{ "uniprot_canonical_ac": "P14196-1", "uniprot_ac": "P14196", "uniprot_id": "AAC2_DICDI", "mass": { "chemical_mass": 50619.0, "monoisotopic_mass": 50619.0 }, "refseq": { "ac": "XP_639980", "name": "HMG-I and HMG-Y, DNA-binding domain-containing protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_639980" }, "gene_names": [ { "name": "AAC11", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P14196", "id": "P14196" }, { "name": "DDB_G0284871", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P14196", "id": "P14196" } ], "protein_names": [ { "name": "AAC-rich mRNA clone AAC11 protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P14196" }, { "name": "HMG-I and HMG-Y, DNA-binding domain-containing protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_639980", "id": "XP_639980" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "P14196", "url": "https://www.uniprot.org/uniprot/P14196" } ], "common_name": "Cellular slime molds" } ], "gene": [ { "name": "AAC11", "url": "https://www.uniprot.org/uniprot/P14196", "locus": {} } ], "crossref": [ { "id": "DDB_G0284871", "url": "http://dictybase.org/gene/DDB_G0284871", "database": "dictyBase", "categories": [ "Organism-specific" ] }, { "id": "8624893", "url": "https://www.ncbi.nlm.nih.gov/gene/8624893", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000116", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000116", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017956", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017956", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0284871", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0284871", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NANNRRM", "url": "https://omabrowser.org/oma/group/NANNRRM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PF02178", "url": "http://pfam.xfam.org/family/PF02178", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P14196", "url": "http://purl.obolibrary.org/obo/PR_P14196", "database": "PRO", "categories": [ "Protein" ] }, { "id": "XP_639980", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_639980", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P14196", "url": "https://www.uniprot.org/uniprot/P14196", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P14196-1", "url": "https://www.uniprot.org/uniprot/P14196-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSTPTLPNLSQLHGIQNQSLQQQQQQQPQQQQQPQQQQQQQQPQQTMQQPIQNLHQQAPQMQQPQYNLHTTLPPPLMNPNGLGLMGHNMMGGGNNGNNSGNNNGQPQMHGTNLNGLSLAIQNQSSLPQPINNNNNNNNNNSNINNNNNNSNNNNNNNNSNLGINSSPTQSSANSADKRSRGRPRKNPPSEPKDTSGPKRKRGRPPKMDEEGNPQPKPVPQPGSNKKRGRPKKPKDENESDYNNTSFSDSNTDGTPKKRGRPPKAKGDSPSASPTHNTLGNGILNSNNNNNNNNNNSNINNINNNNNNNSNNNNNSSNNNNNNNNSTNNNTNNNNNNTNNNTNNNNNNINNNNNNTNNNNNNANNQNTNNNNMGNNSNNNNNPNNNNHQNNNNNNTSNNSNTTTATTTAPGGNNLTNSLNNAGNLGNLGRVSGLHSSDPNNPNAQKSFPDSTNTMDFQPNFSFFH", "length": 464, "header": "sp|P14196-1|AAC2_DICDI Isoform 1 of AAC-rich mRNA clone AAC11 protein OS=Dictyostelium discoideum OX=44689 GN=AAC11 PE=2 SV=2 CANONICAL=P14196-1" }, "isoforms": [ { "isoform_ac": "P14196-1", "url": "", "sequence": { "sequence": "MSTPTLPNLSQLHGIQNQSLQQQQQQQPQQQQQPQQQQQQQQPQQTMQQPIQNLHQQAPQMQQPQYNLHTTLPPPLMNPNGLGLMGHNMMGGGNNGNNSGNNNGQPQMHGTNLNGLSLAIQNQSSLPQPINNNNNNNNNNSNINNNNNNSNNNNNNNNSNLGINSSPTQSSANSADKRSRGRPRKNPPSEPKDTSGPKRKRGRPPKMDEEGNPQPKPVPQPGSNKKRGRPKKPKDENESDYNNTSFSDSNTDGTPKKRGRPPKAKGDSPSASPTHNTLGNGILNSNNNNNNNNNNSNINNINNNNNNNSNNNNNSSNNNNNNNNSTNNNTNNNNNNTNNNTNNNNNNINNNNNNTNNNNNNANNQNTNNNNMGNNSNNNNNPNNNNHQNNNNNNTSNNSNTTTATTTAPGGNNLTNSLNNAGNLGNLGRVSGLHSSDPNNPNAQKSFPDSTNTMDFQPNFSFFH", "length": 464, "header": "sp|P14196-1|AAC2_DICDI Isoform 1 of AAC-rich mRNA clone AAC11 protein OS=Dictyostelium discoideum OX=44689 GN=AAC11 PE=2 SV=2 CANONICAL=P14196-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Eichinger L, Pachebat J A, Gl\u00f6ckner G, Rajandream M-A, Sucgang R, Berriman M, Song J, Olsen R, Szafranski K, Xu Q, Tunggal B, Kummerfeld S, Madera M, Konfortov B A, Rivero F, Bankier A T, Lehmann R, Hamlin N, Davies R, Gaudet P, Fey P, Pilcher K, Chen G, Saunders D, Sodergren E, Davis P, Kerhornou A, Nie X, Hall N, Anjard C, Hemphill L, Bason N, Farbrother P, Desany B, Just E, Morio T, Rost R, Churcher C, Cooper J, Haydock S, van Driessche N, Cronin A, Goodhead I, Muzny D, Mourier T, Pain A, Lu M, Harper D, Lindsay R, Hauser H, James K, Quiles M, Madan Babu M, Saito T, Buchrieser C, Wardroper A, Felder M, Thangavelu M, Johnson D, Knights A, Loulseged H, Mungall K, Oliver K, Price C, Quail M A, Urushihara H, Hernandez J, Rabbinowitsch E, Steffen D, Sanders M, Ma J, Kohara Y, Sharp S, Simmonds M, Spiegler S, Tivey A, Sugano S, White B, Walker D, Woodward J, Winckler T, Tanaka Y, Shaulsky G, Schleicher M, Weinstock G, Rosenthal A, Cox E C, Chisholm R L, Gibbs R, Loomis W F, Platzer M, Kay R R, Williams J, Dear P H, Noegel A A, Barrell B, Kuspa A", "evidence": [ { "database": "UniProtKB", "id": "P14196", "url": "https://www.uniprot.org/uniprot/P14196" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] }, { "title": "Nucleotide sequences of Dictyostelium discoideum developmentally regulated cDNAs rich in (AAC) imply proteins that contain clusters of asparagine, glutamine, or threonine.", "journal": "Mol. Gen. Genet.", "date": "1989", "authors": "Shaw D R, Richter H, Giorda R, Ohmachi T, Ennis H L", "evidence": [ { "database": "UniProtKB", "id": "P14196", "url": "https://www.uniprot.org/uniprot/P14196" } ], "reference": [ { "type": "PubMed", "id": "2511421", "url": "https://glygen.org/publication/PubMed/2511421" } ] } ], "pathway": [ { "id": "ddi:DDB_G0284871", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0284871", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "P14196", "url": "https://www.uniprot.org/uniprot/P14196" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P14196", "url": "https://www.uniprot.org/uniprot/P14196" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "P14196", "url": "https://www.uniprot.org/uniprot/P14196" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "regulation of DNA-templated transcription", "id": "GO:0006355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355", "evidence": [ { "database": "UniProtKB", "id": "P14196", "url": "https://www.uniprot.org/uniprot/P14196" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 122, "end_pos": 124, "annotation": "n_glycosylation_sequon" }, { "start_pos": 139, "end_pos": 141, "annotation": "n_glycosylation_sequon" }, { "start_pos": 148, "end_pos": 150, "annotation": "n_glycosylation_sequon" }, { "start_pos": 157, "end_pos": 159, "annotation": "n_glycosylation_sequon" }, { "start_pos": 164, "end_pos": 166, "annotation": "n_glycosylation_sequon" }, { "start_pos": 17, "end_pos": 19, "annotation": "n_glycosylation_sequon" }, { "start_pos": 237, "end_pos": 239, "annotation": "n_glycosylation_sequon" }, { "start_pos": 242, "end_pos": 244, "annotation": "n_glycosylation_sequon" }, { "start_pos": 243, "end_pos": 245, "annotation": "n_glycosylation_sequon" }, { "start_pos": 294, "end_pos": 296, "annotation": "n_glycosylation_sequon" }, { "start_pos": 307, "end_pos": 309, "annotation": "n_glycosylation_sequon" }, { "start_pos": 313, "end_pos": 315, "annotation": "n_glycosylation_sequon" }, { "start_pos": 314, "end_pos": 316, "annotation": "n_glycosylation_sequon" }, { "start_pos": 323, "end_pos": 325, "annotation": "n_glycosylation_sequon" }, { "start_pos": 324, "end_pos": 326, "annotation": "n_glycosylation_sequon" }, { "start_pos": 328, "end_pos": 330, "annotation": "n_glycosylation_sequon" }, { "start_pos": 335, "end_pos": 337, "annotation": "n_glycosylation_sequon" }, { "start_pos": 339, "end_pos": 341, "annotation": "n_glycosylation_sequon" }, { "start_pos": 353, "end_pos": 355, "annotation": "n_glycosylation_sequon" }, { "start_pos": 374, "end_pos": 376, "annotation": "n_glycosylation_sequon" }, { "start_pos": 393, "end_pos": 395, "annotation": "n_glycosylation_sequon" }, { "start_pos": 394, "end_pos": 396, "annotation": "n_glycosylation_sequon" }, { "start_pos": 397, "end_pos": 399, "annotation": "n_glycosylation_sequon" }, { "start_pos": 400, "end_pos": 402, "annotation": "n_glycosylation_sequon" }, { "start_pos": 413, "end_pos": 415, "annotation": "n_glycosylation_sequon" }, { "start_pos": 459, "end_pos": 461, "annotation": "n_glycosylation_sequon" }, { "start_pos": 8, "end_pos": 10, "annotation": "n_glycosylation_sequon" }, { "start_pos": 97, "end_pos": 99, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 122, "end_pos": 124 }, { "start_pos": 139, "end_pos": 141 }, { "start_pos": 148, "end_pos": 150 }, { "start_pos": 157, "end_pos": 159 }, { "start_pos": 164, "end_pos": 166 }, { "start_pos": 17, "end_pos": 19 }, { "start_pos": 237, "end_pos": 239 }, { "start_pos": 242, "end_pos": 244 }, { "start_pos": 243, "end_pos": 245 }, { "start_pos": 294, "end_pos": 296 }, { "start_pos": 307, "end_pos": 309 }, { "start_pos": 313, "end_pos": 315 }, { "start_pos": 314, "end_pos": 316 }, { "start_pos": 323, "end_pos": 325 }, { "start_pos": 324, "end_pos": 326 }, { "start_pos": 328, "end_pos": 330 }, { "start_pos": 335, "end_pos": 337 }, { "start_pos": 339, "end_pos": 341 }, { "start_pos": 353, "end_pos": 355 }, { "start_pos": 374, "end_pos": 376 }, { "start_pos": 393, "end_pos": 395 }, { "start_pos": 394, "end_pos": 396 }, { "start_pos": 397, "end_pos": 399 }, { "start_pos": 400, "end_pos": 402 }, { "start_pos": 413, "end_pos": 415 }, { "start_pos": 459, "end_pos": 461 }, { "start_pos": 8, "end_pos": 10 }, { "start_pos": 97, "end_pos": 99 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }