{ "uniprot_canonical_ac": "P14174-1", "uniprot_ac": "P14174", "uniprot_id": "MIF_HUMAN", "mass": { "chemical_mass": 12476.0, "monoisotopic_mass": 12476.0 }, "refseq": { "ac": "NP_002406", "name": "macrophage migration inhibitory factor", "summary": "This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002406" }, "gene_names": [ { "name": "MIF", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P14174", "id": "P14174" }, { "name": "GIF; GLIF; MMIF", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002406", "id": "NP_002406" }, { "name": "GLIF", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P14174", "id": "P14174" }, { "name": "MIF", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002406", "id": "NP_002406" }, { "name": "MMIF", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P14174", "id": "P14174" } ], "protein_names": [ { "name": "Macrophage migration inhibitory factor", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P14174" }, { "name": "5.3.2.1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P14174" }, { "name": "5.3.3.12", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P14174" }, { "name": "GIF", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P14174" }, { "name": "Glycosylation-inhibiting factor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P14174" }, { "name": "L-dopachrome isomerase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P14174" }, { "name": "L-dopachrome tautomerase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P14174" }, { "name": "MIF", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P14174" }, { "name": "Phenylpyruvate tautomerase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P14174" }, { "name": "macrophage migration inhibitory factor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002406", "id": "NP_002406" }, { "name": "phenylpyruvate tautomerase; L-dopachrome isomerase; L-dopachrome tautomerase; macrophage migration inhibitory factor (glycosylation-inhibiting factor); epididymis secretory sperm binding protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002406", "id": "NP_002406" } ], "function": [ { "annotation": "Macrophage migration inhibitory factor reversed senescent phenotype in human chondrocytes in vitro. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_002406", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002406" }, { "database": "PubMed", "id": "38245877", "url": "https://glygen.org/publication/PubMed/38245877" } ] }, { "annotation": "Macrophage migration inhibitory factor: A noval biomarker upregulates in myasthenia gravis and correlates with disease severity and relapse.", "evidence": [ { "database": "RefSeq", "id": "NP_002406", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002406" }, { "database": "PubMed", "id": "38159470", "url": "https://glygen.org/publication/PubMed/38159470" } ] }, { "annotation": "Obesity-related Plasma CXCL10 Drives CX3CR1-dependent Monocytic Secretion of Macrophage Migration Inhibitory Factor.", "evidence": [ { "database": "RefSeq", "id": "NP_002406", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002406" }, { "database": "PubMed", "id": "38175171", "url": "https://glygen.org/publication/PubMed/38175171" } ] }, { "annotation": "Pro-inflammatory cytokine involved in the innate immune response to bacterial pathogens (PubMed:15908412, PubMed:17443469, PubMed:23776208). The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense (PubMed:15908412, PubMed:17443469, PubMed:23776208). Counteracts the anti-inflammatory activity of glucocorticoids (PubMed:15908412, PubMed:17443469, PubMed:23776208). Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known (PubMed:11439086, PubMed:17526494). It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity (PubMed:11439086, PubMed:17526494).", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174#function" }, { "database": "PubMed", "id": "17443469", "url": "https://glygen.org/publication/PubMed/17443469" }, { "database": "PubMed", "id": "23776208", "url": "https://glygen.org/publication/PubMed/23776208" }, { "database": "PubMed", "id": "11439086", "url": "https://glygen.org/publication/PubMed/11439086" }, { "database": "PubMed", "id": "17526494", "url": "https://glygen.org/publication/PubMed/17526494" }, { "database": "PubMed", "id": "15908412", "url": "https://glygen.org/publication/PubMed/15908412" } ] }, { "annotation": "Serum macrophage migration inhibitory factor levels predict brain atrophy in people with primary progressive multiple sclerosis.", "evidence": [ { "database": "RefSeq", "id": "NP_002406", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002406" }, { "database": "PubMed", "id": "37982154", "url": "https://glygen.org/publication/PubMed/37982154" } ] }, { "annotation": "This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_002406", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002406" } ] } ], "disease": [ { "disease_id": "DOID:676", "recommended_name": { "id": "DOID:676", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:676", "name": "juvenile rheumatoid arthritis", "description": "A rheumatoid arthritis that involves an autoimmune disease onset in children under 16 which attacks the healthy cells and tissue of located_in joint." }, "synonyms": [ { "id": "DOID:676", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:676", "name": "Pauciarticular onset juvenile chronic arthritis", "description": "" }, { "id": "DOID:676", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:676", "name": "acute juvenile rheumatoid arthritis", "description": "" }, { "id": "DOID:676", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:676", "name": "juvenile chronic polyarthritis", "description": "" }, { "id": "DOID:676", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:676", "name": "juvenile idiopathic arthritis", "description": "" }, { "id": "DOID:676", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:676", "name": "monarticular juvenile rheumatoid arthritis", "description": "" }, { "id": "DOID:676", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:676", "name": "pauciarticular juvenile arthritis", "description": "" }, { "id": "DOID:676", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:676", "name": "systemic juvenile rheumatoid arthritis", "description": "" }, { "id": "DOID:676", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:676", "name": "Still's disease", "description": "" }, { "id": "MONDO:0011429", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011429", "name": "juvenile idiopathic arthritis", "description": "Juvenile idiopathic arthritis (JIA) is the term used to describe a group of inflammatory articular disorders of unknown cause that begin before the age of 16 and last over 6 weeks. The term juvenile idiopathic arthritis was chosen to signify the absence of any known mechanism underlying the disorder and to highlight the necessity of excluding other types of arthritis occurring in well defined diseases (in particular arthritis occurring in association with infectious, inflammatory and haematooncologic diseases)." }, { "id": "MONDO:0011429", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011429", "name": "JIA", "description": "" }, { "id": "MONDO:0011429", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011429", "name": "Juvenile idiopathic arthritis", "description": "" }, { "id": "MONDO:0011429", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011429", "name": "juvenile idiopathic arthritis", "description": "" }, { "id": "MONDO:0011429", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011429", "name": "juvenile rheumatoid arthritis", "description": "" }, { "id": "MONDO:0011429", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011429", "name": "rheumatoid arthritis, systemic juvenile, susceptibility to", "description": "" }, { "id": "MONDO:0011429", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011429", "name": "acute juvenile rheumatoid arthritis", "description": "" }, { "id": "MONDO:0011429", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011429", "name": "monarticular juvenile rheumatoid arthritis", "description": "" }, { "id": "MONDO:0011429", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011429", "name": "pauciarticular juvenile arthritis", "description": "" }, { "id": "MONDO:0011429", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011429", "name": "pauciarticular onset juvenile chronic arthritis", "description": "" }, { "id": "MONDO:0011429", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011429", "name": "systemic juvenile rheumatoid arthritis", "description": "" }, { "id": "MONDO:0011429", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011429", "name": "juvenile chronic arthritis", "description": "" }, { "id": "MONDO:0011429", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011429", "name": "juvenile chronic polyarthritis", "description": "" }, { "id": "MONDO:0011429", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011429", "name": "rheumatoid arthritis, systemic juvenile", "description": "" }, { "id": "MIM:604302", "resource": "MIM", "url": "https://www.omim.org/entry/604302", "name": "Rheumatoid arthritis systemic juvenile", "description": "Rheumatoid arthritis systemic juvenile" } ], "evidence": [ { "id": "604302", "database": "MIM", "url": "https://www.omim.org/entry/604302" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 111, "end_pos": 111, "sequence_org": "N", "sequence_mut": "C", "comment": "Causes formation of interchain disulfide bonds with Cys-81 from another subunit.", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" }, { "database": "PubMed", "id": "23776208", "url": "https://glygen.org/publication/PubMed/23776208" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "99.65", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000240972", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240972" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "98.68", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000240972", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240972" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "98.86", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000240972", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240972" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "93.69", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000240972", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240972" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "99.06", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000240972", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240972" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "99.38", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000240972", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240972" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "98.42", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000240972", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240972" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "99.57", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000240972", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240972" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "98.83", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000240972", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240972" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P14174", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14174" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P14174", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14174" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P14174", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14174" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P14174", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14174" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P14174", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14174" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P14174", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14174" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P14174", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14174" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P14174", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14174" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P14174", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14174" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P14174", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14174" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P14174", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14174" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P14174", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14174" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "common_name": "Human" } ], "gene": [ { "name": "MIF", "url": "https://www.uniprot.org/uniprot/P14174", "locus": { "chromosome": "HSCHR22_1_CTG7", "start_pos": 131589, "end_pos": 130366, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000276701", "url": "https://www.ensembl.org/id/ENSG00000276701" } ] } } ], "crossref": [ { "id": "ENSG00000240972", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000240972", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "5.3.2.1", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=5.3.2.1&UniProtAcc=P14174", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "5.3.3.12", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=5.3.3.12&UniProtAcc=P14174", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "CHEMBL2085", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2085", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "MIF", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=MIF", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "4282", "url": "https://www.ncbi.nlm.nih.gov/gene/4282", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "7097", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=7097", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P14174", "url": "https://www.ebi.ac.uk/intact/interactors/id:P14174*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001398", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001398", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014347", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014347", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019829", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019829", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:4282", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4282", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "153620", "url": "http://www.omim.org/entry/153620", "database": "MIM", "categories": [ "Other" ] }, { "id": "604302", "url": "http://www.omim.org/entry/604302", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P14174", "url": "https://www.nextprot.org/entry/NX_P14174", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P14174", "url": "https://oglcnac.org/atlas/detail/P14174", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P14174", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P14174", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "YINFFDM", "url": "https://omabrowser.org/oma/group/YINFFDM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "296050at2759", "url": "http://www.orthodb.org/?query=296050at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11954", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11954", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11954:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11954:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1CA7", "url": "https://www.rcsb.org/structure/1CA7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1CGQ", "url": "https://www.rcsb.org/structure/1CGQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1GCZ", "url": "https://www.rcsb.org/structure/1GCZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1GD0", "url": "https://www.rcsb.org/structure/1GD0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1GIF", "url": "https://www.rcsb.org/structure/1GIF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1LJT", "url": "https://www.rcsb.org/structure/1LJT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1MIF", "url": "https://www.rcsb.org/structure/1MIF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1P1G", "url": "https://www.rcsb.org/structure/1P1G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2OOH", "url": "https://www.rcsb.org/structure/2OOH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2OOW", "url": "https://www.rcsb.org/structure/2OOW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2OOZ", "url": "https://www.rcsb.org/structure/2OOZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3B9S", "url": "https://www.rcsb.org/structure/3B9S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3CE4", "url": "https://www.rcsb.org/structure/3CE4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3DJH", "url": "https://www.rcsb.org/structure/3DJH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3DJI", "url": "https://www.rcsb.org/structure/3DJI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3HOF", "url": "https://www.rcsb.org/structure/3HOF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3IJG", "url": "https://www.rcsb.org/structure/3IJG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3IJJ", "url": "https://www.rcsb.org/structure/3IJJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3JSF", "url": "https://www.rcsb.org/structure/3JSF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3JSG", "url": "https://www.rcsb.org/structure/3JSG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3JTU", "url": "https://www.rcsb.org/structure/3JTU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3L5P", "url": "https://www.rcsb.org/structure/3L5P", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3L5R", "url": "https://www.rcsb.org/structure/3L5R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3L5S", "url": "https://www.rcsb.org/structure/3L5S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3L5T", "url": "https://www.rcsb.org/structure/3L5T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3L5U", "url": "https://www.rcsb.org/structure/3L5U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3L5V", "url": "https://www.rcsb.org/structure/3L5V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SMB", "url": "https://www.rcsb.org/structure/3SMB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SMC", "url": "https://www.rcsb.org/structure/3SMC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3U18", "url": "https://www.rcsb.org/structure/3U18", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3WNR", "url": "https://www.rcsb.org/structure/3WNR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3WNS", "url": "https://www.rcsb.org/structure/3WNS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3WNT", "url": "https://www.rcsb.org/structure/3WNT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ETG", "url": "https://www.rcsb.org/structure/4ETG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4EUI", "url": "https://www.rcsb.org/structure/4EUI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4EVG", "url": "https://www.rcsb.org/structure/4EVG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4F2K", "url": "https://www.rcsb.org/structure/4F2K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4GRN", "url": "https://www.rcsb.org/structure/4GRN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4GRO", "url": "https://www.rcsb.org/structure/4GRO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4GRP", "url": "https://www.rcsb.org/structure/4GRP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4GRQ", "url": "https://www.rcsb.org/structure/4GRQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4GRR", "url": "https://www.rcsb.org/structure/4GRR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4GRU", "url": "https://www.rcsb.org/structure/4GRU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4GUM", "url": "https://www.rcsb.org/structure/4GUM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4K9G", "url": "https://www.rcsb.org/structure/4K9G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4OSF", "url": "https://www.rcsb.org/structure/4OSF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4OYQ", "url": "https://www.rcsb.org/structure/4OYQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4P01", "url": "https://www.rcsb.org/structure/4P01", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4P0H", "url": "https://www.rcsb.org/structure/4P0H", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4PKK", "url": "https://www.rcsb.org/structure/4PKK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4PKZ", "url": "https://www.rcsb.org/structure/4PKZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4PLU", "url": "https://www.rcsb.org/structure/4PLU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4TRF", "url": "https://www.rcsb.org/structure/4TRF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4TRU", "url": "https://www.rcsb.org/structure/4TRU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4WR8", "url": "https://www.rcsb.org/structure/4WR8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4WRB", "url": "https://www.rcsb.org/structure/4WRB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4XX7", "url": "https://www.rcsb.org/structure/4XX7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4XX8", "url": "https://www.rcsb.org/structure/4XX8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4Z15", "url": "https://www.rcsb.org/structure/4Z15", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4Z1T", "url": "https://www.rcsb.org/structure/4Z1T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4Z1U", "url": "https://www.rcsb.org/structure/4Z1U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5B4O", "url": "https://www.rcsb.org/structure/5B4O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5BS9", "url": "https://www.rcsb.org/structure/5BS9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5BSC", "url": "https://www.rcsb.org/structure/5BSC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5BSI", "url": "https://www.rcsb.org/structure/5BSI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5BSJ", "url": "https://www.rcsb.org/structure/5BSJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5EIZ", "url": "https://www.rcsb.org/structure/5EIZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5HVS", "url": "https://www.rcsb.org/structure/5HVS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5HVT", "url": "https://www.rcsb.org/structure/5HVT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5HVV", "url": "https://www.rcsb.org/structure/5HVV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5J7P", "url": "https://www.rcsb.org/structure/5J7P", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5J7Q", "url": "https://www.rcsb.org/structure/5J7Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5UMJ", "url": "https://www.rcsb.org/structure/5UMJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5UMK", "url": "https://www.rcsb.org/structure/5UMK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5UZY", "url": "https://www.rcsb.org/structure/5UZY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5V70", "url": "https://www.rcsb.org/structure/5V70", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5V73", "url": "https://www.rcsb.org/structure/5V73", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5XEJ", "url": "https://www.rcsb.org/structure/5XEJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6B1C", "url": "https://www.rcsb.org/structure/6B1C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6B1K", "url": "https://www.rcsb.org/structure/6B1K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6B2C", "url": "https://www.rcsb.org/structure/6B2C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BG6", "url": "https://www.rcsb.org/structure/6BG6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BG7", "url": "https://www.rcsb.org/structure/6BG7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6CB5", "url": "https://www.rcsb.org/structure/6CB5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6CBF", "url": "https://www.rcsb.org/structure/6CBF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6CBG", "url": "https://www.rcsb.org/structure/6CBG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6CBH", "url": "https://www.rcsb.org/structure/6CBH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6FVE", "url": "https://www.rcsb.org/structure/6FVE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6FVH", "url": "https://www.rcsb.org/structure/6FVH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OY8", "url": "https://www.rcsb.org/structure/6OY8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OYB", "url": "https://www.rcsb.org/structure/6OYB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OYE", "url": "https://www.rcsb.org/structure/6OYE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OYG", "url": "https://www.rcsb.org/structure/6OYG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6PEG", "url": "https://www.rcsb.org/structure/6PEG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7E45", "url": "https://www.rcsb.org/structure/7E45", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7E47", "url": "https://www.rcsb.org/structure/7E47", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7E49", "url": "https://www.rcsb.org/structure/7E49", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7E4A", "url": "https://www.rcsb.org/structure/7E4A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7E4B", "url": "https://www.rcsb.org/structure/7E4B", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7E4C", "url": "https://www.rcsb.org/structure/7E4C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7KQX", "url": "https://www.rcsb.org/structure/7KQX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7XTX", "url": "https://www.rcsb.org/structure/7XTX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01187", "url": "http://pfam.xfam.org/family/PF01187", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P14174", "url": "https://pharos.nih.gov/targets/P14174", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P14174", "url": "http://purl.obolibrary.org/obo/PR_P14174", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8950505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8950505", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_002406", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002406", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "13041", "url": "https://www.rhea-db.org/rhea/13041", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "17097", "url": "https://www.rhea-db.org/rhea/17097", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P14174-1", "url": "https://www.uniprot.org/uniprot/P14174-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA", "length": 115, "header": "sp|P14174-1|MIF_HUMAN Isoform 1 of Macrophage migration inhibitory factor OS=Homo sapiens OX=9606 GN=MIF PE=1 SV=4 CANONICAL=P14174-1" }, "isoforms": [ { "isoform_ac": "P14174-1", "url": "", "sequence": { "sequence": "MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA", "length": 115, "header": "sp|P14174-1|MIF_HUMAN Isoform 1 of Macrophage migration inhibitory factor OS=Homo sapiens OX=9606 GN=MIF PE=1 SV=4 CANONICAL=P14174-1" }, "locus": { "chromosome": "HSCHR22_1_CTG7", "start_pos": 131465, "end_pos": 130837, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000613839.2", "url": "https://www.ensembl.org/id/ENST00000613839.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000482779.1", "url": "https://www.ensembl.org/id/ENSP00000482779.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 112, "start_aa": "Ser", "end_pos": 112, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser112", "evidence": [ { "id": "P14174", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P14174" }, { "id": "26280537", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26280537" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 113, "start_aa": "Thr", "end_pos": 113, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr113", "evidence": [ { "id": "P14174", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P14174" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "26280537", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26280537" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "34229054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34229054" }, { "id": "P14174", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P14174" } ] } ], "phosphorylation": [ { "start_pos": 37, "end_pos": 37, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P14174", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14174" }, { "database": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" } ], "site_lbl": "Tyr37" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Pro-1 of macrophage migration inhibitory factor functions as a catalytic base in the phenylpyruvate tautomerase activity.", "journal": "Biochemistry", "date": "1999", "authors": "Lubetsky J B, Swope M, Dealwis C, Blake P, Lolis E", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "reference": [ { "type": "PubMed", "id": "10353846", "url": "https://glygen.org/publication/PubMed/10353846" } ] }, { "title": "The biology of the 17-1A antigen (Ep-CAM).", "journal": "Journal of molecular medicine (Berlin, Germany)", "date": "1999", "authors": "Balzar M, Winter MJ, de Boer CJ, Litvinov SV", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "10606205", "url": "https://glygen.org/publication/PubMed/10606205" } ] }, { "title": "The CD2-subset of the Ig superfamily of cell surface molecules: receptor-ligand pairs expressed by NK cells and other immune cells.", "journal": "Seminars in immunology", "date": "2000", "authors": "Tangye SG, Phillips JH, Lanier LL", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "10764623", "url": "https://glygen.org/publication/PubMed/10764623" } ] }, { "title": "Intracellular action of the cytokine MIF to modulate AP-1 activity and the cell cycle through Jab1.", "journal": "Nature", "date": "2000", "authors": "Kleemann R, Hausser A, Geiger G, Mischke R, Burger-Kentischer A, Flieger O, Johannes F J, Roger T, Calandra T, Kapurniotu A, Grell M, Finkelmeier D, Brunner H, Bernhagen J", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "reference": [ { "type": "PubMed", "id": "11089976", "url": "https://glygen.org/publication/PubMed/11089976" } ] }, { "title": "Coumarin and chromen-4-one analogues as tautomerase inhibitors of macrophage migration inhibitory factor: discovery and X-ray crystallography.", "journal": "J. Med. Chem.", "date": "2001", "authors": "Orita M, Yamamoto S, Katayama N, Aoki M, Takayama K, Yamagiwa Y, Seki N, Suzuki H, Kurihara H, Sakashita H, Takeuchi M, Fujita S, Yamada T, Tanaka A", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "reference": [ { "type": "PubMed", "id": "11170644", "url": "https://glygen.org/publication/PubMed/11170644" } ] }, { "title": "Molecular analysis of neisserial Opa protein interactions with the CEA family of receptors: identification of determinants contributing to the differential specificities of binding.", "journal": "Cellular microbiology", "date": "1999", "authors": "Popp A, Dehio C, Grunert F, Meyer TF, Gray-Owen SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11207550", "url": "https://glygen.org/publication/PubMed/11207550" } ] }, { "title": "Characterization of residues and sequences of the carbohydrate recognition domain required for cell surface localization and ligand binding of human lectin-like oxidized LDL receptor.", "journal": "Journal of cell science", "date": "2001", "authors": "Shi X, Niimi S, Ohtani T, Machida S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11256994", "url": "https://glygen.org/publication/PubMed/11256994" } ] }, { "title": "Macrophage migration inhibitory factor of the parasitic nematode Trichinella spiralis.", "journal": "The Biochemical journal", "date": "2001-07-15", "authors": "Tan T H, Edgerton S A, Kumari R, McAlister M S, Roe S M, Nagl S, Pearl L H, Selkirk M E, Bianco A E, Totty N F, Engwerda C, Gray C A, Meyer D J, Rowe S M", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "reference": [ { "type": "PubMed", "id": "11439086", "url": "https://glygen.org/publication/PubMed/11439086" } ] }, { "title": "A novel 5'-flanking region polymorphism of macrophage migration inhibitory factor is associated with systemic-onset juvenile idiopathic arthritis.", "journal": "Arthritis Rheum.", "date": "2001", "authors": "Donn R P, Shelley E, Ollier W E, Thomson W,", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "reference": [ { "type": "PubMed", "id": "11508429", "url": "https://glygen.org/publication/PubMed/11508429" } ] }, { "title": "CD84 functions as a homophilic adhesion molecule and enhances IFN-gamma secretion: adhesion is mediated by Ig-like domain 1.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Martin M, Romero X, de la Fuente MA, Tovar V, Zapater N, Esplugues E, Pizcueta P, Bosch J, Engel P", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11564780", "url": "https://glygen.org/publication/PubMed/11564780" } ] }, { "title": "Expression of Fc alpha/mu receptor by human mesangial cells: a candidate receptor for immune complex deposition in IgA nephropathy.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "McDonald KJ, Cameron AJ, Allen JM, Jardine AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11779189", "url": "https://glygen.org/publication/PubMed/11779189" } ] }, { "title": "JAM-1 is a ligand of the beta(2) integrin LFA-1 involved in transendothelial migration of leukocytes.", "journal": "Nature immunology", "date": "2002", "authors": "Ostermann G, Weber KS, Zernecke A, Schroder A, Weber C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "11812992", "url": "https://glygen.org/publication/PubMed/11812992" } ] }, { "title": "JAM2 interacts with alpha4beta1. Facilitation by JAM3.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Cunningham SA, Rodriguez JM, Arrate MP, Tran TM, Brock TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12070135", "url": "https://glygen.org/publication/PubMed/12070135" } ] }, { "title": "The junctional adhesion molecule 3 (JAM-3) on human platelets is a counterreceptor for the leukocyte integrin Mac-1.", "journal": "The Journal of experimental medicine", "date": "2002", "authors": "Santoso S, Sachs UJ, Kroll H, Linder M, Ruf A, Preissner KT, Chavakis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12208882", "url": "https://glygen.org/publication/PubMed/12208882" } ] }, { "title": "Plasmodium falciparum erythrocyte invasion through glycophorin C and selection for Gerbich negativity in human populations.", "journal": "Nature medicine", "date": "2003", "authors": "Maier AG, Duraisingh MT, Reeder JC, Patel SS, Kazura JW, Zimmerman PA, Cowman AF", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12469115", "url": "https://glygen.org/publication/PubMed/12469115" } ] }, { "title": "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.", "journal": "Nat. Biotechnol.", "date": "2003", "authors": "Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "reference": [ { "type": "PubMed", "id": "12665801", "url": "https://glygen.org/publication/PubMed/12665801" } ] }, { "title": "The apoptosis-associated protein BNIPL interacts with two cell proliferation-related proteins, MIF and GFER.", "journal": "FEBS Lett.", "date": "2003", "authors": "Shen L, Hu J, Lu H, Wu M, Qin W, Wan D, Li YY, Gu J", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "reference": [ { "type": "PubMed", "id": "12681488", "url": "https://glygen.org/publication/PubMed/12681488" } ] }, { "title": "MIF signal transduction initiated by binding to CD74.", "journal": "J. Exp. Med.", "date": "2003", "authors": "Leng L, Metz CN, Fang Y, Xu J, Donnelly S, Baugh J, Delohery T, Chen Y, Mitchell RA, Bucala R", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" }, { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "12782713", "url": "https://glygen.org/publication/PubMed/12782713" } ] }, { "title": "Human liver protein map: a reference database established by microsequencing and gel comparison.", "journal": "Electrophoresis", "date": "1992", "authors": "Hochstrasser DF, Frutiger S, Paquet N, Bairoch A, Ravier F, Pasquali C, Sanchez JC, Tissot JD, Bjellqvist B, Vargas R, et al.", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "reference": [ { "type": "PubMed", "id": "1286669", "url": "https://glygen.org/publication/PubMed/1286669" } ] }, { "title": "Structural biology of the cell adhesion protein CD2: from molecular recognition to protein folding and design.", "journal": "Current protein & peptide science", "date": "2003", "authors": "Wilkins AL, Yang W, Yang JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "14529530", "url": "https://glygen.org/publication/PubMed/14529530" } ] }, { "title": "Platelet-monocyte complexes support monocyte adhesion to endothelium by enhancing secondary tethering and cluster formation.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2004", "authors": "da Costa Martins P, van den Berk N, Ulfman LH, Koenderman L, Hordijk PL, Zwaginga JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "14615387", "url": "https://glygen.org/publication/PubMed/14615387" } ] }, { "title": "Human lectin-like oxidized low-density lipoprotein receptor-1 functions as a dimer in living cells.", "journal": "DNA and cell biology", "date": "2004", "authors": "Xie Q, Matsunaga S, Niimi S, Ogawa S, Tokuyasu K, Sakakibara Y, Machida S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15000751", "url": "https://glygen.org/publication/PubMed/15000751" } ] }, { "title": "The functional interaction of the beta 2 integrin lymphocyte function-associated antigen-1 with junctional adhesion molecule-A is mediated by the I domain.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Fraemohs L, Koenen RR, Ostermann G, Heinemann B, Weber C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15528364", "url": "https://glygen.org/publication/PubMed/15528364" } ] }, { "title": "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.", "journal": "Nature biotechnology", "date": "2005", "authors": "Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ", "evidence": [ { "database": "iPTMnet", "id": "P14174", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14174" } ], "reference": [ { "type": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" } ] }, { "title": "Involvement of JAM-A in mononuclear cell recruitment on inflamed or atherosclerotic endothelium: inhibition by soluble JAM-A.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2005", "authors": "Ostermann G, Fraemohs L, Baltus T, Schober A, Lietz M, Zernecke A, Liehn EA, Weber C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15681301", "url": "https://glygen.org/publication/PubMed/15681301" } ] }, { "title": "Integrin alpha8beta1-fibronectin interactions promote cell survival via PI3 kinase pathway.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Farias E, Lu M, Li X, Schnapp LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "15721307", "url": "https://glygen.org/publication/PubMed/15721307" } ] }, { "title": "Macrophage migration inhibitory factor reduces the growth of virulent Mycobacterium tuberculosis in human macrophages.", "journal": "Infection and immunity", "date": "2005-06", "authors": "Oddo Mauro, Calandra Thierry, Bucala Richard, Meylan Pascal R A", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "reference": [ { "type": "PubMed", "id": "15908412", "url": "https://glygen.org/publication/PubMed/15908412" } ] }, { "title": "Human erythrocyte glycophorins: protein and gene structure analyses.", "journal": "Transfusion medicine reviews", "date": "1992", "authors": "Cartron JP, Rahuel C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "1591491", "url": "https://glygen.org/publication/PubMed/1591491" } ] }, { "title": "Proteome profiling of interleukin-12 treated human T helper cells.", "journal": "Proteomics", "date": "2005", "authors": "Rosengren AT, Nyman TA, Lahesmaa R", "evidence": [ { "database": "Reactome", "id": "R-HSA-8950505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8950505" } ], "reference": [ { "type": "PubMed", "id": "16038020", "url": "https://glygen.org/publication/PubMed/16038020" } ] }, { "title": "beta 1 integrin function in vivo: adhesion, migration and more.", "journal": "Cancer metastasis reviews", "date": "2005", "authors": "Brakebusch C, Fassler R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16258728", "url": "https://glygen.org/publication/PubMed/16258728" } ] }, { "title": "Junctional adhesion molecules (JAM)-B and -C contribute to leukocyte extravasation to the skin and mediate cutaneous inflammation.", "journal": "The Journal of investigative dermatology", "date": "2005", "authors": "Ludwig RJ, Zollner TM, Santoso S, Hardt K, Gille J, Baatz H, Johann PS, Pfeffer J, Radeke HH, Schon MP, Kaufmann R, Boehncke WH, Podda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16297198", "url": "https://glygen.org/publication/PubMed/16297198" } ] }, { "title": "CD48 stimulation by 2B4 (CD244)-expressing targets activates human NK cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006", "authors": "Messmer B, Eissmann P, Stark S, Watzl C", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16585556", "url": "https://glygen.org/publication/PubMed/16585556" } ] }, { "title": "The SIRP family of receptors and immune regulation.", "journal": "Nature reviews. Immunology", "date": "2006", "authors": "Barclay AN, Brown MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16691243", "url": "https://glygen.org/publication/PubMed/16691243" } ] }, { "title": "Signalling and functional diversity within the Axl subfamily of receptor tyrosine kinases.", "journal": "Cytokine & growth factor reviews", "date": "2006", "authors": "Hafizi S, Dahlback B", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16737840", "url": "https://glygen.org/publication/PubMed/16737840" } ] }, { "title": "Junctional adhesion molecule-A regulates cell migration and resistance to shear stress.", "journal": "Journal of cellular physiology", "date": "2006", "authors": "Huang H, Cruz F, Bazzoni G", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "16783819", "url": "https://glygen.org/publication/PubMed/16783819" } ] }, { "title": "Gas6 and protein S. Vitamin K-dependent ligands for the Axl receptor tyrosine kinase subfamily.", "journal": "The FEBS journal", "date": "2006", "authors": "Hafizi S, Dahlback B", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17064312", "url": "https://glygen.org/publication/PubMed/17064312" } ] }, { "title": "JAM-C regulates tight junctions and integrin-mediated cell adhesion and migration.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Mandicourt G, Iden S, Ebnet K, Aurrand-Lions M, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17099249", "url": "https://glygen.org/publication/PubMed/17099249" } ] }, { "title": "PECAM-1, a key player in neuroinflammation.", "journal": "European journal of neurology", "date": "2006", "authors": "Kalinowska A, Losy J", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17116209", "url": "https://glygen.org/publication/PubMed/17116209" } ] }, { "title": "GPI-anchored CEA family glycoproteins CEA and CEACAM6 mediate their biological effects through enhanced integrin alpha5beta1-fibronectin interaction.", "journal": "Journal of cellular physiology", "date": "2007", "authors": "Ordonez C, Zhai AB, Camacho-Leal P, Demarte L, Fan MM, Stanners CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17167768", "url": "https://glygen.org/publication/PubMed/17167768" } ] }, { "title": "Impact of salt bridges on the equilibrium binding and adhesion of human CD2 and CD58.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Bayas MV, Kearney A, Avramovic A, van der Merwe PA, Leckband DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17172599", "url": "https://glygen.org/publication/PubMed/17172599" } ] }, { "title": "P-selectin glycoprotein ligand-1 is expressed on endothelial cells and mediates monocyte adhesion to activated endothelium.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2007", "authors": "da Costa Martins P, Garcia-Vallejo JJ, van Thienen JV, Fernandez-Borja M, van Gils JM, Beckers C, Horrevoets AJ, Hordijk PL, Zwaginga JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17322099", "url": "https://glygen.org/publication/PubMed/17322099" } ] }, { "title": "Foxp3 controls regulatory T-cell function by interacting with AML1/Runx1.", "journal": "Nature", "date": "2007", "authors": "Ono M, Yaguchi H, Ohkura N, Kitabayashi I, Nagamura Y, Nomura T, Miyachi Y, Tsukada T, Sakaguchi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8950505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8950505" } ], "reference": [ { "type": "PubMed", "id": "17377532", "url": "https://glygen.org/publication/PubMed/17377532" } ] }, { "title": "Platelets recruit human dendritic cells via Mac-1/JAM-C interaction and modulate dendritic cell function in vitro.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2007", "authors": "Langer HF, Daub K, Braun G, Schonberger T, May AE, Schaller M, Stein GM, Stellos K, Bueltmann A, Siegel-Axel D, Wendel HP, Aebert H, Roecken M, Seizer P, Santoso S, Wesselborg S, Brossart P, Gawaz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17379836", "url": "https://glygen.org/publication/PubMed/17379836" } ] }, { "title": "Macrophages and dendritic cells use different Axl/Mertk/Tyro3 receptors in clearance of apoptotic cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Seitz HM, Camenisch TD, Lemke G, Earp HS, Matsushima GK", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17442946", "url": "https://glygen.org/publication/PubMed/17442946" } ] }, { "title": "Association between high levels of blood macrophage migration inhibitory factor, inappropriate adrenal response, and early death in patients with severe sepsis.", "journal": "Clinical infectious diseases : an official publication of the Infectious Diseases Society of America", "date": "2007-05-15", "authors": "Emonts Marieke, Sweep Fred C G J, Grebenchtchikov Nicolai, Geurts-Moespot Anneke, Knaup Marlies, Chanson Anne Laure, Erard Veronique, Renner Pascal, Hermans Peter W M, Hazelzet Jan A, Calandra Thierry", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "reference": [ { "type": "PubMed", "id": "17443469", "url": "https://glygen.org/publication/PubMed/17443469" } ] }, { "title": "TREM-1 ligand expression on platelets enhances neutrophil activation.", "journal": "Blood", "date": "2007", "authors": "Haselmayer P, Grosse-Hovest L, von Landenberg P, Schild H, Radsak MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17452516", "url": "https://glygen.org/publication/PubMed/17452516" } ] }, { "title": "JAM-A mediates neutrophil transmigration in a stimulus-specific manner in vivo: evidence for sequential roles for JAM-A and PECAM-1 in neutrophil transmigration.", "journal": "Blood", "date": "2007", "authors": "Woodfin A, Reichel CA, Khandoga A, Corada M, Voisin MB, Scheiermann C, Haskard DO, Dejana E, Krombach F, Nourshargh S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17505016", "url": "https://glygen.org/publication/PubMed/17505016" } ] }, { "title": "The role of junctional adhesion molecules in vascular inflammation.", "journal": "Nature reviews. Immunology", "date": "2007", "authors": "Weber C, Fraemohs L, Dejana E", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17525755", "url": "https://glygen.org/publication/PubMed/17525755" } ] }, { "title": "Alternative chemical modifications reverse the binding orientation of a pharmacophore scaffold in the active site of macrophage migration inhibitory factor.", "journal": "The Journal of biological chemistry", "date": "2007-08-10", "authors": "Crichlow Gregg V, Cheng Kai Fan, Dabideen Darrin, Ochani Mahendar, Aljabari Bayan, Pavlov Valentin A, Miller Edmund J, Lolis Elias, Al-Abed Yousef", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "reference": [ { "type": "PubMed", "id": "17526494", "url": "https://glygen.org/publication/PubMed/17526494" } ] }, { "title": "Structure of CD84 provides insight into SLAM family function.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Yan Q, Malashkevich VN, Fedorov A, Fedorov E, Cao E, Lary JW, Cole JL, Nathenson SG, Almo SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17563375", "url": "https://glygen.org/publication/PubMed/17563375" } ] }, { "title": "The neutrophil-specific antigen CD177 is a counter-receptor for platelet endothelial cell adhesion molecule-1 (CD31).", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Sachs UJ, Andrei-Selmer CL, Maniar A, Weiss T, Paddock C, Orlova VV, Choi EY, Newman PJ, Preissner KT, Chavakis T, Santoso S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17580308", "url": "https://glygen.org/publication/PubMed/17580308" } ] }, { "title": "Epithelial cell adhesion molecule: more than a carcinoma marker and adhesion molecule.", "journal": "The American journal of pathology", "date": "2007", "authors": "Trzpis M, McLaughlin PM, de Leij LM, Harmsen MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17600130", "url": "https://glygen.org/publication/PubMed/17600130" } ] }, { "title": "JAM family and related proteins in leukocyte migration (Vestweber series).", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2007", "authors": "Bradfield PF, Nourshargh S, Aurrand-Lions M, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17615384", "url": "https://glygen.org/publication/PubMed/17615384" } ] }, { "title": "JAM-C regulates unidirectional monocyte transendothelial migration in inflammation.", "journal": "Blood", "date": "2007", "authors": "Bradfield PF, Scheiermann C, Nourshargh S, Ody C, Luscinskas FW, Rainger GE, Nash GB, Miljkovic-Licina M, Aurrand-Lions M, Imhof BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "17625065", "url": "https://glygen.org/publication/PubMed/17625065" } ] }, { "title": "Diagnostic markers for early detection of ovarian cancer.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2008-02-15", "authors": "Visintin Irene, Feng Ziding, Longton Gary, Ward David C, Alvero Ayesha B, Lai Yinglei, Tenthorey Jeannette, Leiser Aliza, Flores-Saaib Ruben, Yu Herbert, Azori Masoud, Rutherford Thomas, Schwartz Peter E, Mor Gil", "evidence": [ { "database": "GlyGen", "id": "A0461", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "PubMed", "id": "18258665", "url": "https://glygen.org/publication/PubMed/18258665" } ] }, { "title": "Structural and kinetic analyses of macrophage migration inhibitory factor active site interactions.", "journal": "Biochemistry", "date": "2009", "authors": "Crichlow Gregg V, Lubetsky Jodi B, Leng Lin, Bucala Richard, Lolis Elias J", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "reference": [ { "type": "PubMed", "id": "19090677", "url": "https://glygen.org/publication/PubMed/19090677" } ] }, { "title": "Glycophorin B is the erythrocyte receptor of Plasmodium falciparum erythrocyte-binding ligand, EBL-1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Mayer DC, Cofie J, Jiang L, Hartl DL, Tracy E, Kabat J, Mendoza LH, Miller LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "19279206", "url": "https://glygen.org/publication/PubMed/19279206" } ] }, { "title": "The Golgi-associated protein p115 mediates the secretion of macrophage migration inhibitory factor.", "journal": "J. Immunol.", "date": "2009", "authors": "Merk Melanie, Baugh John, Zierow Swen, Leng Lin, Pal Utpal, Lee Seung Joon, Ebert Antje D, Mizue Yuka, Trent John O, Mitchell Robert, Nickel Walter, Kavathas Paula B, Bernhagen J\u00fcrgen, Bucala Richard", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "reference": [ { "type": "PubMed", "id": "19454686", "url": "https://glygen.org/publication/PubMed/19454686" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "Pregnancy-specific glycoprotein 1 induces endothelial tubulogenesis through interaction with cell surface proteoglycans.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Lisboa FA, Warren J, Sulkowski G, Aparicio M, David G, Zudaire E, Dveksler GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "21193412", "url": "https://glygen.org/publication/PubMed/21193412" } ] }, { "title": "Analysis of glycoprotein E-selectin ligands on human and mouse marrow cells enriched for hematopoietic stem/progenitor cells.", "journal": "Blood", "date": "2011", "authors": "Merzaban JS, Burdick MM, Gadhoum SZ, Dagia NM, Chu JT, Fuhlbrigge RC, Sackstein R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "21659548", "url": "https://glygen.org/publication/PubMed/21659548" } ] }, { "title": "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features.", "journal": "Mol. Cell. Proteomics", "date": "2012", "authors": "Bienvenut WV, Sumpton D, Martinez A, Lilla S, Espagne C, Meinnel T, Giglione C", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "reference": [ { "type": "PubMed", "id": "22223895", "url": "https://glygen.org/publication/PubMed/22223895" } ] }, { "title": "Proteome profiling of human neutrophil granule subsets, secretory vesicles, and cell membrane: correlation with transcriptome profiling of neutrophil precursors.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Rorvig S, Ostergaard O, Heegaard NH, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "23650620", "url": "https://glygen.org/publication/PubMed/23650620" } ] }, { "title": "MIF intersubunit disulfide mutant antagonist supports activation of CD74 by endogenous MIF trimer at physiologic concentrations.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Fan C, Rajasekaran D, Syed MA, Leng L, Loria JP, Bhandari V, Bucala R, Lolis EJ", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "reference": [ { "type": "PubMed", "id": "23776208", "url": "https://glygen.org/publication/PubMed/23776208" } ] }, { "title": "Pregnancy-specific glycoprotein 1 (PSG1) activates TGF-beta and prevents dextran sodium sulfate (DSS)-induced colitis in mice.", "journal": "Mucosal immunology", "date": "2014", "authors": "Blois SM, Sulkowski G, Tirado-Gonzalez I, Warren J, Freitag N, Klapp BF, Rifkin D, Fuss I, Strober W, Dveksler GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "23945545", "url": "https://glygen.org/publication/PubMed/23945545" } ] }, { "title": "Biochemical analysis of the Plasmodium falciparum erythrocyte-binding antigen-175 (EBA175)-glycophorin-A interaction: implications for vaccine design.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Wanaguru M, Crosnier C, Johnson S, Rayner JC, Wright GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "24043627", "url": "https://glygen.org/publication/PubMed/24043627" } ] }, { "title": "Dominant negative effects of tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL) receptor 4 on TRAIL receptor 1 signaling by formation of heteromeric complexes.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Neumann S, Hasenauer J, Pollak N, Scheurich P", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "24764293", "url": "https://glygen.org/publication/PubMed/24764293" } ] }, { "title": "The roles of protein C and thrombomodulin in the regulation of blood coagulation.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Esmon CT", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "2538457", "url": "https://glygen.org/publication/PubMed/2538457" } ] }, { "title": "Molecular cloning of a cDNA encoding a human macrophage migration inhibitory factor.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1989", "authors": "Weiser WY, Temple PA, Witek-Giannotti JS, Remold HG, Clark SC, David JR", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "reference": [ { "type": "PubMed", "id": "2552447", "url": "https://glygen.org/publication/PubMed/2552447" } ] }, { "title": "Secreted and O-GlcNAcylated MIF binds to the human EGF receptor and inhibits its activation.", "journal": "Nature cell biology", "date": "2015", "authors": "Zheng Y, Li X, Qian X, Wang Y, Lee JH, Xia Y, Hawke DH, Zhang G, Lyu J, Lu Z", "evidence": [ { "database": "O-GlcNAc Database", "id": "P14174", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P14174" }, { "database": "O-GlcNAc Atlas", "id": "P14174", "url": "https://oglcnac.org/atlas/detail/P14174" } ], "reference": [ { "type": "PubMed", "id": "26280537", "url": "https://glygen.org/publication/PubMed/26280537" } ] }, { "title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.", "journal": "Analytical chemistry", "date": "2017", "authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P14174", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P14174" } ], "reference": [ { "type": "PubMed", "id": "28510447", "url": "https://glygen.org/publication/PubMed/28510447" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P14174", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P14174" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P14174", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P14174" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Synthesis of Na2S2O4 mediated cleavable affinity tag for labeling of O-GlcNAc modified proteins via azide-alkyne cycloaddition.", "journal": "Bioorganic & medicinal chemistry letters", "date": "2021", "authors": "Wang J, Dou B, Zheng L, Cao W, Zeng X, Wen Y, Ma J, Li X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P14174", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P14174" } ], "reference": [ { "type": "PubMed", "id": "34229054", "url": "https://glygen.org/publication/PubMed/34229054" } ] }, { "title": "O-GlcNAcylation promotes fatty acid synthase activity under nutritional stress as a pro-survival mechanism in cancer cells.", "journal": "Proteomics", "date": "2022", "authors": "Wong YK, Wang J, Lim TK, Lin Q, Yap CT, Shen HM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P14174", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P14174" } ], "reference": [ { "type": "PubMed", "id": "35083852", "url": "https://glygen.org/publication/PubMed/35083852" } ] }, { "title": "Serum macrophage migration inhibitory factor levels predict brain atrophy in people with primary progressive multiple sclerosis.", "journal": "Multiple sclerosis (Houndmills, Basingstoke, England)", "date": "2024-01", "authors": "Ladakis Dimitrios C, Reyes-Mantilla Maria I, Gadani Sachin P, Mace Jackson W, Dominguez-Penuela Susana C, Appiah Mayaa J, Smith Matthew D, Bhargava Pavan, Fox Robert J, Saidha Shiv, Calabresi Peter A", "evidence": [ { "database": "RefSeq", "id": "NP_002406", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002406" } ], "reference": [ { "type": "PubMed", "id": "37982154", "url": "https://glygen.org/publication/PubMed/37982154" } ] }, { "title": "Macrophage migration inhibitory factor: A noval biomarker upregulates in myasthenia gravis and correlates with disease severity and relapse.", "journal": "Cytokine", "date": "2023-12-29", "authors": "Huang Xiaoyu, Li Hao, Zhang Zhouao, Wang Zhouyi, Du Xue, Zhang Yong", "evidence": [ { "database": "RefSeq", "id": "NP_002406", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002406" } ], "reference": [ { "type": "PubMed", "id": "38159470", "url": "https://glygen.org/publication/PubMed/38159470" } ] }, { "title": "Obesity-related Plasma CXCL10 Drives CX3CR1-dependent Monocytic Secretion of Macrophage Migration Inhibitory Factor.", "journal": "ImmunoHorizons", "date": "2024-01-01", "authors": "Meyh\u00f6fer Svenja, Steffen Armin, Pl\u00f6tze-Martin Kirstin, Marquardt Jens-Uwe, Meyh\u00f6fer Sebastian M, Bruchhage Karl-Ludwig, Pries Ralph", "evidence": [ { "database": "RefSeq", "id": "NP_002406", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002406" } ], "reference": [ { "type": "PubMed", "id": "38175171", "url": "https://glygen.org/publication/PubMed/38175171" } ] }, { "title": "Macrophage migration inhibitory factor reversed senescent phenotype in human chondrocytes in vitro.", "journal": "Molecular biology reports", "date": "2024-01-21", "authors": "Fu Zhenlan, Li Qingqing, Jiang Peiyao, Song Xiongbo, Yang Junjun, Chen Guangxing, Gong Xiaoyuan, Yang Liu", "evidence": [ { "database": "RefSeq", "id": "NP_002406", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002406" } ], "reference": [ { "type": "PubMed", "id": "38245877", "url": "https://glygen.org/publication/PubMed/38245877" } ] }, { "title": "Human plasma protein C: isolation, characterization, and mechanism of activation by alpha-thrombin.", "journal": "The Journal of clinical investigation", "date": "1979", "authors": "Kisiel W", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "468991", "url": "https://glygen.org/publication/PubMed/468991" } ] }, { "title": "Insight into E-selectin/ligand interaction from the crystal structure and mutagenesis of the lec/EGF domains.", "journal": "Nature", "date": "1994", "authors": "Graves BJ, Crowther RL, Chandran C, Rumberger JM, Li S, Huang KS, Presky DH, Familletti PC, Wolitzky BA, Burns DK", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "7509040", "url": "https://glygen.org/publication/PubMed/7509040" } ] }, { "title": "The P-selectin glycoprotein ligand from human neutrophils displays sialylated, fucosylated, O-linked poly-N-acetyllactosamine.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Moore KL, Eaton SF, Lyons DE, Lichenstein HS, Cummings RD, McEver RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "7521878", "url": "https://glygen.org/publication/PubMed/7521878" } ] }, { "title": "A macrophage migration inhibitory factor is expressed in the differentiating cells of the eye lens.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1993", "authors": "Wistow GJ, Shaughnessy MP, Lee DC, Hodin J, Zelenka PS", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "reference": [ { "type": "PubMed", "id": "7679497", "url": "https://glygen.org/publication/PubMed/7679497" } ] }, { "title": "The major binding protein of the interferon antagonist sarcolectin in human placenta is a macrophage migration inhibitory factor.", "journal": "Arch. Biochem. Biophys.", "date": "1993", "authors": "Zeng F Y, Weiser W Y, Kratzin H, Stahl B, Karas M, Gabius H J", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "reference": [ { "type": "PubMed", "id": "7683862", "url": "https://glygen.org/publication/PubMed/7683862" } ] }, { "title": "Purification, bioactivity, and secondary structure analysis of mouse and human macrophage migration inhibitory factor (MIF).", "journal": "Biochemistry", "date": "1994", "authors": "Bernhagen J, Mitchell R A, Calandra T, Voelter W, Cerami A, Bucala R", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "reference": [ { "type": "PubMed", "id": "7947826", "url": "https://glygen.org/publication/PubMed/7947826" } ] }, { "title": "Ep-CAM: a human epithelial antigen is a homophilic cell-cell adhesion molecule.", "journal": "The Journal of cell biology", "date": "1994", "authors": "Litvinov SV, Velders MP, Bakker HA, Fleuren GJ, Warnaar SO", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "8163559", "url": "https://glygen.org/publication/PubMed/8163559" } ] }, { "title": "The surrogate light chain in B-cell development.", "journal": "Immunology today", "date": "1993", "authors": "Melchers F, Karasuyama H, Haasner D, Bauer S, Kudo A, Sakaguchi N, Jameson B, Rolink A", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "8166770", "url": "https://glygen.org/publication/PubMed/8166770" } ] }, { "title": "Cloning the human gene for macrophage migration inhibitory factor (MIF).", "journal": "Genomics", "date": "1994", "authors": "Paralkar V, Wistow G", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "reference": [ { "type": "PubMed", "id": "8188240", "url": "https://glygen.org/publication/PubMed/8188240" } ] }, { "title": "Molecular cloning and functional expression of a cDNA encoding glycosylation-inhibiting factor.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1993", "authors": "Mikayama T, Nakano T, Gomi H, Nakagawa Y, Liu Y C, Sato M, Iwamatsu A, Ishii Y, Weiser W Y, Ishizaka K", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "reference": [ { "type": "PubMed", "id": "8234256", "url": "https://glygen.org/publication/PubMed/8234256" } ] }, { "title": "The alpha v beta 1 integrin functions as a fibronectin receptor but does not support fibronectin matrix assembly and cell migration on fibronectin.", "journal": "The Journal of cell biology", "date": "1993", "authors": "Zhang Z, Morla AO, Vuori K, Bauer JS, Juliano RL, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "8314844", "url": "https://glygen.org/publication/PubMed/8314844" } ] }, { "title": "The crystal structure of human glycosylation-inhibiting factor is a trimeric barrel with three 6-stranded beta-sheets.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1996", "authors": "Kato Y, Muto T, Tomura T, Tsumura H, Watarai H, Mikayama T, Ishizaka K, Kuroki R", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "reference": [ { "type": "PubMed", "id": "8610159", "url": "https://glygen.org/publication/PubMed/8610159" } ] }, { "title": "Crystal structure at 2.6-A resolution of human macrophage migration inhibitory factor.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1996", "authors": "Sun H W, Bernhagen J, Bucala R, Lolis E", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "reference": [ { "type": "PubMed", "id": "8643551", "url": "https://glygen.org/publication/PubMed/8643551" } ] }, { "title": "Targeting of proteins to granule subsets is determined by timing and not by sorting: The specific granule protein NGAL is localized to azurophil granules when expressed in HL-60 cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Le Cabec V, Cowland JB, Calafat J, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "8692836", "url": "https://glygen.org/publication/PubMed/8692836" } ] }, { "title": "Crystal structure of macrophage migration inhibitory factor from human lymphocyte at 2.1-A resolution.", "journal": "FEBS Lett.", "date": "1996", "authors": "Sugimoto H, Suzuki M, Nakagawa A, Tanaka I, Nishihira J", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "reference": [ { "type": "PubMed", "id": "8766818", "url": "https://glygen.org/publication/PubMed/8766818" } ] }, { "title": "An endothelial receptor for oxidized low-density lipoprotein.", "journal": "Nature", "date": "1997", "authors": "Sawamura T, Kume N, Aoyama T, Moriwaki H, Hoshikawa H, Aiba Y, Tanaka T, Miwa S, Katsura Y, Kita T, Masaki T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9052782", "url": "https://glygen.org/publication/PubMed/9052782" } ] }, { "title": "Differential recognition of members of the carcinoembryonic antigen family by Opa variants of Neisseria gonorrhoeae.", "journal": "Infection and immunity", "date": "1997", "authors": "Bos MP, Grunert F, Belland RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9169774", "url": "https://glygen.org/publication/PubMed/9169774" } ] }, { "title": "An antagonist decoy receptor and a death domain-containing receptor for TRAIL.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Pan G, Ni J, Wei YF, Yu G, Gentz R, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9242610", "url": "https://glygen.org/publication/PubMed/9242610" } ] }, { "title": "A novel association of Fc receptor gamma-chain with glycoprotein VI and their co-expression as a collagen receptor in human platelets.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Tsuji M, Ezumi Y, Arai M, Takayama H", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9295288", "url": "https://glygen.org/publication/PubMed/9295288" } ] }, { "title": "Epithelial cell adhesion molecule (Ep-CAM) modulates cell-cell interactions mediated by classic cadherins.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Litvinov SV, Balzar M, Winter MJ, Bakker HA, Briaire-de Bruijn IH, Prins F, Fleuren GJ, Warnaar SO", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9382878", "url": "https://glygen.org/publication/PubMed/9382878" } ] }, { "title": "Identification of the lectin-like receptor for oxidized low-density lipoprotein in human macrophages and its potential role as a scavenger receptor.", "journal": "The Biochemical journal", "date": "1998", "authors": "Yoshida H, Kondratenko N, Green S, Steinberg D, Quehenberger O", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9693095", "url": "https://glygen.org/publication/PubMed/9693095" } ] }, { "title": "Ligand specificity of LOX-1, a novel endothelial receptor for oxidized low density lipoprotein.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "1998", "authors": "Moriwaki H, Kume N, Sawamura T, Aoyama T, Hoshikawa H, Ochi H, Nishi E, Masaki T, Kita T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202733", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733" } ], "reference": [ { "type": "PubMed", "id": "9763524", "url": "https://glygen.org/publication/PubMed/9763524" } ] } ], "pathway": [ { "id": "hsa:4282", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4282", "resource": "KEGG Pathway" }, { "id": "R-HSA-202733", "name": "Cell surface interactions at the vascular wall", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202733", "resource": "Reactome", "description": "Cell surface interactions at the vascular wall" }, { "id": "R-HSA-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-HSA-8950505", "name": "Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8950505", "resource": "Reactome", "description": "Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation" } ], "orthologs": [ { "uniprot_canonical_ac": "P30904-1", "protein_name": "Macrophage migration inhibitory factor", "gene_name": "Mif", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTSDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA", "length": 115 }, "evidence": [ { "id": "45922163", "url": "http://www.informatics.jax.org/homology/45922163", "database": "MGI" }, { "id": "P14174", "url": "https://omabrowser.org/oma/group/P14174/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P34884-1", "protein_name": "Macrophage migration inhibitory factor", "gene_name": "Mif", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA", "length": 115 }, "evidence": [ { "id": "45922163", "url": "http://www.informatics.jax.org/homology/45922163", "database": "MGI" }, { "id": "P14174", "url": "https://omabrowser.org/oma/group/P14174/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P80928-1", "protein_name": "Macrophage migration inhibitory factor", "gene_name": "MIF", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MPMFVVNTNVPRASVPDGFLSELTQQLVQAMGKPAQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRIYINYYDMNAANVGWNGSTFA", "length": 115 }, "evidence": [ { "id": "P14174", "url": "https://omabrowser.org/oma/group/P14174/", "database": "OMA" } ], "common_name": "Pig" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 7, "go_terms": [ { "name": "protease binding", "id": "GO:0002020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002020", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "chemoattractant activity", "id": "GO:0042056", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042056", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "cytokine activity", "id": "GO:0005125", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005125", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "cytokine receptor binding", "id": "GO:0005126", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005126", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "dopachrome isomerase activity", "id": "GO:0004167", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004167", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "phenylpyruvate tautomerase activity", "id": "GO:0050178", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050178", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 11, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "secretory granule lumen", "id": "GO:0034774", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034774", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "ficolin-1-rich granule lumen", "id": "GO:1904813", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904813", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "vesicle", "id": "GO:0031982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031982", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 34, "go_terms": [ { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "cell surface receptor signaling pathway", "id": "GO:0007166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007166", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "negative regulation of gene expression", "id": "GO:0010629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010629", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "positive regulation of protein kinase A signaling", "id": "GO:0010739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010739", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "positive regulation of peptidyl-serine phosphorylation", "id": "GO:0033138", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033138", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "positive regulation of ERK1 and ERK2 cascade", "id": "GO:0070374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "negative regulation of cell migration", "id": "GO:0030336", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030336", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "positive regulation of cytokine production", "id": "GO:0001819", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001819", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "negative regulation of mature B cell apoptotic process", "id": "GO:0002906", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002906", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "positive regulation of B cell proliferation", "id": "GO:0030890", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030890", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "positive regulation of peptidyl-tyrosine phosphorylation", "id": "GO:0050731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050731", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "negative regulation of cellular senescence", "id": "GO:2000773", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000773", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "positive regulation of tumor necrosis factor production", "id": "GO:0032760", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032760", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "positive regulation of phosphorylation", "id": "GO:0042327", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042327", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "positive regulation of fibroblast proliferation", "id": "GO:0048146", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048146", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "negative regulation of myeloid cell apoptotic process", "id": "GO:0033033", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033033", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "protein homotrimerization", "id": "GO:0070207", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070207", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "cellular senescence", "id": "GO:0090398", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090398", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "DNA damage response, signal transduction by p53 class mediator", "id": "GO:0030330", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030330", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "negative regulation of DNA damage response, signal transduction by p53 class mediator", "id": "GO:0043518", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043518", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "regulation of macrophage activation", "id": "GO:0043030", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043030", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator", "id": "GO:1902166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902166", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "positive regulation of lipopolysaccharide-mediated signaling pathway", "id": "GO:0031666", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031666", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "prostaglandin biosynthetic process", "id": "GO:0001516", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001516", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "negative regulation of macrophage chemotaxis", "id": "GO:0010760", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010760", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "positive regulation of prostaglandin secretion involved in immune response", "id": "GO:0061078", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061078", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "positive regulation of myeloid leukocyte cytokine production involved in immune response", "id": "GO:0061081", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061081", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "positive regulation of arachidonic acid secretion", "id": "GO:0090238", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090238", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "carboxylic acid metabolic process", "id": "GO:0019752", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019752", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "positive regulation of chemokine (C-X-C motif) ligand 2 production", "id": "GO:2000343", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000343", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" }, { "name": "negative regulation of protein metabolic process", "id": "GO:0051248", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051248", "evidence": [ { "database": "UniProtKB", "id": "P14174", "url": "https://www.uniprot.org/uniprot/P14174" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 110, "end_pos": 112, "annotation": "n_glycosylation_sequon" }, { "start_pos": 111, "end_pos": 113, "annotation": "n_glycosylation_sequon" }, { "start_pos": 73, "end_pos": 75, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "13041", "name": "", "equation": "L-dopachrome = 5,6-dihydroxyindole-2-carboxylate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P30904-1", "D3ZXK6-1", "D4A3P7-1", "D3ZQU2-1", "D3ZE63-1", "F1LTZ6-1", "A0A8I6AEZ4-1", "P14174-1", "P40126-1", "P34884-1", "P29812-1", "Q9VG08-1", "Q9VG09-1" ], "evidence": [ { "id": "13041", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/13041" } ] }, { "id": "17097", "name": "", "equation": "3-phenylpyruvate = enol-phenylpyruvate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P30904-1", "D3ZXK6-1", "D4A3P7-1", "D3ZQU2-1", "D3ZE63-1", "F1LTZ6-1", "P14174-1", "P34884-1" ], "evidence": [ { "id": "17097", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/17097" } ] }, { "id": "R-HSA-5676133", "name": "CD74 binds MIF", "equation": "", "summary": "Macrophage migration inhibitory factor (MIF), one of the first cytokines to be described (George & Vaughan 1962), is an important regulator of innate and adaptive immunity. MIF is an upstream activator of monocytes/macrophages, centrally involved in the pathogenesis of septic shock, arthritis, and other inflammatory conditions (Nishihira 2000, Sanchez-Ni\u00f1o et al. 2013). High-expression Mif alleles are linked to severe rheumatoid arthritis (Morand & Leech 2005). MIF promotes monocyte/macrophage activation and it is required for the optimal expression of TNF-alpha, IL-1, and PGE2 (Calandra & Bucala 1997). MIF-treated macrophages are more phagocytic and better able to destroy intracellular pathogens, such as Leishmania (Rosado & Rodriguez-Sosa 2011). Active MIF is a 37.5 kDa homotrimer.

MIF can bind to CD74 (Leng et al. 2003) and the chemokine receptors CXCR2 and CXCR4 (Bernhagen et al. 2007). Leukocyte recruitment by MIF is mediated by interaction with CXCR2 and CXCR4 (Bernhagen et al. 2007). MIF interaction with CD74 mediates its proproliferative and antiproliferative effects, regulation of B-cell and tumor cell survival, fibrosis and angiogenesis (Starlets et al. 2006). MIF can suppress the immunosuppressive effects of glucocorticoids, inducing a sustained pattern of ERK-1/2 MAP kinase activation (Bach et al. 2009).

MIF is endocytosed to bind the cytosolic protein JAB1 (Schwartz et al. 2012), negatively regulating JAB1-controlled pathways (Kleemann et al. 2000). MIF inhibits JAB1-induced JNK activity, AP-1 activity and JAB1-dependent cell-cycle regulation by stabilizing p27Kip1 protein (Nguyen et al. 2003). Consequently, MIF blocks JAB1-mediated rescue of fibroblasts from growth arrest (Kleemann et al. 2000).", "cellular_location": "extracellular region, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P14174-1" ], "evidence": [ { "id": "R-HSA-5676133", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676133" } ] }, { "id": "R-HSA-6798748", "name": "Exocytosis of secretory granule lumen proteins", "equation": "", "summary": "Secretory vesicles provide a reservoir of secreted proteins and membrane-associated receptors that are required at the earliest stages of the neutrophil-mediated inflammatory response. They are mobilized in response to a wide variety of inflammatory stimuli (Sengelov et al. 1993a,b). Resultant cell surface changes allow the neutrophil to establish firm contact with activated vascular epithelium (Faurschou & Borregaard 2003).", "cellular_location": "extracellular region, secretory granule lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P18669-1", "Q13464-1", "P32320-1", "P09917-1", "O00487-1", "P13639-1", "P12268-1", "P62937-1", "Q96G03-1", "P68402-1", "Q99436-1", "P55072-1", "P68104-1", "P11142-1", "Q9Y315-1", "P13010-1", "P04075-1", "P09972-1", "P07900-1", "P09769-1", "P09211-1", "Q16539-1", "P14618-1", "P07741-1", "Q01432-1", "P12956-1", "Q7Z6Z7-1", "Q9UNP9-1", "P14174-1", "P04040-1", "O00571-1", "P06744-1", "P52790-1", "P11678-1", "P00491-1", "P06737-1", "P00746-1", "Q13162-1", "P17858-1", "P46976-1", "P22392-1", "P13716-1", "O75874-1", "P20839-1", "O00764-1" ], "evidence": [ { "id": "R-HSA-6798748", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798748" } ] }, { "id": "R-HSA-6800434", "name": "Exocytosis of ficolin-rich granule lumen proteins", "equation": "", "summary": "Ficoli-1 rich granules are a relatively new fourth neutrophil granule population that is enriched in the microbial lectin ficolin-1. Ficolin-1 is present in tertiary granules, but ficolin-1 rich granules can be differentiated by having low levels of gelatinases and an elevated exocytosis propensity (Rorvig et al. 2009, 2013). The importance of these granules may be to provide rapid release of pattern recognition molecules to activate the lectin complement pathway (Rorvig et al. 2009).", "cellular_location": "extracellular region, ficolin-1-rich granule lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9UBR2-1", "P18669-1", "P32320-1", "P09917-1", "O00487-1", "P13639-1", "P12268-1", "P62937-1", "P15586-1", "Q96G03-1", "Q9P0J7-1", "P68402-1", "P36871-1", "Q99436-1", "P07339-1", "P13798-1", "P53396-1", "P55072-1", "P68104-1", "P11142-1", "Q9Y315-1", "P04075-1", "P09972-1", "P07900-1", "P09211-1", "Q16539-1", "P07858-1", "P14618-1", "P28482-1", "Q01432-1", "P12956-1", "Q7Z6Z7-1", "Q9UNP9-1", "Q13510-1", "P14174-1", "P15848-1", "P16278-1", "Q8WVQ1-1", "P04040-1", "O00571-1", "P14780-1", "P06744-1", "P52790-1", "P00491-1", "P06737-1", "Q16769-1", "P08236-1", "P02794-1", "P07384-1", "Q14004-1", "P00746-1", "P98066-1", "P25774-1", "Q13162-1", "P17858-1", "P46976-1", "P09960-1", "P22392-1", "P13716-1", "O75874-1", "P20839-1" ], "evidence": [ { "id": "R-HSA-6800434", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6800434" } ] }, { "id": "R-HSA-8950732", "name": "Expression of Macrophage migration inhibitory factor", "equation": "", "summary": "Experiments using human cord blood CD4(+) T cells show 22 protein spots and 20 protein spots, upregulated and downregulated proteins respectively, following Interleukin-12 stimulation (Rosengren et.al, 2005). Among the up-regulated proteins is :Macrophage migration inhibitory factor(MIF).", "cellular_location": "nucleoplasm, secretory granule lumen", "input_participant_list": [ "R-HSA-8950444" ], "output_participant_list": [ "R-HSA-6803282" ], "enzyme_list": [ "P14174-1" ], "evidence": [ { "id": "R-HSA-8950732", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8950732" } ] } ], "reaction_participants": [ { "participant_id": "R-HSA-6803282", "participant_name": "MIF [secretory granule lumen]", "crossref": [ { "id": "4TRU", "database": "PDB", "url": "" }, { "id": "1GIF", "database": "PDB", "url": "" }, { "id": "5B4O", "database": "PDB", "url": "" }, { "id": "3L5V", "database": "PDB", "url": "" }, { "id": "6FVH", "database": "PDB", "url": "" }, { "id": "3JSF", "database": "PDB", "url": "" }, { "id": "5XEJ", "database": "PDB", "url": "" }, { "id": "3L5T", "database": "PDB", "url": "" }, { "id": "HMDBP00100", "database": "HMDB Protein", "url": "" }, { "id": "6CBG", "database": "PDB", "url": "" }, { "id": "ENSP00000482779", "database": "Ensembl", "url": "" }, { "id": "3JSG", "database": "PDB", "url": "" }, { "id": "4GRQ", "database": "PDB", "url": "" }, { "id": "3CE4", "database": "PDB", "url": "" }, { "id": "7E4A", "database": "PDB", "url": "" }, { "id": "3DJH", "database": "PDB", "url": "" }, { "id": "ENST00000215754", "database": "Ensembl", "url": "" }, { "id": "16399", "database": "Orphanet", "url": "" }, { "id": "P14174", "database": "GeneCards", "url": "" }, { "id": "4P01", "database": "PDB", "url": "" }, { "id": "7KQX", "database": "PDB", "url": "" }, { "id": "ENSG00000240972-MIF", "database": "HPA", "url": "" }, { "id": "1GCZ", "database": "PDB", "url": "" }, { "id": "4PKZ", "database": "PDB", "url": "" }, { "id": "3L5S", "database": "PDB", "url": "" }, { "id": "6B2C", "database": "PDB", "url": "" }, { "id": "4WRB", "database": "PDB", "url": "" }, { "id": "5UZY", "database": "PDB", "url": "" }, { "id": "3U18", "database": "PDB", "url": "" }, { "id": "4OSF", "database": "PDB", "url": "" }, { "id": "1GD0", "database": "PDB", "url": "" }, { "id": "3DJI", "database": "PDB", "url": "" }, { "id": "MIF_HUMAN", "database": "ZINC - Substances", "url": "" }, { "id": "3WNS", "database": "PDB", "url": "" }, { "id": "4XX8", "database": "PDB", "url": "" }, { "id": "4GRN", "database": "PDB", "url": "" }, { "id": "5.3.2.1", "database": "IntEnz", "url": "" }, { "id": "4P0H", "database": "PDB", "url": "" }, { "id": "3IJG", "database": "PDB", "url": "" }, { "id": "5V70", "database": "PDB", "url": "" }, { "id": "ENSG00000240972", "database": "Ensembl", "url": "" }, { "id": "6CBF", "database": "PDB", "url": "" }, { "id": "5BSI", "database": "PDB", "url": "" }, { "id": "6OYB", "database": "PDB", "url": "" }, { "id": "7E4C", "database": "PDB", "url": "" }, { "id": "4GRR", "database": "PDB", "url": "" }, { "id": "4XX7", "database": "PDB", "url": "" }, { "id": "P14174", "database": "ZINC target", "url": "" }, { "id": "ENST00000613839", "database": "Ensembl", "url": "" }, { "id": "1P1G", "database": "PDB", "url": "" }, { "id": "5HVT", "database": "PDB", "url": "" }, { "id": "4PLU", "database": "PDB", "url": "" }, { "id": "4Z1T", "database": "PDB", "url": "" }, { "id": "MIF_HUMAN", "database": "ZINC - World Drugs", "url": "" }, { "id": "MIF_HUMAN", "database": "ZINC - Investigational", "url": "" }, { "id": "P14174", "database": "Pharos - Targets", "url": "" }, { "id": "5BS9", "database": "PDB", "url": "" }, { "id": "4GRO", "database": "PDB", "url": "" }, { "id": "7E47", "database": "PDB", "url": "" }, { "id": "5UMK", "database": "PDB", "url": "" }, { "id": "3WNR", "database": "PDB", "url": "" }, { "id": "2OOW", "database": "PDB", "url": "" }, { "id": "4K9G", "database": "PDB", "url": "" }, { "id": "ENSG00000240972", "database": "OpenTargets", "url": "" }, { "id": "MIF_HUMAN", "database": "ZINC - Metabolites", "url": "" }, { "id": "5UMJ", "database": "PDB", "url": "" }, { "id": "4Z1U", "database": "PDB", "url": "" }, { "id": "4F2K", "database": "PDB", "url": "" }, { "id": "5HVS", "database": "PDB", "url": "" }, { "id": "2OOH", "database": "PDB", "url": "" }, { "id": "7E45", "database": "PDB", "url": "" }, { "id": "4EUI", "database": "PDB", "url": "" }, { "id": "5HVV", "database": "PDB", "url": "" }, { "id": "4PKK", "database": "PDB", "url": "" }, { "id": "4GRU", "database": "PDB", "url": "" }, { "id": "MIF_HUMAN", "database": "ZINC - Biogenic", "url": "" }, { "id": "3L5R", "database": "PDB", "url": "" }, { "id": "4GRP", "database": "PDB", "url": "" }, { "id": "7E49", "database": "PDB", "url": "" }, { "id": "5V73", "database": "PDB", "url": "" }, { "id": "ENSG00000276701", "database": "Ensembl", "url": "" }, { "id": "1MIF", "database": "PDB", "url": "" }, { "id": "3L5U", "database": "PDB", "url": "" }, { "id": "3B9S", "database": "PDB", "url": "" }, { "id": "NP_002406.1", "database": "RefSeq", "url": "" }, { "id": "6BG6", "database": "PDB", "url": "" }, { "id": "4GUM", "database": "PDB", "url": "" }, { "id": "6PEG", "database": "PDB", "url": "" }, { "id": "7XTX", "database": "PDB", "url": "" }, { "id": "5J7Q", "database": "PDB", "url": "" }, { "id": "7E4B", "database": "PDB", "url": "" }, { "id": "MIF_HUMAN", "database": "ZINC - Predictions - Purchasable", "url": "" }, { "id": "5EIZ", "database": "PDB", "url": "" }, { "id": "6FVE", "database": "PDB", "url": "" }, { "id": "P14174", "database": "UniProt", "url": "" }, { "id": "6OYG", "database": "PDB", "url": "" }, { "id": "ENSP00000215754", "database": "Ensembl", "url": "" }, { "id": "3L5P", "database": "PDB", "url": "" }, { "id": "3SMB", "database": "PDB", "url": "" }, { "id": "6CBH", "database": "PDB", "url": "" }, { "id": "3IJJ", "database": "PDB", "url": "" }, { "id": "6B1C", "database": "PDB", "url": "" }, { "id": "5BSJ", "database": "PDB", "url": "" }, { "id": "2OOZ", "database": "PDB", "url": "" }, { "id": "5BSC", "database": "PDB", "url": "" }, { "id": "1CA7", "database": "PDB", "url": "" }, { "id": "3HOF", "database": "PDB", "url": "" }, { "id": "4EVG", "database": "PDB", "url": "" }, { "id": "4ETG", "database": "PDB", "url": "" }, { "id": "1LJT", "database": "PDB", "url": "" }, { "id": "6BG7", "database": "PDB", "url": "" }, { "id": "4WR8", "database": "PDB", "url": "" }, { "id": "7XVX", "database": "PDB", "url": "" }, { "id": "6CB5", "database": "PDB", "url": "" }, { "id": "4Z15", "database": "PDB", "url": "" }, { "id": "6B1K", "database": "PDB", "url": "" }, { "id": "5J7P", "database": "PDB", "url": "" }, { "id": "6OY8", "database": "PDB", "url": "" }, { "id": "P14174", "database": "PRO", "url": "" }, { "id": "4TRF", "database": "PDB", "url": "" }, { "id": "3WNT", "database": "PDB", "url": "" }, { "id": "4OYQ", "database": "PDB", "url": "" }, { "id": "3SMC", "database": "PDB", "url": "" }, { "id": "6OYE", "database": "PDB", "url": "" }, { "id": "3JTU", "database": "PDB", "url": "" }, { "id": "1CGQ", "database": "PDB", "url": "" } ] }, { "participant_id": "R-HSA-8950444", "participant_name": "MIF gene [nucleoplasm]", "crossref": [ { "id": "ENSG00000240972", "database": "ENSEMBL", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A8I6AEZ4", "gene_name": "Dct", "activity": [ { "ec_number": "5.3.3.12", "activity": "L-dopachrome = 5,6-dihydroxyindole-2-carboxylate.", "evidence": [ { "id": "A0A8I6AEZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AEZ4" } ] }, { "ec_number": "5.3.3.12", "activity": "", "evidence": [ { "id": "A0A8I6AEZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AEZ4" } ] } ] }, { "uniprot_ac": "D3ZE63", "gene_name": "LOC679748", "activity": [ { "ec_number": "5.3.2.1", "activity": "3-phenylpyruvate = enol-phenylpyruvate.", "evidence": [ { "id": "D3ZE63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZE63" } ] }, { "ec_number": "5.3.3.12", "activity": "L-dopachrome = 5,6-dihydroxyindole-2-carboxylate.", "evidence": [ { "id": "D3ZE63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZE63" } ] }, { "ec_number": "5.3.2.1", "activity": "", "evidence": [ { "id": "D3ZE63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZE63" } ] }, { "ec_number": "5.3.3.12", "activity": "", "evidence": [ { "id": "D3ZE63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZE63" } ] } ] }, { "uniprot_ac": "D3ZQU2", "gene_name": "AABR07016805.1", "activity": [ { "ec_number": "5.3.2.1", "activity": "3-phenylpyruvate = enol-phenylpyruvate.", "evidence": [ { "id": "D3ZQU2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZQU2" } ] }, { "ec_number": "5.3.3.12", "activity": "L-dopachrome = 5,6-dihydroxyindole-2-carboxylate.", "evidence": [ { "id": "D3ZQU2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZQU2" } ] }, { "ec_number": "5.3.2.1", "activity": "", "evidence": [ { "id": "D3ZQU2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZQU2" } ] }, { "ec_number": "5.3.3.12", "activity": "", "evidence": [ { "id": "D3ZQU2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZQU2" } ] } ] }, { "uniprot_ac": "D3ZXK6", "gene_name": "RGD1565459", "activity": [ { "ec_number": "5.3.2.1", "activity": "3-phenylpyruvate = enol-phenylpyruvate.", "evidence": [ { "id": "D3ZXK6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZXK6" } ] }, { "ec_number": "5.3.3.12", "activity": "L-dopachrome = 5,6-dihydroxyindole-2-carboxylate.", "evidence": [ { "id": "D3ZXK6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZXK6" } ] }, { "ec_number": "5.3.3.12", "activity": "", "evidence": [ { "id": "D3ZXK6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZXK6" } ] }, { "ec_number": "5.3.2.1", "activity": "", "evidence": [ { "id": "D3ZXK6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZXK6" } ] } ] }, { "uniprot_ac": "D4A3P7", "gene_name": "LOC120102174", "activity": [ { "ec_number": "5.3.2.1", "activity": "3-phenylpyruvate = enol-phenylpyruvate.", "evidence": [ { "id": "D4A3P7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A3P7" } ] }, { "ec_number": "5.3.3.12", "activity": "L-dopachrome = 5,6-dihydroxyindole-2-carboxylate.", "evidence": [ { "id": "D4A3P7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A3P7" } ] }, { "ec_number": "5.3.2.1", "activity": "", "evidence": [ { "id": "D4A3P7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A3P7" } ] }, { "ec_number": "5.3.3.12", "activity": "", "evidence": [ { "id": "D4A3P7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A3P7" } ] } ] }, { "uniprot_ac": "F1LTZ6", "gene_name": "RGD1559921", "activity": [ { "ec_number": "5.3.2.1", "activity": "3-phenylpyruvate = enol-phenylpyruvate.", "evidence": [ { "id": "F1LTZ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LTZ6" } ] }, { "ec_number": "5.3.3.12", "activity": "L-dopachrome = 5,6-dihydroxyindole-2-carboxylate.", "evidence": [ { "id": "F1LTZ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LTZ6" } ] }, { "ec_number": "5.3.3.12", "activity": "", "evidence": [ { "id": "F1LTZ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LTZ6" } ] }, { "ec_number": "5.3.2.1", "activity": "", "evidence": [ { "id": "F1LTZ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LTZ6" } ] } ] }, { "uniprot_ac": "O00487", "gene_name": "PSMD14", "activity": [ { "ec_number": "3.4.19.-", "activity": "", "evidence": [ { "id": "O00487", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00487" } ] } ] }, { "uniprot_ac": "O00571", "gene_name": "DDX3X", "activity": [ { "ec_number": "3.6.4.13", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "O00571", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00571" } ] }, { "ec_number": "3.6.4.13", "activity": "", "evidence": [ { "id": "O00571", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00571" } ] } ] }, { "uniprot_ac": "O00764", "gene_name": "PDXK", "activity": [ { "ec_number": "2.7.1.35", "activity": "ATP + pyridoxal = ADP + H(+) + pyridoxal 5'-phosphate.", "evidence": [ { "id": "O00764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00764" } ] }, { "ec_number": "2.7.1.35", "activity": "", "evidence": [ { "id": "O00764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00764" } ] } ] }, { "uniprot_ac": "O75874", "gene_name": "IDH1", "activity": [ { "ec_number": "1.1.1.42", "activity": "D-threo-isocitrate + NADP(+) = 2-oxoglutarate + CO2 + NADPH.", "evidence": [ { "id": "O75874", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75874" } ] }, { "ec_number": "1.1.1.42", "activity": "", "evidence": [ { "id": "O75874", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75874" } ] } ] }, { "uniprot_ac": "P00491", "gene_name": "PNP", "activity": [ { "ec_number": "2.4.2.1", "activity": "a purine 2'-deoxy-D-ribonucleoside + phosphate = 2-deoxy-alpha-D-ribose 1-phosphate + a purine nucleobase.", "evidence": [ { "id": "P00491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00491" } ] }, { "ec_number": "2.4.2.1", "activity": "", "evidence": [ { "id": "P00491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00491" } ] } ] }, { "uniprot_ac": "P00746", "gene_name": "CFD", "activity": [ { "ec_number": "3.4.21.46", "activity": "Selective cleavage of Arg-|-Lys bond in complement factor B when in complex with complement subcomponent C3b or with cobra venom factor.", "evidence": [ { "id": "P00746", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00746" } ] }, { "ec_number": "3.4.21.46", "activity": "", "evidence": [ { "id": "P00746", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00746" } ] } ] }, { "uniprot_ac": "P02794", "gene_name": "FTH1", "activity": [ { "ec_number": "1.16.3.1", "activity": "4 Fe(2+) + 4 H(+) + O2 = 4 Fe(3+) + 2 H2O.", "evidence": [ { "id": "P02794", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02794" } ] }, { "ec_number": "1.16.3.1", "activity": "", "evidence": [ { "id": "P02794", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P02794" } ] } ] }, { "uniprot_ac": "P04040", "gene_name": "CAT", "activity": [ { "ec_number": "1.11.1.6", "activity": "2 H2O2 = 2 H2O + O2.", "evidence": [ { "id": "P04040", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04040" } ] }, { "ec_number": "1.11.1.6", "activity": "", "evidence": [ { "id": "P04040", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04040" } ] } ] }, { "uniprot_ac": "P04075", "gene_name": "ALDOA", "activity": [ { "ec_number": "4.1.2.13", "activity": "beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3-phosphate + dihydroxyacetone phosphate.", "evidence": [ { "id": "P04075", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04075" } ] }, { "ec_number": "4.1.2.13", "activity": "", "evidence": [ { "id": "P04075", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04075" } ] } ] }, { "uniprot_ac": "P06737", "gene_name": "PYGL", "activity": [ { "ec_number": "2.4.1.1", "activity": "[(1->4)-alpha-D-glucosyl](n) + phosphate = [(1->4)-alpha-D-glucosyl](n-1) + alpha-D-glucose 1-phosphate.", "evidence": [ { "id": "P06737", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06737" } ] }, { "ec_number": "2.4.1.1", "activity": "", "evidence": [ { "id": "P06737", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06737" } ] } ] }, { "uniprot_ac": "P06744", "gene_name": "GPI", "activity": [ { "ec_number": "5.3.1.9", "activity": "alpha-D-glucose 6-phosphate = beta-D-fructose 6-phosphate.", "evidence": [ { "id": "P06744", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06744" } ] }, { "ec_number": "5.3.1.9", "activity": "", "evidence": [ { "id": "P06744", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06744" } ] } ] }, { "uniprot_ac": "P07339", "gene_name": "CTSD", "activity": [ { "ec_number": "3.4.23.5", "activity": "Specificity similar to, but narrower than, that of pepsin A. Does not cleave the 4-Gln-|-His-5 bond in B chain of insulin.", "evidence": [ { "id": "P07339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07339" } ] }, { "ec_number": "3.4.23.5", "activity": "", "evidence": [ { "id": "P07339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07339" } ] } ] }, { "uniprot_ac": "P07384", "gene_name": "CAPN1", "activity": [ { "ec_number": "3.4.22.52", "activity": "Broad endopeptidase specificity.", "evidence": [ { "id": "P07384", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07384" } ] }, { "ec_number": "3.4.22.52", "activity": "", "evidence": [ { "id": "P07384", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07384" } ] } ] }, { "uniprot_ac": "P07741", "gene_name": "APRT", "activity": [ { "ec_number": "2.4.2.7", "activity": "AMP + diphosphate = 5-phospho-alpha-D-ribose 1-diphosphate + adenine.", "evidence": [ { "id": "P07741", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07741" } ] }, { "ec_number": "2.4.2.7", "activity": "", "evidence": [ { "id": "P07741", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07741" } ] } ] }, { "uniprot_ac": "P07858", "gene_name": "CTSB", "activity": [ { "ec_number": "3.4.22.1", "activity": "Hydrolysis of proteins with broad specificity for peptide bonds. Preferentially cleaves -Arg-Arg-|-Xaa bonds in small molecule substrates (thus differing from cathepsin L). In addition to being an endopeptidase, shows peptidyl-dipeptidase activity, liberating C-terminal dipeptides.", "evidence": [ { "id": "P07858", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07858" } ] }, { "ec_number": "3.4.22.1", "activity": "", "evidence": [ { "id": "P07858", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07858" } ] } ] }, { "uniprot_ac": "P07900", "gene_name": "HSP90AA1", "activity": [ { "ec_number": "3.6.4.10", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P07900", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07900" } ] }, { "ec_number": "3.6.4.10", "activity": "", "evidence": [ { "id": "P07900", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07900" } ] } ] }, { "uniprot_ac": "P08236", "gene_name": "GUSB", "activity": [ { "ec_number": "3.2.1.31", "activity": "a beta-D-glucuronoside + H2O = an alcohol + D-glucuronate.", "evidence": [ { "id": "P08236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08236" } ] }, { "ec_number": "3.2.1.31", "activity": "", "evidence": [ { "id": "P08236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08236" } ] } ] }, { "uniprot_ac": "P09211", "gene_name": "GSTP1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P09211", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09211" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P09211", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09211" } ] } ] }, { "uniprot_ac": "P09769", "gene_name": "FGR", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "P09769", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09769" } ] }, { "ec_number": "2.7.10.2", "activity": "", "evidence": [ { "id": "P09769", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09769" } ] } ] }, { "uniprot_ac": "P09917", "gene_name": "ALOX5", "activity": [ { "ec_number": "1.13.11.-", "activity": "", "evidence": [ { "id": "P09917", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09917" } ] }, { "ec_number": "1.13.11.34", "activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = H2O + leukotriene A4.", "evidence": [ { "id": "P09917", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09917" } ] } ] }, { "uniprot_ac": "P09960", "gene_name": "LTA4H", "activity": [ { "ec_number": "3.3.2.6", "activity": "H2O + leukotriene A4 = leukotriene B4.", "evidence": [ { "id": "P09960", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09960" } ] }, { "ec_number": "3.4.11.4", "activity": "Release of the N-terminal residue from a tripeptide.", "evidence": [ { "id": "P09960", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09960" } ] }, { "ec_number": "3.3.2.6", "activity": "", "evidence": [ { "id": "P09960", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09960" } ] } ] }, { "uniprot_ac": "P09972", "gene_name": "ALDOC", "activity": [ { "ec_number": "4.1.2.13", "activity": "beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3-phosphate + dihydroxyacetone phosphate.", "evidence": [ { "id": "P09972", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09972" } ] }, { "ec_number": "4.1.2.13", "activity": "", "evidence": [ { "id": "P09972", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09972" } ] } ] }, { "uniprot_ac": "P11142", "gene_name": "HSPA8", "activity": [ { "ec_number": "3.6.4.10", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P11142", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11142" } ] }, { "ec_number": "3.6.4.10", "activity": "", "evidence": [ { "id": "P11142", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11142" } ] } ] }, { "uniprot_ac": "P11678", "gene_name": "EPX", "activity": [ { "ec_number": "1.11.1.7", "activity": "2 a phenolic donor + H2O2 = 2 a phenolic radical donor + 2 H2O.", "evidence": [ { "id": "P11678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11678" } ] }, { "ec_number": "1.11.1.7", "activity": "", "evidence": [ { "id": "P11678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11678" } ] } ] }, { "uniprot_ac": "P12268", "gene_name": "IMPDH2", "activity": [ { "ec_number": "1.1.1.205", "activity": "H2O + IMP + NAD(+) = H(+) + NADH + XMP.", "evidence": [ { "id": "P12268", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12268" } ] }, { "ec_number": "1.1.1.205", "activity": "", "evidence": [ { "id": "P12268", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12268" } ] } ] }, { "uniprot_ac": "P12956", "gene_name": "XRCC6", "activity": [ { "ec_number": "4.2.99.-", "activity": "", "evidence": [ { "id": "P12956", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12956" } ] }, { "ec_number": "3.6.4.-", "activity": "", "evidence": [ { "id": "P12956", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12956" } ] } ] }, { "uniprot_ac": "P13010", "gene_name": "XRCC5", "activity": [ { "ec_number": "3.6.4.-", "activity": "", "evidence": [ { "id": "P13010", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13010" } ] } ] }, { "uniprot_ac": "P13639", "gene_name": "EEF2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P13639", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13639" } ] } ] }, { "uniprot_ac": "P13716", "gene_name": "ALAD", "activity": [ { "ec_number": "4.2.1.24", "activity": "2 5-aminolevulinate = H(+) + 2 H2O + porphobilinogen.", "evidence": [ { "id": "P13716", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13716" } ] }, { "ec_number": "4.2.1.24", "activity": "", "evidence": [ { "id": "P13716", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13716" } ] } ] }, { "uniprot_ac": "P13798", "gene_name": "APEH", "activity": [ { "ec_number": "3.4.19.1", "activity": "Internal cleavage of oxidized and glycated proteins.", "evidence": [ { "id": "P13798", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13798" } ] }, { "ec_number": "3.4.19.1", "activity": "", "evidence": [ { "id": "P13798", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13798" } ] } ] }, { "uniprot_ac": "P14174", "gene_name": "MIF", "activity": [ { "ec_number": "5.3.2.1", "activity": "3-phenylpyruvate = enol-phenylpyruvate.", "evidence": [ { "id": "P14174", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14174" } ] }, { "ec_number": "5.3.3.12", "activity": "L-dopachrome = 5,6-dihydroxyindole-2-carboxylate.", "evidence": [ { "id": "P14174", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14174" } ] }, { "ec_number": "5.3.2.1", "activity": "", "evidence": [ { "id": "P14174", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14174" } ] } ] }, { "uniprot_ac": "P14618", "gene_name": "PKM", "activity": [ { "ec_number": "2.7.1.40", "activity": "CTP + pyruvate = CDP + H(+) + phosphoenolpyruvate.", "evidence": [ { "id": "P14618", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14618" } ] }, { "ec_number": "2.7.1.40", "activity": "", "evidence": [ { "id": "P14618", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14618" } ] }, { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "P14618", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14618" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P14618", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14618" } ] } ] }, { "uniprot_ac": "P14780", "gene_name": "MMP9", "activity": [ { "ec_number": "3.4.24.35", "activity": "Cleavage of gelatin types I and V and collagen types IV and V.", "evidence": [ { "id": "P14780", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14780" } ] }, { "ec_number": "3.4.24.35", "activity": "", "evidence": [ { "id": "P14780", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14780" } ] } ] }, { "uniprot_ac": "P15586", "gene_name": "GNS", "activity": [ { "ec_number": "3.1.6.14", "activity": "Hydrolysis of the 6-sulfate groups of the N-acetyl-D-glucosamine 6-sulfate units of heparan sulfate and keratan sulfate.", "evidence": [ { "id": "P15586", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15586" } ] }, { "ec_number": "3.1.6.14", "activity": "", "evidence": [ { "id": "P15586", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15586" } ] } ] }, { "uniprot_ac": "P15848", "gene_name": "ARSB", "activity": [ { "ec_number": "3.1.6.12", "activity": "Hydrolysis of the 4-sulfate groups of the N-acetyl-D-galactosamine 4-sulfate units of chondroitin sulfate and dermatan sulfate.", "evidence": [ { "id": "P15848", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15848" } ] }, { "ec_number": "3.1.6.12", "activity": "", "evidence": [ { "id": "P15848", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15848" } ] } ] }, { "uniprot_ac": "P16278", "gene_name": "GLB1", "activity": [ { "ec_number": "3.2.1.23", "activity": "Hydrolysis of terminal non-reducing beta-D-galactose residues in beta-D-galactosides.", "evidence": [ { "id": "P16278", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16278" } ] }, { "ec_number": "3.2.1.23", "activity": "", "evidence": [ { "id": "P16278", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16278" } ] } ] }, { "uniprot_ac": "P17858", "gene_name": "PFKL", "activity": [ { "ec_number": "2.7.1.11", "activity": "ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 1,6-bisphosphate + H(+).", "evidence": [ { "id": "P17858", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17858" } ] }, { "ec_number": "2.7.1.11", "activity": "", "evidence": [ { "id": "P17858", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17858" } ] } ] }, { "uniprot_ac": "P18669", "gene_name": "PGAM1", "activity": [ { "ec_number": "5.4.2.11", "activity": "(2R)-2-phosphoglycerate = (2R)-3-phosphoglycerate.", "evidence": [ { "id": "P18669", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18669" } ] }, { "ec_number": "5.4.2.4", "activity": "(2R)-3-phospho-glyceroyl phosphate = (2R)-2,3-bisphosphoglycerate + H(+).", "evidence": [ { "id": "P18669", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18669" } ] }, { "ec_number": "5.4.2.4", "activity": "", "evidence": [ { "id": "P18669", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18669" } ] }, { "ec_number": "5.4.2.11", "activity": "", "evidence": [ { "id": "P18669", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18669" } ] } ] }, { "uniprot_ac": "P20839", "gene_name": "IMPDH1", "activity": [ { "ec_number": "1.1.1.205", "activity": "H2O + IMP + NAD(+) = H(+) + NADH + XMP.", "evidence": [ { "id": "P20839", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20839" } ] }, { "ec_number": "1.1.1.205", "activity": "", "evidence": [ { "id": "P20839", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20839" } ] } ] }, { "uniprot_ac": "P22392", "gene_name": "NME2", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P22392", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22392" } ] }, { "ec_number": "2.7.13.3", "activity": "ATP + protein L-histidine = ADP + protein N-phospho-L-histidine.", "evidence": [ { "id": "P22392", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22392" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P22392", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22392" } ] }, { "ec_number": "2.7.13.3", "activity": "", "evidence": [ { "id": "P22392", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22392" } ] } ] }, { "uniprot_ac": "P25774", "gene_name": "CTSS", "activity": [ { "ec_number": "3.4.22.27", "activity": "Similar to cathepsin L, but with much less activity on Z-Phe-Arg-|-NHMec, and more activity on the Z-Val-Val-Arg-|-Xaa compound.", "evidence": [ { "id": "P25774", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25774" } ] }, { "ec_number": "3.4.22.27", "activity": "", "evidence": [ { "id": "P25774", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25774" } ] } ] }, { "uniprot_ac": "P28482", "gene_name": "MAPK1", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P28482", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28482" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P28482", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28482" } ] } ] }, { "uniprot_ac": "P29812", "gene_name": "Dct", "activity": [ { "ec_number": "5.3.3.12", "activity": "L-dopachrome = 5,6-dihydroxyindole-2-carboxylate.", "evidence": [ { "id": "P29812", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29812" } ] }, { "ec_number": "5.3.3.12", "activity": "", "evidence": [ { "id": "P29812", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29812" } ] } ] }, { "uniprot_ac": "P30904", "gene_name": "Mif", "activity": [ { "ec_number": "5.3.2.1", "activity": "3-phenylpyruvate = enol-phenylpyruvate.", "evidence": [ { "id": "P30904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30904" } ] }, { "ec_number": "5.3.3.12", "activity": "L-dopachrome = 5,6-dihydroxyindole-2-carboxylate.", "evidence": [ { "id": "P30904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30904" } ] }, { "ec_number": "5.3.3.12", "activity": "", "evidence": [ { "id": "P30904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30904" } ] }, { "ec_number": "5.3.2.1", "activity": "", "evidence": [ { "id": "P30904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30904" } ] } ] }, { "uniprot_ac": "P32320", "gene_name": "CDA", "activity": [ { "ec_number": "3.5.4.5", "activity": "2'-deoxycytidine + H(+) + H2O = 2'-deoxyuridine + NH4(+).", "evidence": [ { "id": "P32320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32320" } ] }, { "ec_number": "3.5.4.5", "activity": "", "evidence": [ { "id": "P32320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32320" } ] } ] }, { "uniprot_ac": "P34884", "gene_name": "Mif", "activity": [ { "ec_number": "5.3.2.1", "activity": "3-phenylpyruvate = enol-phenylpyruvate.", "evidence": [ { "id": "P34884", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34884" } ] }, { "ec_number": "5.3.3.12", "activity": "L-dopachrome = 5,6-dihydroxyindole-2-carboxylate.", "evidence": [ { "id": "P34884", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34884" } ] }, { "ec_number": "5.3.2.1", "activity": "", "evidence": [ { "id": "P34884", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34884" } ] } ] }, { "uniprot_ac": "P36871", "gene_name": "PGM1", "activity": [ { "ec_number": "5.4.2.2", "activity": "alpha-D-glucose 1-phosphate = alpha-D-glucose 6-phosphate.", "evidence": [ { "id": "P36871", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36871" } ] }, { "ec_number": "5.4.2.2", "activity": "", "evidence": [ { "id": "P36871", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36871" } ] } ] }, { "uniprot_ac": "P40126", "gene_name": "DCT", "activity": [ { "ec_number": "5.3.3.12", "activity": "L-dopachrome = 5,6-dihydroxyindole-2-carboxylate.", "evidence": [ { "id": "P40126", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40126" } ] }, { "ec_number": "5.3.3.12", "activity": "", "evidence": [ { "id": "P40126", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40126" } ] } ] }, { "uniprot_ac": "P46976", "gene_name": "GYG1", "activity": [ { "ec_number": "2.4.1.186", "activity": "[1,4-alpha-D-glucosyl](n)-L-tyrosyl-[glycogenin] + UDP-alpha-D-glucose = [1,4-alpha-D-glucosyl](n+1)-L-tyrosyl-[glycogenin] + H(+) + UDP.", "evidence": [ { "id": "P46976", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46976" } ] }, { "ec_number": "2.4.1.186", "activity": "", "evidence": [ { "id": "P46976", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46976" } ] } ] }, { "uniprot_ac": "P52790", "gene_name": "HK3", "activity": [ { "ec_number": "2.7.1.1", "activity": "ATP + D-fructose = ADP + D-fructose 6-phosphate + H(+).", "evidence": [ { "id": "P52790", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52790" } ] }, { "ec_number": "2.7.1.1", "activity": "", "evidence": [ { "id": "P52790", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52790" } ] }, { "ec_number": "2.7.1.-", "activity": "", "evidence": [ { "id": "P52790", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52790" } ] } ] }, { "uniprot_ac": "P53396", "gene_name": "ACLY", "activity": [ { "ec_number": "2.3.3.8", "activity": "acetyl-CoA + ADP + oxaloacetate + phosphate = ATP + citrate + CoA.", "evidence": [ { "id": "P53396", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53396" } ] }, { "ec_number": "2.3.3.8", "activity": "", "evidence": [ { "id": "P53396", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53396" } ] } ] }, { "uniprot_ac": "P55072", "gene_name": "VCP", "activity": [ { "ec_number": "3.6.4.6", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P55072", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55072" } ] }, { "ec_number": "3.6.4.6", "activity": "", "evidence": [ { "id": "P55072", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55072" } ] } ] }, { "uniprot_ac": "P62937", "gene_name": "PPIA", "activity": [ { "ec_number": "5.2.1.8", "activity": "[protein]-peptidylproline (omega=180) = [protein]-peptidylproline (omega=0).", "evidence": [ { "id": "P62937", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62937" } ] }, { "ec_number": "5.2.1.8", "activity": "", "evidence": [ { "id": "P62937", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62937" } ] } ] }, { "uniprot_ac": "P68104", "gene_name": "EEF1A1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P68104", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68104" } ] } ] }, { "uniprot_ac": "P68402", "gene_name": "PAFAH1B2", "activity": [ { "ec_number": "3.1.1.47", "activity": "a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + acetate + H(+).", "evidence": [ { "id": "P68402", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68402" } ] }, { "ec_number": "3.1.1.47", "activity": "", "evidence": [ { "id": "P68402", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68402" } ] } ] }, { "uniprot_ac": "P98066", "gene_name": "TNFAIP6", "activity": [ { "ec_number": "3.1.1.-", "activity": "", "evidence": [ { "id": "P98066", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P98066" } ] } ] }, { "uniprot_ac": "Q01432", "gene_name": "AMPD3", "activity": [ { "ec_number": "3.5.4.6", "activity": "AMP + H(+) + H2O = IMP + NH4(+).", "evidence": [ { "id": "Q01432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01432" } ] }, { "ec_number": "3.5.4.6", "activity": "", "evidence": [ { "id": "Q01432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01432" } ] } ] }, { "uniprot_ac": "Q13162", "gene_name": "PRDX4", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "Q13162", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13162" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "Q13162", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13162" } ] } ] }, { "uniprot_ac": "Q13464", "gene_name": "ROCK1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q13464", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13464" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q13464", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13464" } ] } ] }, { "uniprot_ac": "Q13510", "gene_name": "ASAH1", "activity": [ { "ec_number": "3.5.1.23", "activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.", "evidence": [ { "id": "Q13510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13510" } ] }, { "ec_number": "3.5.1.23", "activity": "", "evidence": [ { "id": "Q13510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13510" } ] }, { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q13510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13510" } ] } ] }, { "uniprot_ac": "Q14004", "gene_name": "CDK13", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q14004", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14004" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "Q14004", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14004" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q14004", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14004" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "Q14004", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14004" } ] } ] }, { "uniprot_ac": "Q16539", "gene_name": "MAPK14", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q16539", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16539" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "Q16539", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16539" } ] } ] }, { "uniprot_ac": "Q16769", "gene_name": "QPCT", "activity": [ { "ec_number": "2.3.2.5", "activity": "N-terminal L-glutaminyl-[peptide] = N-terminal 5-oxo-L-prolyl-[peptide] + NH4(+).", "evidence": [ { "id": "Q16769", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16769" } ] }, { "ec_number": "2.3.2.5", "activity": "", "evidence": [ { "id": "Q16769", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16769" } ] } ] }, { "uniprot_ac": "Q7Z6Z7", "gene_name": "HUWE1", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q7Z6Z7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z6Z7" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q7Z6Z7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z6Z7" } ] } ] }, { "uniprot_ac": "Q8WVQ1", "gene_name": "CANT1", "activity": [ { "ec_number": "3.6.1.6", "activity": "ADP + H2O = AMP + H(+) + phosphate.", "evidence": [ { "id": "Q8WVQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WVQ1" } ] }, { "ec_number": "3.6.1.6", "activity": "", "evidence": [ { "id": "Q8WVQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WVQ1" } ] } ] }, { "uniprot_ac": "Q96G03", "gene_name": "PGM2", "activity": [ { "ec_number": "5.4.2.2", "activity": "alpha-D-glucose 1-phosphate = alpha-D-glucose 6-phosphate.", "evidence": [ { "id": "Q96G03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96G03" } ] }, { "ec_number": "5.4.2.7", "activity": "2-deoxy-alpha-D-ribose 1-phosphate = 2-deoxy-D-ribose 5-phosphate.", "evidence": [ { "id": "Q96G03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96G03" } ] }, { "ec_number": "5.4.2.7", "activity": "", "evidence": [ { "id": "Q96G03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96G03" } ] } ] }, { "uniprot_ac": "Q99436", "gene_name": "PSMB7", "activity": [ { "ec_number": "3.4.25.1", "activity": "Cleavage of peptide bonds with very broad specificity.", "evidence": [ { "id": "Q99436", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99436" } ] }, { "ec_number": "3.4.25.1", "activity": "", "evidence": [ { "id": "Q99436", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99436" } ] } ] }, { "uniprot_ac": "Q9P0J7", "gene_name": "KCMF1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9P0J7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9P0J7" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9P0J7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9P0J7" } ] } ] }, { "uniprot_ac": "Q9UBR2", "gene_name": "CTSZ", "activity": [ { "ec_number": "3.4.18.1", "activity": "Release of C-terminal amino acid residues with broad specificity, but lacks action on C-terminal proline. Shows weak endopeptidase activity.", "evidence": [ { "id": "Q9UBR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UBR2" } ] }, { "ec_number": "3.4.18.1", "activity": "", "evidence": [ { "id": "Q9UBR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UBR2" } ] } ] }, { "uniprot_ac": "Q9UNP9", "gene_name": "PPIE", "activity": [ { "ec_number": "5.2.1.8", "activity": "[protein]-peptidylproline (omega=180) = [protein]-peptidylproline (omega=0).", "evidence": [ { "id": "Q9UNP9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UNP9" } ] }, { "ec_number": "5.2.1.8", "activity": "", "evidence": [ { "id": "Q9UNP9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UNP9" } ] } ] }, { "uniprot_ac": "Q9VG08", "gene_name": "yellow-f2", "activity": [ { "ec_number": "5.3.3.12", "activity": "L-dopachrome = 5,6-dihydroxyindole-2-carboxylate.", "evidence": [ { "id": "Q9VG08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG08" } ] }, { "ec_number": "5.3.3.12", "activity": "", "evidence": [ { "id": "Q9VG08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG08" } ] } ] }, { "uniprot_ac": "Q9VG09", "gene_name": "yellow-f", "activity": [ { "ec_number": "5.3.3.12", "activity": "L-dopachrome = 5,6-dihydroxyindole-2-carboxylate.", "evidence": [ { "id": "Q9VG09", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG09" } ] }, { "ec_number": "5.3.3.12", "activity": "", "evidence": [ { "id": "Q9VG09", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG09" } ] } ] }, { "uniprot_ac": "Q9Y315", "gene_name": "DERA", "activity": [ { "ec_number": "4.1.2.4", "activity": "2-deoxy-D-ribose 5-phosphate = acetaldehyde + D-glyceraldehyde 3-phosphate.", "evidence": [ { "id": "Q9Y315", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y315" } ] }, { "ec_number": "4.1.2.4", "activity": "", "evidence": [ { "id": "Q9Y315", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y315" } ] } ] } ], "biomarkers": [ { "assessed_biomarker_entity": "Ovarian cancer OPN, MUC16, LEP, PRL, IGF2, MIF expression panel", "biomarker_id": "A0461", "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "18258665", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18258665" } ], "instances": [ { "best_biomarker_type": "risk", "status": "increased MUC16, OPN, LEP, PRL, IGF2, MIF level", "disease": { "disease_id": "DOID:2394", "recommended_name": { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovarian cancer", "description": "A female reproductive organ cancer that is located_in the ovary." }, "synonyms": [ { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "malignant Ovarian tumor", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "malignant tumour of ovary", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovarian neoplasm", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovary neoplasm", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "primary ovarian cancer", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "tumor of the Ovary", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to, 1", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "OVCAS1", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to, 1", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer", "description": "A primary or metastatic malignant neoplasm involving the ovary. Most primary malignant ovarian neoplasms are either carcinomas (serous, mucinous, or endometrioid adenocarcinomas) or malignant germ cell tumors. Metastatic malignant neoplasms to the ovary include carcinomas, lymphomas, and melanomas." }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovary neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "tumor of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "tumour of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "cancer of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "cancer of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant neoplasm of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant neoplasm of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian tumor", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian tumour", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovary neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumor of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumor of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumour of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumour of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer, somatic", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian malignant tumor", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian malignant tumour", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovary cancer", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer, epithelial", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "primary ovarian cancer", "description": "" }, { "id": "MIM:167000", "resource": "MIM", "url": "https://www.omim.org/entry/167000", "name": "Ovarian cancer", "description": "Ovarian cancer" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "18258665", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18258665" } ] } ] } ], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 112, 113 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 37 ], "sequon_annotation_sites": [ { "start_pos": 110, "end_pos": 112 }, { "start_pos": 111, "end_pos": 113 }, { "start_pos": 73, "end_pos": 75 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 101 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }