brachmann S, Chene P, De Pover A, Schoemaker K, Fabbro D, Gabriel D, Simonen M, Murphy L, Finan P, Sellers W, Garcia-Echeverria C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "18606717", "url": "https://glygen.org/publication/PubMed/18606717" } ] }, { "title": "Signal transducer and activator of transcription 3 is required for hypoxia-inducible factor-1alpha RNA expression in both tumor cells and tumor-associated myeloid cells.", "journal": "Molecular cancer research : MCR", "date": "2008", "authors": "Niu G, Briggs J, Deng J, Ma Y, Lee H, Kortylewski M, Kujawski M, Kay H, Cress WD, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "18644974", "url": "https://glygen.org/publication/PubMed/18644974" } ] }, { "title": "The identification of 2-(1H-indazol-4-yl)-6-(4-methanesulfonyl-piperazin-1-ylmethyl)-4-morpholin-4-yl-t hieno[3,2-d]pyrimidine (GDC-0941) as a potent, selective, orally bioavailable inhibitor of class I PI3 kinase for the treatment of cancer .", "journal": "Journal of medicinal chemistry", "date": "2008", "authors": "Folkes AJ, Ahmadi K, Alderton WK, Alix S, Baker SJ, Box G, Chuckowree IS, Clarke PA, Depledge P, Eccles SA, Friedman LS, Hayes A, Hancox TC, Kugendradas A, Lensun L, Moore P, Olivero AG, Pang J, Patel S, Pergl-Wilson GH, Raynaud FI, Robson A, Saghir N, Salphati L, Sohal S, Ultsch MH, Valenti M, Wallweber HJ, Wan NC, Wiesmann C, Workman P, Zhyvoloup A, Zvelebil MJ, Shuttleworth SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "18754654", "url": "https://glygen.org/publication/PubMed/18754654" } ] }, { "title": "PTEN-deficient cancers depend on PIK3CB.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Wee S, Wiederschain D, Maira SM, Loo A, Miller C, deBeaumont R, Stegmeier F, Yao YM, Lengauer C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "18755892", "url": "https://glygen.org/publication/PubMed/18755892" } ] }, { "title": "Essential role of ERK dimers in the activation of cytoplasmic but not nuclear substrates by ERK-scaffold complexes.", "journal": "Molecular cell", "date": "2008", "authors": "Casar B, Pinto A, Crespo P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "18775330", "url": "https://glygen.org/publication/PubMed/18775330" } ] }, { "title": "Receptor trafficking controls weak signal delivery: a strategy used by c-Met for STAT3 nuclear accumulation.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Kermorgant S, Parker PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8875791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875791" } ], "reference": [ { "type": "PubMed", "id": "18779368", "url": "https://glygen.org/publication/PubMed/18779368" } ] }, { "title": "Regulation of the Met receptor-tyrosine kinase by the protein-tyrosine phosphatase 1B and T-cell phosphatase.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Sangwan V, Paliouras GN, Abella JV, Dube N, Monast A, Tremblay ML, Park M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "18819921", "url": "https://glygen.org/publication/PubMed/18819921" } ] }, { "title": "NVP-BEZ235, a dual PI3K/mTOR inhibitor, prevents PI3K signaling and inhibits the growth of cancer cells with activating PI3K mutations.", "journal": "Cancer research", "date": "2008", "authors": "Serra V, Markman B, Scaltriti M, Eichhorn PJ, Valero V, Guzman M, Botero ML, Llonch E, Atzori F, Di Cosimo S, Maira M, Garcia-Echeverria C, Parra JL, Arribas J, Baselga J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "18829560", "url": "https://glygen.org/publication/PubMed/18829560" } ] }, { "title": "Hepsin, a cell membrane-associated protease. Characterization, tissue distribution, and gene localization.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Tsuji A, Torres-Rosado A, Arai T, Le Beau MM, Lemons RS, Chou SH, Kurachi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6806942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6806942" } ], "reference": [ { "type": "PubMed", "id": "1885621", "url": "https://glygen.org/publication/PubMed/1885621" } ] }, { "title": "mTOR complex 2 (mTORC2) controls hydrophobic motif phosphorylation and activation of serum- and glucocorticoid-induced protein kinase 1 (SGK1).", "journal": "The Biochemical journal", "date": "2008", "authors": "Garcia-Martinez JM, Alessi DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "18925875", "url": "https://glygen.org/publication/PubMed/18925875" } ] }, { "title": "The GTPase superfamily: conserved structure and molecular mechanism.", "journal": "Nature", "date": "1991", "authors": "Bourne HR, Sanders DA, McCormick F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "1898771", "url": "https://glygen.org/publication/PubMed/1898771" } ] }, { "title": "Distinct recruitment of Eps15 via Its coiled-coil domain is required for efficient down-regulation of the met receptor tyrosine kinase.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Parachoniak CA, Park M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "19109251", "url": "https://glygen.org/publication/PubMed/19109251" } ] }, { "title": "Mechanism of interferon-gamma mediated down-regulation of interleukin-10 gene expression.", "journal": "Molecular immunology", "date": "2009", "authors": "Schaefer A, Unterberger C, Frankenberger M, Lohrum M, Staples KJ, Werner T, Stunnenberg H, Ziegler-Heitbrock L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19124156", "url": "https://glygen.org/publication/PubMed/19124156" } ] }, { "title": "PI 3-kinase and cancer: changing accents.", "journal": "Current opinion in genetics & development", "date": "2009", "authors": "Vogt PK, Gymnopoulos M, Hart JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "19185485", "url": "https://glygen.org/publication/PubMed/19185485" } ] }, { "title": "Regulation of the IL-23 and IL-12 balance by Stat3 signaling in the tumor microenvironment.", "journal": "Cancer cell", "date": "2009", "authors": "Kortylewski M, Xin H, Kujawski M, Lee H, Liu Y, Harris T, Drake C, Pardoll D, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19185846", "url": "https://glygen.org/publication/PubMed/19185846" } ] }, { "title": "Discovery of N-(4-(2-amino-3-chloropyridin-4-yloxy)-3-fluorophenyl)-4-ethoxy-1-(4-fluorophenyl )-2-oxo-1,2-dihydropyridine-3-carboxamide (BMS-777607), a selective and orally efficacious inhibitor of the Met kinase superfamily.", "journal": "Journal of medicinal chemistry", "date": "2009", "authors": "Schroeder GM, An Y, Cai ZW, Chen XT, Clark C, Cornelius LA, Dai J, Gullo-Brown J, Gupta A, Henley B, Hunt JT, Jeyaseelan R, Kamath A, Kim K, Lippy J, Lombardo LJ, Manne V, Oppenheimer S, Sack JS, Schmidt RJ, Shen G, Stefanski K, Tokarski JS, Trainor GL, Wautlet BS, Wei D, Williams DK, Zhang Y, Zhang Y, Fargnoli J, Borzilleri RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "19260711", "url": "https://glygen.org/publication/PubMed/19260711" } ] }, { "title": "ERK dimers and scaffold proteins: unexpected partners for a forgotten (cytoplasmic) task.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2009", "authors": "Casar B, Pinto A, Crespo P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "19279408", "url": "https://glygen.org/publication/PubMed/19279408" } ] }, { "title": "The RhoU/Wrch1 Rho GTPase gene is a common transcriptional target of both the gp130/STAT3 and Wnt-1 pathways.", "journal": "The Biochemical journal", "date": "2009", "authors": "Schiavone D, Dewilde S, Vallania F, Turkson J, Di Cunto F, Poli V", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "19397496", "url": "https://glygen.org/publication/PubMed/19397496" } ] }, { "title": "Ligand-independent HER2/HER3/PI3K complex is disrupted by trastuzumab and is effectively inhibited by the PI3K inhibitor GDC-0941.", "journal": "Cancer cell", "date": "2009", "authors": "Junttila TT, Akita RW, Parsons K, Fields C, Lewis Phillips GD, Friedman LS, Sampath D, Sliwkowski MX", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "19411071", "url": "https://glygen.org/publication/PubMed/19411071" } ] }, { "title": "PtdIns5P protects Akt from dephosphorylation through PP2A inhibition.", "journal": "Biochemical and biophysical research communications", "date": "2009", "authors": "Ramel D, Lagarrigue F, Dupuis-Coronas S, Chicanne G, Leslie N, Gaits-Iacovoni F, Payrastre B, Tronchere H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811558" } ], "reference": [ { "type": "PubMed", "id": "19576174", "url": "https://glygen.org/publication/PubMed/19576174" } ] }, { "title": "Noncoding mutations of HGF are associated with nonsyndromic hearing loss, DFNB39.", "journal": "Am. J. Hum. Genet.", "date": "2009", "authors": "Schultz Julie M, Khan Shaheen N, Ahmed Zubair M, Riazuddin Saima, Waryah Ali M, Chhatre Dhananjay, Starost Matthew F, Ploplis Barbara, Buckley Stephanie, Vel\u00e1squez David, Kabra Madhulika, Lee Kwanghyuk, Hassan Muhammad J, Ali Ghazanfar, Ansar Muhammad, Ghosh Manju, Wilcox Edward R, Ahmad Wasim, Merlino Glenn, Leal Suzanne M, Riazuddin Sheikh, Friedman Thomas B, Morell Robert J", "evidence": [ { "database": "UniProtKB", "id": "C9WSJ4", "url": "https://www.uniprot.org/uniprot/C9WSJ4" } ], "reference": [ { "type": "PubMed", "id": "19576567", "url": "https://glygen.org/publication/PubMed/19576567" } ] }, { "title": "Targeting the phosphoinositide 3-kinase pathway in cancer.", "journal": "Nature reviews. Drug discovery", "date": "2009", "authors": "Liu P, Cheng H, Roberts TM, Zhao JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "19644473", "url": "https://glygen.org/publication/PubMed/19644473" } ] }, { "title": "A frequent kinase domain mutation that changes the interaction between PI3Kalpha and the membrane.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Mandelker D, Gabelli SB, Schmidt-Kittler O, Zhu J, Cheong I, Huang CH, Kinzler KW, Vogelstein B, Amzel LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "19805105", "url": "https://glygen.org/publication/PubMed/19805105" } ] }, { "title": "Inhibition of tumor cell growth, invasion, and metastasis by EXEL-2880 (XL880, GSK1363089), a novel inhibitor of HGF and VEGF receptor tyrosine kinases.", "journal": "Cancer research", "date": "2009", "authors": "Qian F, Engst S, Yamaguchi K, Yu P, Won KA, Mock L, Lou T, Tan J, Li C, Tam D, Lougheed J, Yakes FM, Bentzien F, Xu W, Zaks T, Wooster R, Greshock J, Joly AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "19808973", "url": "https://glygen.org/publication/PubMed/19808973" } ] }, { "title": "E7050: a dual c-Met and VEGFR-2 tyrosine kinase inhibitor promotes tumor regression and prolongs survival in mouse xenograft models.", "journal": "Cancer science", "date": "2010", "authors": "Nakagawa T, Tohyama O, Yamaguchi A, Matsushima T, Takahashi K, Funasaka S, Shirotori S, Asada M, Obaishi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "19832844", "url": "https://glygen.org/publication/PubMed/19832844" } ] }, { "title": "Dual mechanism of impairment of interleukin-7 (IL-7) responses in human immunodeficiency virus infection: decreased IL-7 binding and abnormal activation of the JAK/STAT5 pathway.", "journal": "Journal of virology", "date": "2010", "authors": "Juffroy O, Bugault F, Lambotte O, Landires I, Viard JP, Niel L, Fontanet A, Delfraissy JF, Theze J, Chakrabarti LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "19864382", "url": "https://glygen.org/publication/PubMed/19864382" } ] }, { "title": "Differential phosphorylation of the docking protein Gab1 by c-Src and the hepatocyte growth factor receptor regulates different aspects of cell functions.", "journal": "Oncogene", "date": "2010", "authors": "Chan PC, Sudhakar JN, Lai CC, Chen HC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8851907", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8851907" } ], "reference": [ { "type": "PubMed", "id": "19881549", "url": "https://glygen.org/publication/PubMed/19881549" } ] }, { "title": "ERK nuclear translocation is dimerization-independent but controlled by the rate of phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Lidke DS, Huang F, Post JN, Rieger B, Wilsbacher J, Thomas JL, Pouyssegur J, Jovin TM, Lenormand P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "19920141", "url": "https://glygen.org/publication/PubMed/19920141" } ] }, { "title": "SGX523 is an exquisitely selective, ATP-competitive inhibitor of the MET receptor tyrosine kinase with antitumor activity in vivo.", "journal": "Molecular cancer therapeutics", "date": "2009", "authors": "Buchanan SG, Hendle J, Lee PS, Smith CR, Bounaud PY, Jessen KA, Tang CM, Huser NH, Felce JD, Froning KJ, Peterman MC, Aubol BE, Gessert SF, Sauder JM, Schwinn KD, Russell M, Rooney IA, Adams J, Leon BC, Do TH, Blaney JM, Sprengeler PA, Thompson DA, Smyth L, Pelletier LA, Atwell S, Holme K, Wasserman SR, Emtage S, Burley SK, Reich SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "19934279", "url": "https://glygen.org/publication/PubMed/19934279" } ] }, { "title": "Somatic mutations in p85alpha promote tumorigenesis through class IA PI3K activation.", "journal": "Cancer cell", "date": "2009", "authors": "Jaiswal BS, Janakiraman V, Kljavin NM, Chaudhuri S, Stern HM, Wang W, Kan Z, Dbouk HA, Peters BA, Waring P, Dela Vega T, Kenski DM, Bowman KK, Lorenzo M, Li H, Wu J, Modrusan Z, Stinson J, Eby M, Yue P, Kaminker JS, de Sauvage FJ, Backer JM, Seshagiri S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "19962665", "url": "https://glygen.org/publication/PubMed/19962665" } ] }, { "title": "MK-2461, a novel multitargeted kinase inhibitor, preferentially inhibits the activated c-Met receptor.", "journal": "Cancer research", "date": "2010", "authors": "Pan BS, Chan GK, Chenard M, Chi A, Davis LJ, Deshmukh SV, Gibbs JB, Gil S, Hang G, Hatch H, Jewell JP, Kariv I, Katz JD, Kunii K, Lu W, Lutterbach BA, Paweletz CP, Qu X, Reilly JF, Szewczak AA, Zeng Q, Kohl NE, Dinsmore CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "20145145", "url": "https://glygen.org/publication/PubMed/20145145" } ] }, { "title": "Phosphoinositide 3-kinase pathway activation in phosphate and tensin homolog (PTEN)-deficient prostate cancer cells is independent of receptor tyrosine kinases and mediated by the p110beta and p110delta catalytic subunits.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Jiang X, Chen S, Asara JM, Balk SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "20231295", "url": "https://glygen.org/publication/PubMed/20231295" } ] }, { "title": "mTOR complex-2 activates ENaC by phosphorylating SGK1.", "journal": "Journal of the American Society of Nephrology : JASN", "date": "2010", "authors": "Lu M, Wang J, Jones KT, Ives HE, Feldman ME, Yao LJ, Shokat KM, Ashrafi K, Pearce D", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "20338997", "url": "https://glygen.org/publication/PubMed/20338997" } ] }, { "title": "RalGDS family members couple Ras to Ral signalling and that's not all.", "journal": "Cellular signalling", "date": "2010", "authors": "Ferro E, Trabalzini L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "20478380", "url": "https://glygen.org/publication/PubMed/20478380" } ] }, { "title": "ARQ 197, a novel and selective inhibitor of the human c-Met receptor tyrosine kinase with antitumor activity.", "journal": "Molecular cancer therapeutics", "date": "2010", "authors": "Munshi N, Jeay S, Li Y, Chen CR, France DS, Ashwell MA, Hill J, Moussa MM, Leggett DS, Li CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "20484018", "url": "https://glygen.org/publication/PubMed/20484018" } ] }, { "title": "Diverse targets of the transcription factor STAT3 contribute to T cell pathogenicity and homeostasis.", "journal": "Immunity", "date": "2010", "authors": "Durant L, Watford WT, Ramos HL, Laurence A, Vahedi G, Wei L, Takahashi H, Sun HW, Kanno Y, Powrie F, O'Shea JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "20493732", "url": "https://glygen.org/publication/PubMed/20493732" } ] }, { "title": "Phosphatidylinositol 3-kinase-delta inhibitor CAL-101 shows promising preclinical activity in chronic lymphocytic leukemia by antagonizing intrinsic and extrinsic cellular survival signals.", "journal": "Blood", "date": "2010", "authors": "Herman SE, Gordon AL, Wagner AJ, Heerema NA, Zhao W, Flynn JM, Jones J, Andritsos L, Puri KD, Lannutti BJ, Giese NA, Zhang X, Wei L, Byrd JC, Johnson AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "20522708", "url": "https://glygen.org/publication/PubMed/20522708" } ] }, { "title": "Structural basis for agonism and antagonism of hepatocyte growth factor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010-07-27", "authors": "Tolbert W David, Daugherty-Holtrop Jennifer, Gherardi Ermanno, Vande Woude George, Xu H Eric", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "reference": [ { "type": "PubMed", "id": "20624990", "url": "https://glygen.org/publication/PubMed/20624990" } ] }, { "title": "Cancer-derived mutations in the regulatory subunit p85alpha of phosphoinositide 3-kinase function through the catalytic subunit p110alpha.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Sun M, Hillmann P, Hofmann BT, Hart JR, Vogt PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "20713702", "url": "https://glygen.org/publication/PubMed/20713702" } ] }, { "title": "Phosphorylation of focal adhesion kinase on tyrosine 194 by Met leads to its activation through relief of autoinhibition.", "journal": "Oncogene", "date": "2011", "authors": "Chen TH, Chan PC, Chen CL, Chen HC", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081" } ], "reference": [ { "type": "PubMed", "id": "20802513", "url": "https://glygen.org/publication/PubMed/20802513" } ] }, { "title": "TMPRSS13, a type II transmembrane serine protease, is inhibited by hepatocyte growth factor activator inhibitor type 1 and activates pro-hepatocyte growth factor.", "journal": "The FEBS journal", "date": "2010", "authors": "Hashimoto T, Kato M, Shimomura T, Kitamura N", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "reference": [ { "type": "PubMed", "id": "20977675", "url": "https://glygen.org/publication/PubMed/20977675" } ] }, { "title": "STAT3-induced S1PR1 expression is crucial for persistent STAT3 activation in tumors.", "journal": "Nature medicine", "date": "2010", "authors": "Lee H, Deng J, Kujawski M, Yang C, Liu Y, Herrmann A, Kortylewski M, Horne D, Somlo G, Forman S, Jove R, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21102457", "url": "https://glygen.org/publication/PubMed/21102457" } ] }, { "title": "Ras superfamily GEFs and GAPs: validated and tractable targets for cancer therapy?", "journal": "Nature reviews. Cancer", "date": "2010", "authors": "Vigil D, Cherfils J, Rossman KL, Der CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "21102635", "url": "https://glygen.org/publication/PubMed/21102635" } ] }, { "title": "Discovery of CP-690,550: a potent and selective Janus kinase (JAK) inhibitor for the treatment of autoimmune diseases and organ transplant rejection.", "journal": "Journal of medicinal chemistry", "date": "2010", "authors": "Flanagan ME, Blumenkopf TA, Brissette WH, Brown MF, Casavant JM, Shang-Poa C, Doty JL, Elliott EA, Fisher MB, Hines M, Kent C, Kudlacz EM, Lillie BM, Magnuson KS, McCurdy SP, Munchhof MJ, Perry BD, Sawyer PS, Strelevitz TJ, Subramanyam C, Sun J, Whipple DA, Changelian PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "21105711", "url": "https://glygen.org/publication/PubMed/21105711" } ] }, { "title": "PTEN restoration and PIK3CB knockdown synergistically suppress glioblastoma growth in vitro and in xenografts.", "journal": "Journal of neuro-oncology", "date": "2011", "authors": "Chen H, Mei L, Zhou L, Shen X, Guo C, Zheng Y, Zhu H, Zhu Y, Huang L", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "21188471", "url": "https://glygen.org/publication/PubMed/21188471" } ] }, { "title": "alphaMbeta(2) integrin activation prevents alternative activation of human and murine macrophages and impedes foam cell formation.", "journal": "Circulation research", "date": "2011", "authors": "Yakubenko VP, Bhattacharjee A, Pluskota E, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21252155", "url": "https://glygen.org/publication/PubMed/21252155" } ] }, { "title": "Inhibition of PI3K/mTOR pathways in glioblastoma and implications for combination therapy with temozolomide.", "journal": "Neuro-oncology", "date": "2011", "authors": "Prasad G, Sottero T, Yang X, Mueller S, James CD, Weiss WA, Polley MY, Ozawa T, Berger MS, Aftab DT, Prados MD, Haas-Kogan DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "21317208", "url": "https://glygen.org/publication/PubMed/21317208" } ] }, { "title": "Feedback upregulation of HER3 (ErbB3) expression and activity attenuates antitumor effect of PI3K inhibitors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Chakrabarty A, Sanchez V, Kuba MG, Rinehart C, Arteaga CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "21368164", "url": "https://glygen.org/publication/PubMed/21368164" } ] }, { "title": "Activation and function of the MAPKs and their substrates, the MAPK-activated protein kinases.", "journal": "Microbiology and molecular biology reviews : MMBR", "date": "2011", "authors": "Cargnello M, Roux PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "21372320", "url": "https://glygen.org/publication/PubMed/21372320" } ] }, { "title": "Isolation and expression of cDNA for different forms of hepatocyte growth factor from human leukocyte.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1990", "authors": "Seki T, Ihara I, Sugimura A, Shimonishi M, Nishizawa T, Asami O, Hagiya M, Nakamura T, Shimizu S", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "reference": [ { "type": "PubMed", "id": "2145836", "url": "https://glygen.org/publication/PubMed/2145836" } ] }, { "title": "PIK3R1 (p85alpha) is somatically mutated at high frequency in primary endometrial cancer.", "journal": "Cancer research", "date": "2011", "authors": "Urick ME, Rudd ML, Godwin AK, Sgroi D, Merino M, Bell DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "21478295", "url": "https://glygen.org/publication/PubMed/21478295" } ] }, { "title": "Foretinib (GSK1363089), a multi-kinase inhibitor of MET and VEGFRs, inhibits growth of gastric cancer cell lines by blocking inter-receptor tyrosine kinase networks.", "journal": "Investigational new drugs", "date": "2012", "authors": "Kataoka Y, Mukohara T, Tomioka H, Funakoshi Y, Kiyota N, Fujiwara Y, Yashiro M, Hirakawa K, Hirai M, Minami H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "21655918", "url": "https://glygen.org/publication/PubMed/21655918" } ] }, { "title": "GGA3 functions as a switch to promote Met receptor recycling, essential for sustained ERK and cell migration.", "journal": "Developmental cell", "date": "2011", "authors": "Parachoniak CA, Luo Y, Abella JV, Keen JH, Park M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8875656", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875656" } ], "reference": [ { "type": "PubMed", "id": "21664574", "url": "https://glygen.org/publication/PubMed/21664574" } ] }, { "title": "A drug targeting only p110alpha can block phosphoinositide 3-kinase signalling and tumour growth in certain cell types.", "journal": "The Biochemical journal", "date": "2011", "authors": "Jamieson S, Flanagan JU, Kolekar S, Buchanan C, Kendall JD, Lee WJ, Rewcastle GW, Denny WA, Singh R, Dickson J, Baguley BC, Shepherd PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "21668414", "url": "https://glygen.org/publication/PubMed/21668414" } ] }, { "title": "TRIM8 regulates Nanog via Hsp90beta-mediated nuclear translocation of STAT3 in embryonic stem cells.", "journal": "Biochimica et biophysica acta", "date": "2011", "authors": "Okumura F, Okumura AJ, Matsumoto M, Nakayama KI, Hatakeyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21689689", "url": "https://glygen.org/publication/PubMed/21689689" } ] }, { "title": "STAT3 protein promotes T-cell survival and inhibits interleukin-2 production through up-regulation of Class O Forkhead transcription factors.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Oh HM, Yu CR, Golestaneh N, Amadi-Obi A, Lee YS, Eseonu A, Mahdi RM, Egwuagu CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21730069", "url": "https://glygen.org/publication/PubMed/21730069" } ] }, { "title": "RAS Interaction with PI3K: More Than Just Another Effector Pathway.", "journal": "Genes & cancer", "date": "2011", "authors": "Castellano E, Downward J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "21779497", "url": "https://glygen.org/publication/PubMed/21779497" } ] }, { "title": "Therapeutic strategies for targeting ras proteins.", "journal": "Genes & cancer", "date": "2011", "authors": "Gysin S, Salt M, Young A, McCormick F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "21779505", "url": "https://glygen.org/publication/PubMed/21779505" } ] }, { "title": "Dynamics of the phosphoinositide 3-kinase p110delta interaction with p85alpha and membranes reveals aspects of regulation distinct from p110alpha.", "journal": "Structure (London, England : 1993)", "date": "2011", "authors": "Burke JE, Vadas O, Berndt A, Finegan T, Perisic O, Williams RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "21827948", "url": "https://glygen.org/publication/PubMed/21827948" } ] }, { "title": "A novel kinase inhibitor, INCB28060, blocks c-MET-dependent signaling, neoplastic activities, and cross-talk with EGFR and HER-3.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2011", "authors": "Liu X, Wang Q, Yang G, Marando C, Koblish HK, Hall LM, Fridman JS, Behshad E, Wynn R, Li Y, Boer J, Diamond S, He C, Xu M, Zhuo J, Yao W, Newton RC, Scherle PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "21918175", "url": "https://glygen.org/publication/PubMed/21918175" } ] }, { "title": "Cabozantinib (XL184), a novel MET and VEGFR2 inhibitor, simultaneously suppresses metastasis, angiogenesis, and tumor growth.", "journal": "Molecular cancer therapeutics", "date": "2011", "authors": "Yakes FM, Chen J, Tan J, Yamaguchi K, Shi Y, Yu P, Qian F, Chu F, Bentzien F, Cancilla B, Orf J, You A, Laird AD, Engst S, Lee L, Lesch J, Chou YC, Joly AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "21926191", "url": "https://glygen.org/publication/PubMed/21926191" } ] }, { "title": "Signal transducers and activators of transcription 3 (STAT3) directly regulates cytokine-induced fascin expression and is required for breast cancer cell migration.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Snyder M, Huang XY, Zhang JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21937440", "url": "https://glygen.org/publication/PubMed/21937440" } ] }, { "title": "Novel phosphoinositide 3-kinase/mTOR dual inhibitor, NVP-BGT226, displays potent growth-inhibitory activity against human head and neck cancer cells in vitro and in vivo.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2011", "authors": "Chang KY, Tsai SY, Wu CM, Yen CJ, Chuang BF, Chang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "21976531", "url": "https://glygen.org/publication/PubMed/21976531" } ] }, { "title": "High frequency of PIK3R1 and PIK3R2 mutations in endometrial cancer elucidates a novel mechanism for regulation of PTEN protein stability.", "journal": "Cancer discovery", "date": "2011", "authors": "Cheung LW, Hennessy BT, Li J, Yu S, Myers AP, Djordjevic B, Lu Y, Stemke-Hale K, Dyer MD, Zhang F, Ju Z, Cantley LC, Scherer SE, Liang H, Lu KH, Broaddus RR, Mills GB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "21984976", "url": "https://glygen.org/publication/PubMed/21984976" } ] }, { "title": "RAS oncogenes: weaving a tumorigenic web.", "journal": "Nature reviews. Cancer", "date": "2011", "authors": "Pylayeva-Gupta Y, Grabocka E, Bar-Sagi D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "21993244", "url": "https://glygen.org/publication/PubMed/21993244" } ] }, { "title": "Cytokine induction of tumor necrosis factor receptor 2 is mediated by STAT3 in colon cancer cells.", "journal": "Molecular cancer research : MCR", "date": "2011", "authors": "Hamilton KE, Simmons JG, Ding S, Van Landeghem L, Lund PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "21994466", "url": "https://glygen.org/publication/PubMed/21994466" } ] }, { "title": "Necdin, a negative growth regulator, is a novel STAT3 target gene down-regulated in human cancer.", "journal": "PloS one", "date": "2011", "authors": "Haviland R, Eschrich S, Bloom G, Ma Y, Minton S, Jove R, Cress WD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22046235", "url": "https://glygen.org/publication/PubMed/22046235" } ] }, { "title": "Regulation of lipid binding underlies the activation mechanism of class IA PI3-kinases.", "journal": "Oncogene", "date": "2012", "authors": "Hon WC, Berndt A, Williams RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "22120714", "url": "https://glygen.org/publication/PubMed/22120714" } ] }, { "title": "Identification and characterization of NVP-BKM120, an orally available pan-class I PI3-kinase inhibitor.", "journal": "Molecular cancer therapeutics", "date": "2012", "authors": "Maira SM, Pecchi S, Huang A, Burger M, Knapp M, Sterker D, Schnell C, Guthy D, Nagel T, Wiesmann M, Brachmann S, Fritsch C, Dorsch M, Chene P, Shoemaker K, De Pover A, Menezes D, Martiny-Baron G, Fabbro D, Wilson CJ, Schlegel R, Hofmann F, Garcia-Echeverria C, Sellers WR, Voliva CF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "22188813", "url": "https://glygen.org/publication/PubMed/22188813" } ] }, { "title": "Roles of STAT3 and ZEB1 proteins in E-cadherin down-regulation and human colorectal cancer epithelial-mesenchymal transition.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Xiong H, Hong J, Du W, Lin YW, Ren LL, Wang YC, Su WY, Wang JL, Cui Y, Wang ZH, Fang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22205702", "url": "https://glygen.org/publication/PubMed/22205702" } ] }, { "title": "SRPX2 is a novel chondroitin sulfate proteoglycan that is overexpressed in gastrointestinal cancer.", "journal": "PLoS ONE", "date": "2012", "authors": "Tanaka Kaoru, Arao Tokuzo, Tamura Daisuke, Aomatsu Keiichi, Furuta Kazuyuki, Matsumoto Kazuko, Kaneda Hiroyasu, Kudo Kanae, Fujita Yoshihiko, Kimura Hideharu, Yanagihara Kazuyoshi, Yamada Yasuhide, Okamoto Isamu, Nakagawa Kazuhiko, Nishio Kazuto", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "reference": [ { "type": "PubMed", "id": "22242148", "url": "https://glygen.org/publication/PubMed/22242148" } ] }, { "title": "The Jak/STAT pathway.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2012", "authors": "Harrison DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22383755", "url": "https://glygen.org/publication/PubMed/22383755" } ] }, { "title": "Histone recognition and large-scale structural analysis of the human bromodomain family.", "journal": "Cell", "date": "2012", "authors": "Filippakopoulos P, Picaud S, Mangos M, Keates T, Lambert JP, Barsyte-Lovejoy D, Felletar I, Volkmer R, Muller S, Pawson T, Gingras AC, Arrowsmith CH, Knapp S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "22464331", "url": "https://glygen.org/publication/PubMed/22464331" } ] }, { "title": "ERK1/2 MAP kinases: structure, function, and regulation.", "journal": "Pharmacological research", "date": "2012", "authors": "Roskoski R Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "22569528", "url": "https://glygen.org/publication/PubMed/22569528" } ] }, { "title": "Functional characterization of an isoform-selective inhibitor of PI3K-p110beta as a potential anticancer agent.", "journal": "Cancer discovery", "date": "2012", "authors": "Ni J, Liu Q, Xie S, Carlson C, Von T, Vogel K, Riddle S, Benes C, Eck M, Roberts T, Gray N, Zhao J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "22588880", "url": "https://glygen.org/publication/PubMed/22588880" } ] }, { "title": "A comprehensive survey of Ras mutations in cancer.", "journal": "Cancer research", "date": "2012", "authors": "Prior IA, Lewis PD, Mattos C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "22589270", "url": "https://glygen.org/publication/PubMed/22589270" } ] }, { "title": "STAT1 gene expression is enhanced by nuclear EGFR and HER2 via cooperation with STAT3.", "journal": "Molecular carcinogenesis", "date": "2013", "authors": "Han W, Carpenter RL, Cao X, Lo HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22693070", "url": "https://glygen.org/publication/PubMed/22693070" } ] }, { "title": "Probing the GTPase cycle with real-time NMR: GAP and GEF activities in cell extracts.", "journal": "Methods (San Diego, Calif.)", "date": "2012", "authors": "Marshall CB, Meiri D, Smith MJ, Mazhab-Jafari MT, Gasmi-Seabrook GM, Rottapel R, Stambolic V, Ikura M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "22750304", "url": "https://glygen.org/publication/PubMed/22750304" } ] }, { "title": "The p110alpha and p110beta isoforms of PI3K play divergent roles in mammary gland development and tumorigenesis.", "journal": "Genes & development", "date": "2012", "authors": "Utermark T, Rao T, Cheng H, Wang Q, Lee SH, Wang ZC, Iglehart JD, Roberts TM, Muller WJ, Zhao JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "22802530", "url": "https://glygen.org/publication/PubMed/22802530" } ] }, { "title": "Interleukin-10-induced neutrophil gelatinase-associated lipocalin production in macrophages with consequences for tumor growth.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Jung M, Weigert A, Tausendschon M, Mora J, Oren B, Sola A, Hotter G, Muta T, Brune B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "22851691", "url": "https://glygen.org/publication/PubMed/22851691" } ] }, { "title": "STAT1 activation by venous malformations mutant Tie2-R849W antagonizes VEGF-A-mediated angiogenic response partly via reduced bFGF production.", "journal": "Angiogenesis", "date": "2013", "authors": "Huang YH, Wu MP, Pan SC, Su WC, Chen YW, Wu LW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23086340", "url": "https://glygen.org/publication/PubMed/23086340" } ] }, { "title": "The protein tyrosine phosphatase, Shp2, positively contributes to FLT3-ITD-induced hematopoietic progenitor hyperproliferation and malignant disease in vivo.", "journal": "Leukemia", "date": "2013", "authors": "Nabinger SC, Li XJ, Ramdas B, He Y, Zhang X, Zeng L, Richine B, Bowling JD, Fukuda S, Goenka S, Liu Z, Feng GS, Yu M, Sandusky GE, Boswell HS, Zhang ZY, Kapur R, Chan RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "23103841", "url": "https://glygen.org/publication/PubMed/23103841" } ] }, { "title": "IL-4 and IL-13 employ discrete signaling pathways for target gene expression in alternatively activated monocytes/macrophages.", "journal": "Free radical biology & medicine", "date": "2013", "authors": "Bhattacharjee A, Shukla M, Yakubenko VP, Mulya A, Kundu S, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23124025", "url": "https://glygen.org/publication/PubMed/23124025" } ] }, { "title": "STAT3 is involved in esophageal carcinogenesis through regulation of Oct-1.", "journal": "Carcinogenesis", "date": "2013", "authors": "Wang Z, Zhu S, Shen M, Liu J, Wang M, Li C, Wang Y, Deng A, Mei Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23172665", "url": "https://glygen.org/publication/PubMed/23172665" } ] }, { "title": "Cloning of the human and murine interleukin-7 receptors: demonstration of a soluble form and homology to a new receptor superfamily.", "journal": "Cell", "date": "1990", "authors": "Goodwin RG, Friend D, Ziegler SF, Jerzy R, Falk BA, Gimpel S, Cosman D, Dower SK, March CJ, Namen AE, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "2317865", "url": "https://glygen.org/publication/PubMed/2317865" } ] }, { "title": "Cbl-independent degradation of Met: ways to avoid agonism of bivalent Met-targeting antibody.", "journal": "Oncogene", "date": "2014", "authors": "Lee JM, Kim B, Lee SB, Jeong Y, Oh YM, Song YJ, Jung S, Choi J, Lee S, Cheong KH, Kim DU, Park HW, Han YK, Kim GW, Choi H, Song PH, Kim KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "23208509", "url": "https://glygen.org/publication/PubMed/23208509" } ] }, { "title": "Regulation of small GTPases by GEFs, GAPs, and GDIs.", "journal": "Physiological reviews", "date": "2013", "authors": "Cherfils J, Zeghouf M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "23303910", "url": "https://glygen.org/publication/PubMed/23303910" } ] }, { "title": "Nonredundant functions for Ras GTPase-activating proteins in tissue homeostasis.", "journal": "Science signaling", "date": "2013", "authors": "King PD, Lubeck BA, Lapinski PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "23443682", "url": "https://glygen.org/publication/PubMed/23443682" } ] }, { "title": "Mutant B-RAF-Mcl-1 survival signaling depends on the STAT3 transcription factor.", "journal": "Oncogene", "date": "2014", "authors": "Becker TM, Boyd SC, Mijatov B, Gowrishankar K, Snoyman S, Pupo GM, Scolyer RA, Mann GJ, Kefford RF, Zhang XD, Rizos H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23455323", "url": "https://glygen.org/publication/PubMed/23455323" } ] }, { "title": "Tivantinib (ARQ197) displays cytotoxic activity that is independent of its ability to bind MET.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2013", "authors": "Basilico C, Pennacchietti S, Vigna E, Chiriaco C, Arena S, Bardelli A, Valdembri D, Serini G, Michieli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "23532890", "url": "https://glygen.org/publication/PubMed/23532890" } ] }, { "title": "Tissue inhibitor of metalloproteinase 1 is preferentially expressed in Th1 and Th17 T-helper cell subsets and is a direct STAT target gene.", "journal": "PloS one", "date": "2013", "authors": "Adamson A, Ghoreschi K, Rittler M, Chen Q, Sun HW, Vahedi G, Kanno Y, Stetler-Stevenson WG, O'Shea JJ, Laurence A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23555662", "url": "https://glygen.org/publication/PubMed/23555662" } ] }, { "title": "Structure of ERK2 bound to PEA-15 reveals a mechanism for rapid release of activated MAPK.", "journal": "Nature communications", "date": "2013", "authors": "Mace PD, Wallez Y, Egger MF, Dobaczewska MK, Robinson H, Pasquale EB, Riedl SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "23575685", "url": "https://glygen.org/publication/PubMed/23575685" } ] }, { "title": "High precision platelet releasate definition by quantitative reversed protein profiling--brief report.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2013", "authors": "Wijten P, van Holten T, Woo LL, Bleijerveld OB, Roest M, Heck AJ, Scholten A", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "23640497", "url": "https://glygen.org/publication/PubMed/23640497" } ] }, { "title": "Monovalent antibody design and mechanism of action of onartuzumab, a MET antagonist with anti-tumor activity as a therapeutic agent.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Merchant M, Ma X, Maun HR, Zheng Z, Peng J, Romero M, Huang A, Yang NY, Nishimura M, Greve J, Santell L, Zhang YW, Su Y, Kaufman DW, Billeci KL, Mai E, Moffat B, Lim A, Duenas ET, Phillips HS, Xiang H, Young JC, Vande Woude GF, Dennis MS, Reilly DE, Schwall RH, Starovasnik MA, Lazarus RA, Yansura DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "23882082", "url": "https://glygen.org/publication/PubMed/23882082" } ] }, { "title": "STAT3 regulates MMP3 in heme-induced endothelial cell apoptosis.", "journal": "PloS one", "date": "2013", "authors": "Liu M, Wilson NO, Hibbert JM, Stiles JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "23967200", "url": "https://glygen.org/publication/PubMed/23967200" } ] }, { "title": "The signal transducers Stat1 and Stat3 and their novel target Jmjd3 drive the expression of inflammatory genes in microglia.", "journal": "Journal of molecular medicine (Berlin, Germany)", "date": "2014", "authors": "Przanowski P, Dabrowski M, Ellert-Miklaszewska A, Kloss M, Mieczkowski J, Kaza B, Ronowicz A, Hu F, Piotrowski A, Kettenmann H, Komorowski J, Kaminska B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "24097101", "url": "https://glygen.org/publication/PubMed/24097101" } ] }, { "title": "Synergistic activities of MET/RON inhibitor BMS-777607 and mTOR inhibitor AZD8055 to polyploid cells derived from pancreatic cancer and cancer stem cells.", "journal": "Molecular cancer therapeutics", "date": "2014", "authors": "Zeng JY, Sharma S, Zhou YQ, Yao HP, Hu X, Zhang R, Wang MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "24233399", "url": "https://glygen.org/publication/PubMed/24233399" } ] }, { "title": "Targeting MET kinase with the small-molecule inhibitor amuvatinib induces cytotoxicity in primary myeloma cells and cell lines.", "journal": "Journal of hematology & oncology", "date": "2013", "authors": "Phillip CJ, Zaman S, Shentu S, Balakrishnan K, Zhang J, Baladandayuthapani V, Taverna P, Redkar S, Wang M, Stellrecht CM, Gandhi V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "24326130", "url": "https://glygen.org/publication/PubMed/24326130" } ] }, { "title": "Discovery and development of Janus kinase (JAK) inhibitors for inflammatory diseases.", "journal": "Journal of medicinal chemistry", "date": "2014", "authors": "Clark JD, Flanagan ME, Telliez JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "24417533", "url": "https://glygen.org/publication/PubMed/24417533" } ] }, { "title": "FAK dimerization controls its kinase-dependent functions at focal adhesions.", "journal": "The EMBO journal", "date": "2014", "authors": "Brami-Cherrier K, Gervasi N, Arsenieva D, Walkiewicz K, Boutterin MC, Ortega A, Leonard PG, Seantier B, Gasmi L, Bouceba T, Kadare G, Girault JA, Arold ST", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081" } ], "reference": [ { "type": "PubMed", "id": "24480479", "url": "https://glygen.org/publication/PubMed/24480479" } ] }, { "title": "Guanine nucleotide exchange factor Dock7 mediates HGF-induced glioblastoma cell invasion via Rac activation.", "journal": "British journal of cancer", "date": "2014", "authors": "Murray DW, Didier S, Chan A, Paulino V, Van Aelst L, Ruggieri R, Tran NL, Byrne AT, Symons M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8875555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875555" } ], "reference": [ { "type": "PubMed", "id": "24518591", "url": "https://glygen.org/publication/PubMed/24518591" } ] }, { "title": "Cabozantinib suppresses tumor growth and metastasis in hepatocellular carcinoma by a dual blockade of VEGFR2 and MET.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2014", "authors": "Xiang Q, Chen W, Ren M, Wang J, Zhang H, Deng DY, Zhang L, Shang C, Chen Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "24700742", "url": "https://glygen.org/publication/PubMed/24700742" } ] }, { "title": "Met degradation by SAIT301, a Met monoclonal antibody, reduces the invasion and migration of nasopharyngeal cancer cells via inhibition of EGR-1 expression.", "journal": "Cell death & disease", "date": "2014", "authors": "Lee BS, Kang S, Kim KA, Song YJ, Cheong KH, Cha HY, Kim CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "24722284", "url": "https://glygen.org/publication/PubMed/24722284" } ] }, { "title": "STAT3 Target Genes Relevant to Human Cancers.", "journal": "Cancers", "date": "2014", "authors": "Carpenter RL, Lo HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "24743777", "url": "https://glygen.org/publication/PubMed/24743777" } ] }, { "title": "Tensin-4-dependent MET stabilization is essential for survival and proliferation in carcinoma cells.", "journal": "Developmental cell", "date": "2014", "authors": "Muharram G, Sahgal P, Korpela T, De Franceschi N, Kaukonen R, Clark K, Tulasne D, Carpen O, Ivaska J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8875513", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875513" } ], "reference": [ { "type": "PubMed", "id": "24814316", "url": "https://glygen.org/publication/PubMed/24814316" } ] }, { "title": "USP8 modulates ubiquitination of LRIG1 for Met degradation.", "journal": "Scientific reports", "date": "2014", "authors": "Oh YM, Lee SB, Choi J, Suh HY, Shim S, Song YJ, Kim B, Lee JM, Oh SJ, Jeong Y, Cheong KH, Song PH, Kim KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807004", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004" } ], "reference": [ { "type": "PubMed", "id": "24828152", "url": "https://glygen.org/publication/PubMed/24828152" } ] }, { "title": "PI3K/AKT signaling pathway and cancer: an updated review.", "journal": "Annals of medicine", "date": "2014", "authors": "Martini M, De Santis MC, Braccini L, Gulluni F, Hirsch E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "24897931", "url": "https://glygen.org/publication/PubMed/24897931" } ] }, { "title": "`RAF` neighborhood: protein-protein interaction in the Raf/Mek/Erk pathway.", "journal": "FEBS letters", "date": "2014", "authors": "Cseh B, Doma E, Baccarini M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "24937142", "url": "https://glygen.org/publication/PubMed/24937142" } ] }, { "title": "Discovery of (S)-1-(1-(Imidazo[1,2-a]pyridin-6-yl)ethyl)-6-(1-methyl-1H-pyrazol-4-yl)-1H-[1,2, 3]triazolo[4,5-b]pyrazine (volitinib) as a highly potent and selective mesenchymal-epithelial transition factor (c-Met) inhibitor in clinical development for treatment of cancer.", "journal": "Journal of medicinal chemistry", "date": "2014", "authors": "Jia H, Dai G, Weng J, Zhang Z, Wang Q, Zhou F, Jiao L, Cui Y, Ren Y, Fan S, Zhou J, Qing W, Gu Y, Wang J, Sai Y, Su W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "25148209", "url": "https://glygen.org/publication/PubMed/25148209" } ] }, { "title": "Ral small GTPase signaling and oncogenesis: More than just 15minutes of fame.", "journal": "Biochimica et biophysica acta", "date": "2014", "authors": "Gentry LR, Martin TD, Reiner DJ, Der CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "25219551", "url": "https://glygen.org/publication/PubMed/25219551" } ] }, { "title": "LY2875358, a neutralizing and internalizing anti-MET bivalent antibody, inhibits HGF-dependent and HGF-independent MET activation and tumor growth.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2014", "authors": "Liu L, Zeng W, Wortinger MA, Yan SB, Cornwell P, Peek VL, Stephens JR, Tetreault JW, Xia J, Manro JR, Credille KM, Ballard DW, Brown-Augsburger P, Wacheck V, Chow CK, Huang L, Wang Y, Denning I, Davies J, Tang Y, Vaillancourt P, Lu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "25231402", "url": "https://glygen.org/publication/PubMed/25231402" } ] }, { "title": "Liver is the major source of elevated serum lipocalin-2 levels after bacterial infection or partial hepatectomy: a critical role for IL-6/STAT3.", "journal": "Hepatology (Baltimore, Md.)", "date": "2015", "authors": "Xu MJ, Feng D, Wu H, Wang H, Chan Y, Kolls J, Borregaard N, Porse B, Berger T, Mak TW, Cowland JB, Kong X, Gao B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "25234944", "url": "https://glygen.org/publication/PubMed/25234944" } ] }, { "title": "Volitinib, a potent and highly selective c-Met inhibitor, effectively blocks c-Met signaling and growth in c-MET amplified gastric cancer patient-derived tumor xenograft models.", "journal": "Molecular oncology", "date": "2015", "authors": "Gavine PR, Ren Y, Han L, Lv J, Fan S, Zhang W, Xu W, Liu YJ, Zhang T, Fu H, Yu Y, Wang H, Xu S, Zhou F, Su X, Yin X, Xie L, Wang L, Qing W, Jiao L, Su W, Wang QM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "25248999", "url": "https://glygen.org/publication/PubMed/25248999" } ] }, { "title": "Molecular cloning and sequence analysis of cDNA for human hepatocyte growth factor.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1989", "authors": "Miyazawa K, Tsubouchi H, Naka D, Takahashi K, Okigaki M, Arakaki N, Nakayama H, Hirono S, Sakiyama O, Takahashi K, et al.", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "reference": [ { "type": "PubMed", "id": "2528952", "url": "https://glygen.org/publication/PubMed/2528952" } ] }, { "title": "Molecular cloning and expression of human hepatocyte growth factor.", "journal": "Nature", "date": "1989", "authors": "Nakamura T, Nishizawa T, Hagiya M, Seki T, Shimonishi M, Sugimura A, Tashiro K, Shimizu S", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "reference": [ { "type": "PubMed", "id": "2531289", "url": "https://glygen.org/publication/PubMed/2531289" } ] }, { "title": "Ras activation revisited: role of GEF and GAP systems.", "journal": "Biological chemistry", "date": "2015", "authors": "Hennig A, Markwart R, Esparza-Franco MA, Ladds G, Rubio I", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "25781681", "url": "https://glygen.org/publication/PubMed/25781681" } ] }, { "title": "The Key Role of Calmodulin in KRAS-Driven Adenocarcinomas.", "journal": "Molecular cancer research : MCR", "date": "2015", "authors": "Nussinov R, Muratcioglu S, Tsai CJ, Jang H, Gursoy A, Keskin O", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "26085527", "url": "https://glygen.org/publication/PubMed/26085527" } ] }, { "title": "Depleting MET-Expressing Tumor Cells by ADCC Provides a Therapeutic Advantage over Inhibiting HGF/MET Signaling.", "journal": "Cancer research", "date": "2015", "authors": "Hultberg A, Morello V, Huyghe L, De Jonge N, Blanchetot C, Hanssens V, De Boeck G, Silence K, Festjens E, Heukers R, Roux B, Lamballe F, Ginestier C, Charafe-Jauffret E, Maina F, Brouckaert P, Saunders M, Thibault A, Dreier T, de Haard H, Michieli P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "26141862", "url": "https://glygen.org/publication/PubMed/26141862" } ] }, { "title": "Histone reader BRWD1 targets and restricts recombination to the Igk locus.", "journal": "Nature immunology", "date": "2015", "authors": "Mandal M, Hamel KM, Maienschein-Cline M, Tanaka A, Teng G, Tuteja JH, Bunker JJ, Bahroos N, Eppig JJ, Schatz DG, Clark MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "26301565", "url": "https://glygen.org/publication/PubMed/26301565" } ] }, { "title": "LNK/SH2B3 regulates IL-7 receptor signaling in normal and malignant B-progenitors.", "journal": "The Journal of clinical investigation", "date": "2016", "authors": "Cheng Y, Chikwava K, Wu C, Zhang H, Bhagat A, Pei D, Choi JK, Tong W", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "26974155", "url": "https://glygen.org/publication/PubMed/26974155" } ] }, { "title": "In Vitro and In Vivo Activity of AMG 337, a Potent and Selective MET Kinase Inhibitor, in MET-Dependent Cancer Models.", "journal": "Molecular cancer therapeutics", "date": "2016", "authors": "Hughes PE, Rex K, Caenepeel S, Yang Y, Zhang Y, Broome MA, Kha HT, Burgess TL, Amore B, Kaplan-Lefko PJ, Moriguchi J, Werner J, Damore MA, Baker D, Choquette DM, Harmange JC, Radinsky R, Kendall R, Dussault I, Coxon A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "27196782", "url": "https://glygen.org/publication/PubMed/27196782" } ] }, { "title": "Suppressor of cytokine signaling (SOCS) proteins are induced by IL-7 and target surface CD127 protein for degradation in human CD8 T cells.", "journal": "Cellular immunology", "date": "2016", "authors": "Ghazawi FM, Faller EM, Parmar P, El-Salfiti A, MacPherson PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "27423467", "url": "https://glygen.org/publication/PubMed/27423467" } ] }, { "title": "Modulating the function of ATP-binding cassette subfamily G member 2 (ABCG2) with inhibitor cabozantinib.", "journal": "Pharmacological research", "date": "2017", "authors": "Zhang GN, Zhang YK, Wang YJ, Barbuti AM, Zhu XJ, Yu XY, Wen AW, Wurpel JND, Chen ZS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "28131876", "url": "https://glygen.org/publication/PubMed/28131876" } ] }, { "title": "Glesatinib Exhibits Antitumor Activity in Lung Cancer Models and Patients Harboring MET Exon 14 Mutations and Overcomes Mutation-mediated Resistance to Type I MET Inhibitors in Nonclinical Models.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2017", "authors": "Engstrom LD, Aranda R, Lee M, Tovar EA, Essenburg CJ, Madaj Z, Chiang H, Briere D, Hallin J, Lopez-Casas PP, Banos N, Menendez C, Hidalgo M, Tassell V, Chao R, Chudova DI, Lanman RB, Olson P, Bazhenova L, Patel SP, Graveel C, Nishino M, Shapiro GI, Peled N, Awad MM, Janne PA, Christensen JG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "28765324", "url": "https://glygen.org/publication/PubMed/28765324" } ] }, { "title": "Targeting Ras with Macromolecules.", "journal": "Cold Spring Harbor perspectives in medicine", "date": "2018", "authors": "Pei D, Chen K, Liao H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "28778966", "url": "https://glygen.org/publication/PubMed/28778966" } ] }, { "title": "Tofacitinib: A Review in Rheumatoid Arthritis.", "journal": "Drugs", "date": "2017", "authors": "Dhillon S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "29139090", "url": "https://glygen.org/publication/PubMed/29139090" } ] }, { "title": "Known and novel roles of the MET oncogene in cancer: a coherent approach to targeted therapy.", "journal": "Nature reviews. Cancer", "date": "2018", "authors": "Comoglio PM, Trusolino L, Boccaccio C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "29674709", "url": "https://glygen.org/publication/PubMed/29674709" } ] }, { "title": "Synthesis, Evaluation, and Mechanism Study of New Tepotinib Derivatives as Antiproliferative Agents.", "journal": "Molecules (Basel, Switzerland)", "date": "2019", "authors": "Zhang NN, An BJ, Zhou Y, Li XS, Yan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "30934578", "url": "https://glygen.org/publication/PubMed/30934578" } ] }, { "title": "The structural basis for Ras activation of PI3Kalpha lipid kinase.", "journal": "Physical chemistry chemical physics : PCCP", "date": "2019", "authors": "Zhang M, Jang H, Nussinov R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "31135801", "url": "https://glygen.org/publication/PubMed/31135801" } ] }, { "title": "JAK3 inhibitors based on thieno[3,2-d]pyrimidine scaffold: design, synthesis and bioactivity evaluation for the treatment of B-cell lymphoma.", "journal": "Bioorganic chemistry", "date": "2020", "authors": "Chi F, Chen L, Wang C, Li L, Sun X, Xu Y, Ma T, Liu K, Ma X, Shu X", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "31918398", "url": "https://glygen.org/publication/PubMed/31918398" } ] }, { "title": "Tivantinib, A c-Met Inhibitor in Clinical Trials, Is Susceptible to ABCG2-Mediated Drug Resistance.", "journal": "Cancers", "date": "2020", "authors": "Wu ZX, Yang Y, Teng QX, Wang JQ, Lei ZN, Wang JQ, Lusvarghi S, Ambudkar SV, Yang DH, Chen ZS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "31940916", "url": "https://glygen.org/publication/PubMed/31940916" } ] }, { "title": "OMO-1 reduces progression and enhances cisplatin efficacy in a 4T1-based non-c-MET addicted intraductal mouse model for triple-negative breast cancer.", "journal": "NPJ breast cancer", "date": "2021", "authors": "Steenbrugge J, Vander Elst N, Demeyere K, De Wever O, Sanders NN, Van Den Broeck W, Ciamporcero E, Perera T, Meyer E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9734091", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091" } ], "reference": [ { "type": "PubMed", "id": "33731699", "url": "https://glygen.org/publication/PubMed/33731699" } ] }, { "title": "Translation of circHGF RNA encodes an HGF protein variant promoting glioblastoma growth through stimulation of c-MET.", "journal": "Journal of neuro-oncology", "date": "2023-05-10", "authors": "Saunders Jacquelyn T, Kumar Sunil, Benavides-Serrato Angelica, Holmes Brent, Benavides Kennedy E, Bashir Muhammad T, Nishimura Robert N, Gera Joseph", "evidence": [ { "database": "RefSeq", "id": "NP_000592", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000592" } ], "reference": [ { "type": "PubMed", "id": "37162666", "url": "https://glygen.org/publication/PubMed/37162666" } ] }, { "title": "Immunohistochemical expression of the hepatocyte growth factor in chromophobe renal cell carcinoma.", "journal": "BMC urology", "date": "2023-05-11", "authors": "Erlmeier Maximilian, Mikuteit Marie, Zsch\u00e4bitz Stefanie, Autenrieth Michael, Weichert Wilko, Hartmann Arndt, Steffens Sandra, Erlmeier Franziska", "evidence": [ { "database": "RefSeq", "id": "NP_000592", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000592" } ], "reference": [ { "type": "PubMed", "id": "37170275", "url": "https://glygen.org/publication/PubMed/37170275" } ] }, { "title": "Intercellular Interactions Mediated by HGF And TGF-\u0392 Promote the 3D Spherical and Xenograft Growth of Liver Cancer Cells.", "journal": "Current protein & peptide science", "date": "2023-08-25", "authors": "Peng Zheng, Lv Xiaolan, Zhang Pengfei, Chen Qiao, Zhang Hongyu, Chen Jianlin, Ma Xingxuan, Ouyang Bohui, Hao Meng, Tong Haibo, Guo Dongwei, Luo Yi, Huang Shigao", "evidence": [ { "database": "RefSeq", "id": "NP_000592", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000592" } ], "reference": [ { "type": "PubMed", "id": "37642183", "url": "https://glygen.org/publication/PubMed/37642183" } ] }, { "title": "USP11 potentiates HGF/AKT signaling and drives metastasis in hepatocellular carcinoma.", "journal": "Oncogene", "date": "2024-01", "authors": "Chen Jin, Ning Deng, Du Pengcheng, Liu Qiumeng, Mo Jie, Liang Huifang, Zhang Wanguang, Zhang Mingzhi, Jiang Li, Zhang Bixiang, Chen Xiaoping", "evidence": [ { "database": "RefSeq", "id": "NP_000592", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000592" } ], "reference": [ { "type": "PubMed", "id": "37973952", "url": "https://glygen.org/publication/PubMed/37973952" } ] }, { "title": "Intrinsic GTPase activity distinguishes normal and oncogenic ras p21 molecules.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1984", "authors": "Gibbs JB, Sigal IS, Poe M, Scolnick EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "6148751", "url": "https://glygen.org/publication/PubMed/6148751" } ] }, { "title": "Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa.", "journal": "Biochimica et biophysica acta", "date": "1981", "authors": "Gogstad GO, Hagen I, Korsmo R, Solum NO", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "6457647", "url": "https://glygen.org/publication/PubMed/6457647" } ] }, { "title": "Interleukin-7 can induce the activation of Jak 1, Jak 3 and STAT 5 proteins in murine T cells.", "journal": "European journal of immunology", "date": "1995", "authors": "Foxwell BM, Beadling C, Guschin D, Kerr I, Cantrell D", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "7489741", "url": "https://glygen.org/publication/PubMed/7489741" } ] }, { "title": "Autophosphorylation of the focal adhesion kinase, pp125FAK, directs SH2-dependent binding of pp60src.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Schaller MD, Hildebrand JD, Shannon JD, Fox JW, Vines RR, Parsons JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081" } ], "reference": [ { "type": "PubMed", "id": "7509446", "url": "https://glygen.org/publication/PubMed/7509446" } ] }, { "title": "Interferon activation of the transcription factor Stat91 involves dimerization through SH2-phosphotyrosyl peptide interactions.", "journal": "Cell", "date": "1994", "authors": "Shuai K, Horvath CM, Huang LH, Qureshi SA, Cowburn D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7510216", "url": "https://glygen.org/publication/PubMed/7510216" } ] }, { "title": "Molecular cloning of APRF, a novel IFN-stimulated gene factor 3 p91-related transcription factor involved in the gp130-mediated signaling pathway.", "journal": "Cell", "date": "1994", "authors": "Akira S, Nishio Y, Inoue M, Wang XJ, Wei S, Matsusaka T, Yoshida K, Sudo T, Naruto M, Kishimoto T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7512451", "url": "https://glygen.org/publication/PubMed/7512451" } ] }, { "title": "A multifunctional docking site mediates signaling and transformation by the hepatocyte growth factor/scatter factor receptor family.", "journal": "Cell", "date": "1994", "authors": "Ponzetto C, Bardelli A, Zhen Z, Maina F, dalla Zonca P, Giordano S, Graziani A, Panayotou G, Comoglio PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6806942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6806942" } ], "reference": [ { "type": "PubMed", "id": "7513258", "url": "https://glygen.org/publication/PubMed/7513258" } ] }, { "title": "Cytoplasmic domains of the interleukin-2 receptor beta and gamma chains mediate the signal for T-cell proliferation.", "journal": "Nature", "date": "1994", "authors": "Nelson BH, Lord JD, Greenberg PD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "7514277", "url": "https://glygen.org/publication/PubMed/7514277" } ] }, { "title": "IL-13 selectively induces vascular cell adhesion molecule-1 expression in human endothelial cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1995", "authors": "Bochner BS, Klunk DA, Sterbinsky SA, Coffman RL, Schleimer RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7529288", "url": "https://glygen.org/publication/PubMed/7529288" } ] }, { "title": "Protein kinase B (c-Akt) in phosphatidylinositol-3-OH kinase signal transduction.", "journal": "Nature", "date": "1995", "authors": "Burgering BM, Coffer PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "7637810", "url": "https://glygen.org/publication/PubMed/7637810" } ] }, { "title": "Essential role for the c-met receptor in the migration of myogenic precursor cells into the limb bud.", "journal": "Nature", "date": "1995", "authors": "Bladt F, Riethmacher D, Isenmann S, Aguzzi A, Birchmeier C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6806942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6806942" } ], "reference": [ { "type": "PubMed", "id": "7651534", "url": "https://glygen.org/publication/PubMed/7651534" } ] }, { "title": "Mutation of juxtamembrane tyrosine residue 1001 suppresses loss-of-function mutations of the met receptor in epithelial cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Weidner KM, Sachs M, Riethmacher D, Birchmeier W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6806942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6806942" } ], "reference": [ { "type": "PubMed", "id": "7708691", "url": "https://glygen.org/publication/PubMed/7708691" } ] }, { "title": "The role of shared receptor motifs and common Stat proteins in the generation of cytokine pleiotropy and redundancy by IL-2, IL-4, IL-7, IL-13, and IL-15.", "journal": "Immunity", "date": "1995", "authors": "Lin JX, Migone TS, Tsang M, Friedmann M, Weatherbee JA, Zhou L, Yamauchi A, Bloom ET, Mietz J, John S, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "7719938", "url": "https://glygen.org/publication/PubMed/7719938" } ] }, { "title": "The motogenic and mitogenic responses to HGF are amplified by the Shc adaptor protein.", "journal": "Oncogene", "date": "1995", "authors": "Pelicci G, Giordano S, Zhen Z, Salcini AE, Lanfrancone L, Bardelli A, Panayotou G, Waterfield MD, Ponzetto C, Pelicci PG, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-8851805", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8851805" } ], "reference": [ { "type": "PubMed", "id": "7731718", "url": "https://glygen.org/publication/PubMed/7731718" } ] }, { "title": "Phosphoinositide 3-kinase inhibition spares actin assembly in activating platelets but reverses platelet aggregation.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Kovacsovics TJ, Bachelot C, Toker A, Vlahos CJ, Duckworth B, Cantley LC, Hartwig JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "7744773", "url": "https://glygen.org/publication/PubMed/7744773" } ] }, { "title": "Direct evidence of a heterotrimeric complex of human interleukin-4 with its receptors.", "journal": "Protein science : a publication of the Protein Society", "date": "1995", "authors": "Hoffman RC, Castner BJ, Gerhart M, Gibson MG, Rasmussen BD, March CJ, Weatherbee J, Tsang M, Gustchina A, Schalk-Hihi C, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7795521", "url": "https://glygen.org/publication/PubMed/7795521" } ] }, { "title": "Components of a Stat recognition code: evidence for two layers of molecular selectivity.", "journal": "Immunity", "date": "1995", "authors": "Schindler U, Wu P, Rothe M, Brasseur M, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7796300", "url": "https://glygen.org/publication/PubMed/7796300" } ] }, { "title": "Identification of the guanine nucleotide dissociation stimulator for Ral as a putative effector molecule of R-ras, H-ras, K-ras, and Rap.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Spaargaren M, Bischoff JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "7809086", "url": "https://glygen.org/publication/PubMed/7809086" } ] }, { "title": "Scatter factor/hepatocyte growth factor is essential for liver development.", "journal": "Nature", "date": "1995", "authors": "Schmidt C, Bladt F, Goedecke S, Brinkmann V, Zschiesche W, Sharpe M, Gherardi E, Birchmeier C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6806942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6806942" } ], "reference": [ { "type": "PubMed", "id": "7854452", "url": "https://glygen.org/publication/PubMed/7854452" } ] }, { "title": "Placental defect and embryonic lethality in mice lacking hepatocyte growth factor/scatter factor.", "journal": "Nature", "date": "1995", "authors": "Uehara Y, Minowa O, Mori C, Shiota K, Kuno J, Noda T, Kitamura N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6806942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6806942" } ], "reference": [ { "type": "PubMed", "id": "7854453", "url": "https://glygen.org/publication/PubMed/7854453" } ] }, { "title": "Transcriptional regulation of the junB promoter: analysis of STAT-mediated signal transduction.", "journal": "Oncogene", "date": "1995", "authors": "Coffer P, Lutticken C, van Puijenbroek A, Klop-de Jonge M, Horn F, Kruijer W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7898939", "url": "https://glygen.org/publication/PubMed/7898939" } ] }, { "title": "Interleukin 13, an interleukin 4-like cytokine that acts on monocytes and B cells, but not on T cells.", "journal": "Immunology today", "date": "1994", "authors": "Zurawski G, de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "7907877", "url": "https://glygen.org/publication/PubMed/7907877" } ] }, { "title": "ralGDS family members interact with the effector loop of ras p21.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Kikuchi A, Demo SD, Ye ZH, Chen YW, Williams LT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "7935463", "url": "https://glygen.org/publication/PubMed/7935463" } ] }, { "title": "Activated Ras interacts with the Ral guanine nucleotide dissociation stimulator.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Hofer F, Fields S, Schneider C, Martin GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "7972015", "url": "https://glygen.org/publication/PubMed/7972015" } ] }, { "title": "Phosphatidylinositol-3-OH kinase as a direct target of Ras.", "journal": "Nature", "date": "1994", "authors": "Rodriguez-Viciana P, Warne PH, Dhand R, Vanhaesebroeck B, Gout I, Fry MJ, Waterfield MD, Downward J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "8052307", "url": "https://glygen.org/publication/PubMed/8052307" } ] }, { "title": "Direct interaction of v-Src with the focal adhesion kinase mediated by the Src SH2 domain.", "journal": "Molecular biology of the cell", "date": "1994", "authors": "Xing Z, Chen HC, Nowlen JK, Taylor SJ, Shalloway D, Guan JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081" } ], "reference": [ { "type": "PubMed", "id": "8054685", "url": "https://glygen.org/publication/PubMed/8054685" } ] }, { "title": "An interleukin-4-induced transcription factor: IL-4 Stat.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Hou J, Schindler U, Henzel WJ, Ho TC, Brasseur M, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8085155", "url": "https://glygen.org/publication/PubMed/8085155" } ] }, { "title": "Functional participation of the IL-2 receptor gamma chain in IL-7 receptor complexes.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Kondo M, Takeshita T, Higuchi M, Nakamura M, Sudo T, Nishikawa S, Sugamura K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "8128231", "url": "https://glygen.org/publication/PubMed/8128231" } ] }, { "title": "Invasiveness and metastasis of NIH 3T3 cells induced by Met-hepatocyte growth factor/scatter factor autocrine stimulation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Rong S, Segal S, Anver M, Resau JH, Vande Woude GF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6806942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6806942" } ], "reference": [ { "type": "PubMed", "id": "8197126", "url": "https://glygen.org/publication/PubMed/8197126" } ] }, { "title": "Autophosphorylation modulates the kinase activity and oncogenic potential of the Met receptor tyrosine kinase.", "journal": "Oncogene", "date": "1994", "authors": "Rodrigues GA, Park M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6806942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6806942" } ], "reference": [ { "type": "PubMed", "id": "8208547", "url": "https://glygen.org/publication/PubMed/8208547" } ] }, { "title": "Interleukin-2 receptor gamma chain: a functional component of the interleukin-7 receptor.", "journal": "Science (New York, N.Y.)", "date": "1993", "authors": "Noguchi M, Nakamura Y, Russell SM, Ziegler SF, Tsang M, Cao X, Leonard WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "8266077", "url": "https://glygen.org/publication/PubMed/8266077" } ] }, { "title": "Tyrosines1234-1235 are critical for activation of the tyrosine kinase encoded by the MET proto-oncogene (HGF receptor).", "journal": "Oncogene", "date": "1994", "authors": "Longati P, Bardelli A, Ponzetto C, Naldini L, Comoglio PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6806942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6806942" } ], "reference": [ { "type": "PubMed", "id": "8302603", "url": "https://glygen.org/publication/PubMed/8302603" } ] }, { "title": "Hepsin, a putative cell-surface serine protease, is required for mammalian cell growth.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Torres-Rosado A, O'Shea KS, Tsuji A, Chou SH, Kurachi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6806942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6806942" } ], "reference": [ { "type": "PubMed", "id": "8346233", "url": "https://glygen.org/publication/PubMed/8346233" } ] }, { "title": "Growth factors induce nuclear translocation of MAP kinases (p42mapk and p44mapk) but not of their activator MAP kinase kinase (p45mapkk) in fibroblasts.", "journal": "The Journal of cell biology", "date": "1993", "authors": "Lenormand P, Sardet C, Pages G, L'Allemain G, Brunet A, Pouyssegur J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "8394845", "url": "https://glygen.org/publication/PubMed/8394845" } ] }, { "title": "Structural study of the N-linked oligosaccharides of hepatocyte growth factor by two-dimensional sugar mapping.", "journal": "Journal of biochemistry", "date": "1993", "authors": "Hara H, Nakae Y, Sogabe T, Ihara I, Ueno S, Sakai H, Inoue H, Shimizu S, Nakamura T, Shimizu N", "evidence": [ { "database": "UniCarbKB", "id": "P14210", "url": "" }, { "database": "GlyConnect", "id": "219", "url": "https://glyconnect.expasy.org/browser/proteins/219" } ], "reference": [ { "type": "PubMed", "id": "8407880", "url": "https://glygen.org/publication/PubMed/8407880" } ] }, { "title": "Platelet alpha-granules.", "journal": "Blood reviews", "date": "1993", "authors": "Harrison P, Cramer EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "8467233", "url": "https://glygen.org/publication/PubMed/8467233" } ] }, { "title": "Human Sos1: a guanine nucleotide exchange factor for Ras that binds to GRB2.", "journal": "Science (New York, N.Y.)", "date": "1993", "authors": "Chardin P, Camonis JH, Gale NW, van Aelst L, Schlessinger J, Wigler MH, Bar-Sagi D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "8493579", "url": "https://glygen.org/publication/PubMed/8493579" } ] }, { "title": "Essential role of Stat6 in IL-4 signalling.", "journal": "Nature", "date": "1996", "authors": "Takeda K, Tanaka T, Shi W, Matsumoto M, Minami M, Kashiwamura S, Nakanishi K, Yoshida N, Kishimoto T, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8602263", "url": "https://glygen.org/publication/PubMed/8602263" } ] }, { "title": "STAT3 participates in transcriptional activation of the C-reactive protein gene by interleukin-6.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Zhang D, Sun M, Samols D, Kushner I", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8621622", "url": "https://glygen.org/publication/PubMed/8621622" } ] }, { "title": "Rac GTPase interacts specifically with phosphatidylinositol 3-kinase.", "journal": "The Biochemical journal", "date": "1996", "authors": "Bokoch GM, Vlahos CJ, Wang Y, Knaus UG, Traynor-Kaplan AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "8645157", "url": "https://glygen.org/publication/PubMed/8645157" } ] }, { "title": "Wortmannin inactivates phosphoinositide 3-kinase by covalent modification of Lys-802, a residue involved in the phosphate transfer reaction.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Wymann MP, Bulgarelli-Leva G, Zvelebil MJ, Pirola L, Vanhaesebroeck B, Waterfield MD, Panayotou G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "8657148", "url": "https://glygen.org/publication/PubMed/8657148" } ] }, { "title": "Hepatocyte growth factor (HGF)/NK1 is a naturally occurring HGF/scatter factor variant with partial agonist/antagonist activity.", "journal": "J. Biol. Chem.", "date": "1996", "authors": "Cioce V, Csaky K G, Chan A M, Bottaro D P, Taylor W G, Jensen R, Aaronson S A, Rubin J S", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "reference": [ { "type": "PubMed", "id": "8662798", "url": "https://glygen.org/publication/PubMed/8662798" } ] }, { "title": "Cloning and characterization of a specific interleukin (IL)-13 binding protein structurally related to the IL-5 receptor alpha chain.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Caput D, Laurent P, Kaghad M, Lelias JM, Lefort S, Vita N, Ferrara P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8663118", "url": "https://glygen.org/publication/PubMed/8663118" } ] }, { "title": "Activation of phosphoinositide 3-kinase by interaction with Ras and by point mutation.", "journal": "The EMBO journal", "date": "1996", "authors": "Rodriguez-Viciana P, Warne PH, Vanhaesebroeck B, Waterfield MD, Downward J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "8665852", "url": "https://glygen.org/publication/PubMed/8665852" } ] }, { "title": "The lipopolysaccharide-binding protein is a secretory class 1 acute-phase protein whose gene is transcriptionally activated by APRF/STAT/3 and other cytokine-inducible nuclear proteins.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Schumann RR, Kirschning CJ, Unbehaun A, Aberle HP, Knope HP, Lamping N, Ulevitch RJ, Herrmann F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8668165", "url": "https://glygen.org/publication/PubMed/8668165" } ] }, { "title": "Distinct tyrosine residues within the interleukin-2 receptor beta chain drive signal transduction specificity, redundancy, and diversity.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Gaffen SL, Lai SY, Ha M, Liu X, Hennighausen L, Greene WC, Goldsmith MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "8702919", "url": "https://glygen.org/publication/PubMed/8702919" } ] }, { "title": "Branching tubulogenesis but not scatter of madin-darby canine kidney cells requires a functional Grb2 binding site in the Met receptor tyrosine kinase.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Fournier TM, Kamikura D, Teng K, Park M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8851805", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8851805" } ], "reference": [ { "type": "PubMed", "id": "8703035", "url": "https://glygen.org/publication/PubMed/8703035" } ] }, { "title": "Interleukin-7 signaling in human B cell precursor acute lymphoblastic leukemia cells and murine BAF3 cells involves activation of STAT1 and STAT5 mediated via the interleukin-7 receptor alpha chain.", "journal": "Leukemia", "date": "1996", "authors": "van der Plas DC, Smiers F, Pouwels K, Hoefsloot LH, Lowenberg B, Touw IP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "8709637", "url": "https://glygen.org/publication/PubMed/8709637" } ] }, { "title": "RalGDS-like factor (Rlf) is a novel Ras and Rap 1A-associating protein.", "journal": "Oncogene", "date": "1996", "authors": "Wolthuis RM, Bauer B, van 't Veer LJ, de Vries-Smits AM, Cool RH, Spaargaren M, Wittinghofer A, Burgering BM, Bos JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "8710374", "url": "https://glygen.org/publication/PubMed/8710374" } ] }, { "title": "Scatter factor binds to thrombospondin and other extracellular matrix components.", "journal": "The American journal of pathology", "date": "1996", "authors": "Lamszus K, Joseph A, Jin L, Yao Y, Chowdhury S, Fuchs A, Polverini PJ, Goldberg ID, Rosen EM", "evidence": [ { "database": "MatrixDB", "id": "GAG_4", "url": "http://matrixdb.univ-lyon1.fr/cgi-bin/current/newPort?type=biomolecule&value=GAG_4" } ], "reference": [ { "type": "PubMed", "id": "8780385", "url": "https://glygen.org/publication/PubMed/8780385" } ] }, { "title": "Global and local determinants for the kinetics of interleukin-4/interleukin-4 receptor alpha chain interaction. A biosensor study employing recombinant interleukin-4-binding protein.", "journal": "European journal of biochemistry", "date": "1996", "authors": "Shen BJ, Hage T, Sebald W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8797861", "url": "https://glygen.org/publication/PubMed/8797861" } ] }, { "title": "Requirements for interleukin-4-induced gene expression and functional characterization of Stat6.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Mikita T, Campbell D, Wu P, Williamson K, Schindler U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "8816495", "url": "https://glygen.org/publication/PubMed/8816495" } ] }, { "title": "Interaction between Gab1 and the c-Met receptor tyrosine kinase is responsible for epithelial morphogenesis.", "journal": "Nature", "date": "1996", "authors": "Weidner KM, Di Cesare S, Sachs M, Brinkmann V, Behrens J, Birchmeier W", "evidence": [ { "database": "Reactome", "id": "R-HSA-8851907", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8851907" } ], "reference": [ { "type": "PubMed", "id": "8906793", "url": "https://glygen.org/publication/PubMed/8906793" } ] }, { "title": "Identification of a novel RalGDS-related protein as a candidate effector for Ras and Rap1.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Peterson SN, Trabalzini L, Brtva TR, Fischer T, Altschuler DL, Martelli P, Lapetina EG, Der CJ, White GC 2nd", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "8939933", "url": "https://glygen.org/publication/PubMed/8939933" } ] }, { "title": "Cloning of the human IL-13R alpha1 chain and reconstitution with the IL4R alpha of a functional IL-4/IL-13 receptor complex.", "journal": "FEBS letters", "date": "1997", "authors": "Miloux B, Laurent P, Bonnin O, Lupker J, Caput D, Vita N, Ferrara P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9013879", "url": "https://glygen.org/publication/PubMed/9013879" } ] }, { "title": "Regulation of the urokinase-type plasminogen activator gene by the oncogene Tpr-Met involves GRB2.", "journal": "Oncogene", "date": "1997", "authors": "Besser D, Bardelli A, Didichenko S, Thelen M, Comoglio PM, Ponzetto C, Nagamine Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8851805", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8851805" } ], "reference": [ { "type": "PubMed", "id": "9038378", "url": "https://glygen.org/publication/PubMed/9038378" } ] }, { "title": "Hepatocyte growth factor activator inhibitor, a novel Kunitz-type serine protease inhibitor.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Shimomura T, Denda K, Kitamura A, Kawaguchi T, Kito M, Kondo J, Kagaya S, Qin L, Takata H, Miyazawa K, Kitamura N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6806942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6806942" } ], "reference": [ { "type": "PubMed", "id": "9045658", "url": "https://glygen.org/publication/PubMed/9045658" } ] }, { "title": "DDT stimulates c-erbB2, c-met, and STATS tyrosine phosphorylation, Grb2-Sos association, MAPK phosphorylation, and proliferation of human breast epithelial cells.", "journal": "Biochemical and biophysical research communications", "date": "1997", "authors": "Shen K, Novak RF", "evidence": [ { "database": "Reactome", "id": "R-HSA-8851805", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8851805" } ], "reference": [ { "type": "PubMed", "id": "9070211", "url": "https://glygen.org/publication/PubMed/9070211" } ] }, { "title": "Hepatocyte growth factor/scatter factor (HGF/SF) signals via the STAT3/APRF transcription factor in human hepatoma cells and hepatocytes.", "journal": "FEBS letters", "date": "1997", "authors": "Schaper F, Siewert E, Gomez-Lechon MJ, Gatsios P, Sachs M, Birchmeier W, Heinrich PC, Castell J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8875791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875791" } ], "reference": [ { "type": "PubMed", "id": "9094433", "url": "https://glygen.org/publication/PubMed/9094433" } ] }, { "title": "Germline and somatic mutations in the tyrosine kinase domain of the MET proto-oncogene in papillary renal carcinomas.", "journal": "Nature genetics", "date": "1997", "authors": "Schmidt L, Duh FM, Chen F, Kishida T, Glenn G, Choyke P, Scherer SW, Zhuang Z, Lubensky I, Dean M, Allikmets R, Chidambaram A, Bergerheim UR, Feltis JT, Casadevall C, Zamarron A, Bernues M, Richard S, Lips CJ, Walther MM, Tsui LC, Geil L, Orcutt ML, Stackhouse T, Lipan J, Slife L, Brauch H, Decker J, Niehans G, Hughson MD, Moch H, Storkel S, Lerman MI, Linehan WM, Zbar B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6806942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6806942" } ], "reference": [ { "type": "PubMed", "id": "9140397", "url": "https://glygen.org/publication/PubMed/9140397" } ] }, { "title": "Differential association of phosphatidylinositol 3-kinase with insulin receptor substrate (IRS)-1 and IRS-2 in human thymocytes in response to IL-7.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1997", "authors": "Sharfe N, Roifman CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "9233603", "url": "https://glygen.org/publication/PubMed/9233603" } ] }, { "title": "Purification and cloning of hepatocyte growth factor activator inhibitor type 2, a Kunitz-type serine protease inhibitor.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Kawaguchi T, Qin L, Shimomura T, Kondo J, Matsumoto K, Denda K, Kitamura N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6806942", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6806942" } ], "reference": [ { "type": "PubMed", "id": "9346890", "url": "https://glygen.org/publication/PubMed/9346890" } ] }, { "title": "IL-2 and IL-7 induce heterodimerization of STAT5 isoforms in human peripheral blood T lymphoblasts.", "journal": "Cellular immunology", "date": "1997", "authors": "Rosenthal LA, Winestock KD, Finbloom DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "9398404", "url": "https://glygen.org/publication/PubMed/9398404" } ] }, { "title": "SH2- and SH3-mediated interactions between focal adhesion kinase and Src.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Thomas JW, Ellis B, Boerner RJ, Knight WB, White GC 2nd, Schaller MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874081", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081" } ], "reference": [ { "type": "PubMed", "id": "9417118", "url": "https://glygen.org/publication/PubMed/9417118" } ] }, { "title": "Induction of epithelial tubules by growth factor HGF depends on the STAT pathway.", "journal": "Nature", "date": "1998", "authors": "Boccaccio C, Ando M, Tamagnone L, Bardelli A, Michieli P, Battistini C, Comoglio PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-8875791", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875791" } ], "reference": [ { "type": "PubMed", "id": "9440692", "url": "https://glygen.org/publication/PubMed/9440692" } ] }, { "title": "The solution structure of the N-terminal domain of hepatocyte growth factor reveals a potential heparin-binding site.", "journal": "Structure", "date": "1998", "authors": "Zhou H, Mazzulla M J, Kaufman J D, Stahl S J, Wingfield P T, Rubin J S, Bottaro D P, Byrd R A", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "reference": [ { "type": "PubMed", "id": "9493272", "url": "https://glygen.org/publication/PubMed/9493272" } ] }, { "title": "Delineation of the regions of interleukin-2 (IL-2) receptor beta chain important for association of Jak1 and Jak3. Jak1-independent functional recruitment of Jak3 to Il-2Rbeta.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Zhu MH, Berry JA, Russell SM, Leonard WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "9553136", "url": "https://glygen.org/publication/PubMed/9553136" } ] }, { "title": "Phosphorylation of the MAP kinase ERK2 promotes its homodimerization and nuclear translocation.", "journal": "Cell", "date": "1998", "authors": "Khokhlatchev AV, Canagarajah B, Wilsbacher J, Robinson M, Atkinson M, Goldsmith E, Cobb MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "9604935", "url": "https://glygen.org/publication/PubMed/9604935" } ] }, { "title": "Mutational analysis of the STAT6 SH2 domain.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Mikita T, Daniel C, Wu P, Schindler U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9651359", "url": "https://glygen.org/publication/PubMed/9651359" } ] }, { "title": "Characterization of cytokine differential induction of STAT complexes in primary human T and NK cells.", "journal": "Journal of leukocyte biology", "date": "1998", "authors": "Yu CR, Young HA, Ortaldo JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "9715265", "url": "https://glygen.org/publication/PubMed/9715265" } ] }, { "title": "The role of IL-13 and its receptor in allergy and inflammatory responses.", "journal": "The Journal of allergy and clinical immunology", "date": "1998", "authors": "de Vries JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9723655", "url": "https://glygen.org/publication/PubMed/9723655" } ] }, { "title": "Interferon-gamma-induced factor binding to the interleukin-4-responsive element of CD23b promoter in human tonsillar mononuclear cells: role in transient up-regulation of the interleukin-4-induced CD23b mRNA.", "journal": "Molecular immunology", "date": "1998", "authors": "Park HJ, So EY, Lee CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9736340", "url": "https://glygen.org/publication/PubMed/9736340" } ] }, { "title": "Phosphoinositide-3-OH kinase-dependent regulation of glycogen synthase kinase 3 and protein kinase B/AKT by the integrin-linked kinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Delcommenne M, Tan C, Gray V, Rue L, Woodgett J, Dedhar S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "9736715", "url": "https://glygen.org/publication/PubMed/9736715" } ] }, { "title": "Crystal structure of the NK1 fragment of human hepatocyte growth factor at 2.0-A resolution.", "journal": "Structure", "date": "1998", "authors": "Ultsch M, Lokker N A, Godowski P J, de Vos A M", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "reference": [ { "type": "PubMed", "id": "9817840", "url": "https://glygen.org/publication/PubMed/9817840" } ] }, { "title": "Induction of 15-lipoxygenase expression by IL-13 requires tyrosine phosphorylation of Jak2 and Tyk2 in human monocytes.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Roy B, Cathcart MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9822675", "url": "https://glygen.org/publication/PubMed/9822675" } ] }, { "title": "STAT3 is required for the gp130-mediated full activation of the c-myc gene.", "journal": "The Journal of experimental medicine", "date": "1999", "authors": "Kiuchi N, Nakajima K, Ichiba M, Fukada T, Narimatsu M, Mizuno K, Hibi M, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6785807", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807" } ], "reference": [ { "type": "PubMed", "id": "9874564", "url": "https://glygen.org/publication/PubMed/9874564" } ] }, { "title": "Role of phosphatidylinositol 3,4,5-trisphosphate in regulating the activity and localization of 3-phosphoinositide-dependent protein kinase-1.", "journal": "The Biochemical journal", "date": "1999", "authors": "Currie RA, Walker KS, Gray A, Deak M, Casamayor A, Downes CP, Cohen P, Alessi DR, Lucocq J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "9895304", "url": "https://glygen.org/publication/PubMed/9895304" } ] }, { "title": "Nuclear translocation of p42/p44 mitogen-activated protein kinase is required for growth factor-induced gene expression and cell cycle entry.", "journal": "The EMBO journal", "date": "1999", "authors": "Brunet A, Roux D, Lenormand P, Dowd S, Keyse S, Pouyssegur J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001" } ], "reference": [ { "type": "PubMed", "id": "9927426", "url": "https://glygen.org/publication/PubMed/9927426" } ] } ], "pathway": [ { "id": "hsa:3082", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3082", "resource": "KEGG Pathway" }, { "id": "R-HSA-114608", "name": "Platelet degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "resource": "Reactome", "description": "Platelet degranulation" }, { "id": "R-HSA-1257604", "name": "PIP3 activates AKT signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604", "resource": "Reactome", "description": "PIP3 activates AKT signaling" }, { "id": "R-HSA-1266695", "name": "Interleukin-7 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695", "resource": "Reactome", "description": "Interleukin-7 signaling" }, { "id": "R-HSA-2219530", "name": "Constitutive Signaling by Aberrant PI3K in Cancer", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530", "resource": "Reactome", "description": "Constitutive Signaling by Aberrant PI3K in Cancer" }, { "id": "R-HSA-5673001", "name": "RAF/MAP kinase cascade", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001", "resource": "Reactome", "description": "RAF/MAP kinase cascade" }, { "id": "R-HSA-6785807", "name": "Interleukin-4 and Interleukin-13 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6785807", "resource": "Reactome", "description": "Interleukin-4 and Interleukin-13 signaling" }, { "id": "R-HSA-6806942", "name": "MET Receptor Activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6806942", "resource": "Reactome", "description": "MET Receptor Activation" }, { "id": "R-HSA-6807004", "name": "Negative regulation of MET activity", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807004", "resource": "Reactome", "description": "Negative regulation of MET activity" }, { "id": "R-HSA-6811558", "name": "PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811558", "resource": "Reactome", "description": "PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling" }, { "id": "R-HSA-8851805", "name": "MET activates RAS signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8851805", "resource": "Reactome", "description": "MET activates RAS signaling" }, { "id": "R-HSA-8851907", "name": "MET activates PI3K/AKT signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8851907", "resource": "Reactome", "description": "MET activates PI3K/AKT signaling" }, { "id": "R-HSA-8865999", "name": "MET activates PTPN11", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8865999", "resource": "Reactome", "description": "MET activates PTPN11" }, { "id": "R-HSA-8874081", "name": "MET activates PTK2 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874081", "resource": "Reactome", "description": "MET activates PTK2 signaling" }, { "id": "R-HSA-8875513", "name": "MET interacts with TNS proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875513", "resource": "Reactome", "description": "MET interacts with TNS proteins" }, { "id": "R-HSA-8875555", "name": "MET activates RAP1 and RAC1", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875555", "resource": "Reactome", "description": "MET activates RAP1 and RAC1" }, { "id": "R-HSA-8875656", "name": "MET receptor recycling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875656", "resource": "Reactome", "description": "MET receptor recycling" }, { "id": "R-HSA-8875791", "name": "MET activates STAT3", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8875791", "resource": "Reactome", "description": "MET activates STAT3" }, { "id": "R-HSA-9734091", "name": "Drug-mediated inhibition of MET activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9734091", "resource": "Reactome", "description": "Drug-mediated inhibition of MET activation" } ], "orthologs": [ { "uniprot_canonical_ac": "P17945-1", "protein_name": "Hepatocyte growth factor", "gene_name": "Hgf", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MMWGTKLLPVLLLQHVLLHLLLLPVTIPYAEGQKKRRNTLHEFKKSAKTTLTKEDPLVKIKTKKVNSADECANRCIRNKGFPFTCKAFVFDKSRKRCYWYPFNSMSSGVKKGFGHEFDLYENKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKTCQRWDQQTPHRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSAVNETDVPMETTECIKGQGEGYRGTTNTIWNGIPCQRWDSQYPHKHDITPENFKCKDLRENYCRNPDGAESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNMEDLHRHIFWEPDASKLTKNYCRNPDDDAHGPWCYTGNPLVPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTQTTVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPARNKDLKDYEAWLGIHDVHERGEEKRKQILNISQLVYGPEGSDLVLLKLARPAILDNFVSTIDLPSYGCTIPEKTTCSIYGWGYTGLINADGLLRVAHLYIMGNEKCSQHHQGKVTLNESELCAGAEKIGSGPCEGDYGGPLICEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKVILTYKL", "length": 728 }, "evidence": [ { "id": "45919008", "url": "http://www.informatics.jax.org/homology/45919008", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q08048-1", "protein_name": "Hepatocyte growth factor", "gene_name": "Hgf", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MMWGTKLLPVLLLQHVLLHLLLLHVAIPYAEGQKKRRNTLHEFKKSAKTTLTKEDPLLKIKTKKVNSADECANRCIRNRGFTFTCKAFVFDKSRKRCYWYPFNSMSSGVKKGFGHEFDLYENKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKTCQRWDQQTPHRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKTCAHSAVNETDVPMETTECIQGQGEGYRGTSNTIWNGIPCQRWDSQYPHKHDITPENFKCKDLRENYCRNPDGAESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNMEDLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTQTTVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPARNKDLKDYEAWLGIHDVHERGEEKRKQILNISQLVYGPEGSDLVLLKLARPAILDNFVSTIDLPSYGCTIPEKTTCSIYGWGYTGLINADGLLRVAHLYIMGNEKCSQHHQGKVTLNESELCAGAEKIGSGPCEGDYGGPLICEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKVILTYKL", "length": 728 }, "evidence": [ { "id": "45919008", "url": "http://www.informatics.jax.org/homology/45919008", "database": "MGI" }, { "id": "P14210", "url": "https://omabrowser.org/oma/group/P14210/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 29, "go_terms": [ { "name": "regulation of p38MAPK cascade", "id": "GO:1900744", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900744", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "mitotic cell cycle", "id": "GO:0000278", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000278", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "liver development", "id": "GO:0001889", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001889", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "positive regulation of protein phosphorylation", "id": "GO:0001934", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001934", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "positive regulation of cell migration", "id": "GO:0030335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030335", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "positive regulation of MAPK cascade", "id": "GO:0043410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043410", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction", "id": "GO:0051897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051897", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "negative regulation of interleukin-6 production", "id": "GO:0032715", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032715", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "negative regulation of inflammatory response", "id": "GO:0050728", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050728", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "cell morphogenesis", "id": "GO:0000902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000902", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "negative regulation of autophagy", "id": "GO:0010507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010507", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "positive regulation of peptidyl-tyrosine phosphorylation", "id": "GO:0050731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050731", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "cell chemotaxis", "id": "GO:0060326", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060326", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "positive regulation of osteoblast differentiation", "id": "GO:0045669", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045669", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "epithelial to mesenchymal transition", "id": "GO:0001837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001837", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "negative regulation of release of cytochrome c from mitochondria", "id": "GO:0090201", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090201", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "positive regulation of DNA biosynthetic process", "id": "GO:2000573", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000573", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "negative regulation of extrinsic apoptotic signaling pathway via death domain receptors", "id": "GO:1902042", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902042", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "negative regulation of peptidyl-serine phosphorylation", "id": "GO:0033137", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033137", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "positive regulation of interleukin-10 production", "id": "GO:0032733", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032733", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "cellular response to hepatocyte growth factor stimulus", "id": "GO:0035729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035729", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "hepatocyte growth factor receptor signaling pathway", "id": "GO:0048012", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048012", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "myoblast proliferation", "id": "GO:0051450", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051450", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "epithelial cell proliferation", "id": "GO:0050673", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050673", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "regulation of branching involved in salivary gland morphogenesis by mesenchymal-epithelial signaling", "id": "GO:0060665", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060665", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "negative regulation of hydrogen peroxide-mediated programmed cell death", "id": "GO:1901299", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901299", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "skeletal muscle cell proliferation", "id": "GO:0014856", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014856", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "signaling receptor binding", "id": "GO:0005102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005102", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "chemoattractant activity", "id": "GO:0042056", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042056", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "growth factor activity", "id": "GO:0008083", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008083", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" }, { "name": "platelet alpha granule lumen", "id": "GO:0031093", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031093", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "hepatocyte growth factor N-glycosylated 1 (human)", "definition": "A hepatocyte growth factor (human) that has been N-glycosylated at the residue equivalent to Asn-294 of the amino acid sequence represented by UniProtKB:P14210-1, in which the glycan structure is represented by GlyTouCan:G17689DH. Example: UniProtKB:P14210-1, Asn-294, MOD:00160~GNO:G17689DH. [PRO:DNx, PMID:1482348, PMID:8407880]", "evidence": [ { "id": "PR:000055402", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055402" } ] }, { "name": "hepatocyte growth factor N-glycosylated 2 (human)", "definition": "A hepatocyte growth factor (human) that has been N-glycosylated at the residue equivalent to Asn-294 of the amino acid sequence represented by UniProtKB:P14210-1, in which the glycan structure is represented by GlyTouCan:G60542VK. Example: UniProtKB:P14210-1, Asn-294, MOD:00160~GNO:G60542VK. [PRO:DNx, PMID:1482348, PMID:8407880]", "evidence": [ { "id": "PR:000055403", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055403" } ] }, { "name": "hepatocyte growth factor N-glycosylated 3 (human)", "definition": "A hepatocyte growth factor (human) that has been N-glycosylated at the residue equivalent to Asn-294 of the amino acid sequence represented by UniProtKB:P14210-1, in which the glycan structure is represented by GlyTouCan:G77252PU. Example: UniProtKB:P14210-1, Asn-294, MOD:00160~GNO:G77252PU. [PRO:DNx, PMID:1482348, PMID:8407880]", "evidence": [ { "id": "PR:000055404", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055404" } ] }, { "name": "hepatocyte growth factor N-glycosylated 4 (human)", "definition": "A hepatocyte growth factor (human) that has been N-glycosylated at the residue equivalent to Asn-402 of the amino acid sequence represented by UniProtKB:P14210-1, in which the glycan structure is represented by GlyTouCan:G17689DH. Example: UniProtKB:P14210-1, Asn-402, MOD:00160~GNO:G17689DH. [PRO:DNx, PMID:1482348, PMID:8407880]", "evidence": [ { "id": "PR:000055405", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055405" } ] }, { "name": "hepatocyte growth factor N-glycosylated 5 (human)", "definition": "A hepatocyte growth factor (human) that has been N-glycosylated at the residue equivalent to Asn-402 of the amino acid sequence represented by UniProtKB:P14210-1, in which the glycan structure is represented by GlyTouCan:G77252PU. Example: UniProtKB:P14210-1, Asn-402, MOD:00160~GNO:G77252PU. [PRO:DNx, PMID:1482348, PMID:8407880]", "evidence": [ { "id": "PR:000055406", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055406" } ] }, { "name": "hepatocyte growth factor N-glycosylated 6 (human)", "definition": "A hepatocyte growth factor (human) that has been N-glycosylated at the residue equivalent to Asn-566 of the amino acid sequence represented by UniProtKB:P14210-1, in which the glycan structure is represented by GlyTouCan:G17689DH. Example: UniProtKB:P14210-1, Asn-566, MOD:00160~GNO:G17689DH. [PRO:DNx, PMID:1482348, PMID:8407880]", "evidence": [ { "id": "PR:000055407", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055407" } ] }, { "name": "hepatocyte growth factor N-glycosylated 7 (human)", "definition": "A hepatocyte growth factor (human) that has been N-glycosylated at the residue equivalent to Asn-566 of the amino acid sequence represented by UniProtKB:P14210-1, in which the glycan structure is represented by GlyTouCan:G77252PU. Example: UniProtKB:P14210-1, Asn-566, MOD:00160~GNO:G77252PU. [PRO:DNx, PMID:1482348, PMID:8407880]", "evidence": [ { "id": "PR:000055408", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055408" } ] }, { "name": "hepatocyte growth factor N-glycosylated 8 (human)", "definition": "A hepatocyte growth factor (human) that has been N-glycosylated at the residue equivalent to Asn-653 of the amino acid sequence represented by UniProtKB:P14210-1, in which the glycan structure is represented by GlyTouCan:G17689DH. Example: UniProtKB:P14210-1, Asn-653, MOD:00160~GNO:G17689DH. [PRO:DNx, PMID:1482348, PMID:8407880]", "evidence": [ { "id": "PR:000055409", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055409" } ] }, { "name": "hepatocyte growth factor N-glycosylated 9 (human)", "definition": "A hepatocyte growth factor (human) that has been N-glycosylated at the residue equivalent to Asn-653 of the amino acid sequence represented by UniProtKB:P14210-1, in which the glycan structure is represented by GlyTouCan:G77252PU. Example: UniProtKB:P14210-1, Asn-653, MOD:00160~GNO:G77252PU. [PRO:DNx, PMID:1482348, PMID:8407880]", "evidence": [ { "id": "PR:000055410", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055410" } ] } ], "site_annotation": [ { "start_pos": 294, "end_pos": 296, "annotation": "n_glycosylation_sequon" }, { "start_pos": 402, "end_pos": 404, "annotation": "n_glycosylation_sequon" }, { "start_pos": 566, "end_pos": 568, "annotation": "n_glycosylation_sequon" }, { "start_pos": 653, "end_pos": 655, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "The single-chain precursor undergoes proteolytic processing by TMPRSS13 resulting in an active two-chain form.", "evidence": [ { "database": "UniProtKB", "id": "P14210", "url": "https://www.uniprot.org/uniprot/P14210" }, { "database": "PubMed", "id": "20977675", "url": "https://glygen.org/publication/PubMed/20977675" } ] } ], "interactions": [ { "interactor_id": "G19059PI", "interaction_name": "matrixdb:Chondroitin Sulfate A(short label)", "interaction_type": "Glycosaminoglycan", "evidence": [ { "database": "MatrixDB", "id": "GAG_4", "url": "http://matrixdb.univ-lyon1.fr/cgi-bin/current/newPort?type=biomolecule&value=GAG_4" }, { "database": "PubMed", "id": "8780385", "url": "https://glygen.org/publication/PubMed/8780385" } ] } ], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [ { "assessed_biomarker_entity": "Hepatocyte growth factor (HGF)", "biomarker_id": "A0078", "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "16759302", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16759302" } ], "instances": [ { "best_biomarker_type": "prognostic", "status": "increased HGF level", "disease": { "disease_id": "DOID:0080600", "recommended_name": { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "COVID-19", "description": "A Coronavirus infection that is characterized by fever, cough and shortness of breath and that has_material_basis_in SARS-CoV-2." }, "synonyms": [ { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "2019 Novel Coronavirus (2019-nCoV)", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "2019-nCoV infection", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "Wuhan coronavirus infection", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "Wuhan seafood market pneumonia virus infection", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "COVID19", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "SARS-CoV-2 infection", "description": "" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "10.1101/2020.05.31.20118315", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1101/2020.05.31.20118315" } ] }, { "best_biomarker_type": "prognostic", "status": "increased HGF level", "disease": { "disease_id": "DOID:9351", "recommended_name": { "id": "DOID:9351", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9351", "name": "diabetes mellitus", "description": "A glucose metabolism disease that is characterized by chronic hyperglycaemia with disturbances of carbohydrate, fat and protein metabolism resulting from defects in insulin secretion, insulin action, or both." }, "synonyms": [ { "id": "DOID:9351", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9351", "name": "diabetes", "description": "" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "16759302", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16759302" } ] } ] } ], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 294, 402, 566, 653 ], "o_linked_sites": [ 476 ], "snv_sites": [ 43, 67, 104, 137, 178, 294, 296, 384, 400, 402, 438, 476, 655 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 294, "end_pos": 296 }, { "start_pos": 402, "end_pos": 404 }, { "start_pos": 566, "end_pos": 568 }, { "start_pos": 653, "end_pos": 655 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 58 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 14 }, { "field": "n_linked_glycan_sites", "count": 8 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 53 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 14 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 15 }, { "field": "total_sites", "count": 13 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 11 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 361 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }