{ "uniprot_canonical_ac": "P14136-1", "uniprot_ac": "P14136", "uniprot_id": "GFAP_HUMAN", "mass": { "chemical_mass": 49880.0, "monoisotopic_mass": 49880.0 }, "refseq": { "ac": "NP_001124491", "name": "glial fibrillary acidic protein isoform 2", "summary": "This gene encodes one of the major intermediate filament proteins of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Oct 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124491" }, "gene_names": [ { "name": "GFAP", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P14136", "id": "P14136" }, { "name": "ALXDRD", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124491", "id": "NP_001124491" }, { "name": "GFAP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124491", "id": "NP_001124491" } ], "protein_names": [ { "name": "Glial fibrillary acidic protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P14136" }, { "name": "GFAP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P14136" }, { "name": "glial fibrillary acidic protein isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124491", "id": "NP_001124491" } ], "function": [ { "annotation": "Alexander disease genetics: Beyond GFAP exon sequencing?", "evidence": [ { "database": "RefSeq", "id": "NP_001124491", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124491" }, { "database": "PubMed", "id": "37990643", "url": "https://glygen.org/publication/PubMed/37990643" } ] }, { "annotation": "GFAP, a class-III intermediate filament, is a cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells.", "evidence": [ { "database": "UniProtKB", "id": "K7EJU1", "url": "https://www.uniprot.org/uniprot/K7EJU1#function" }, { "database": "UniProtKB", "id": "ARBA00002194", "url": "https://www.uniprot.org/uniprot/ARBA00002194#function" }, { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136#function" }, { "database": "UniProtKB", "id": "A0A1X7SBR3", "url": "https://www.uniprot.org/uniprot/A0A1X7SBR3#function" }, { "database": "UniProtKB", "id": "A0A1W2PR46", "url": "https://www.uniprot.org/uniprot/A0A1W2PR46#function" }, { "database": "UniProtKB", "id": "K7EKH9", "url": "https://www.uniprot.org/uniprot/K7EKH9#function" }, { "database": "UniProtKB", "id": "B4DIR1", "url": "https://www.uniprot.org/uniprot/B4DIR1#function" }, { "database": "UniProtKB", "id": "K7ELP4", "url": "https://www.uniprot.org/uniprot/K7ELP4#function" }, { "database": "UniProtKB", "id": "A0A1X7SCE1", "url": "https://www.uniprot.org/uniprot/A0A1X7SCE1#function" } ] }, { "annotation": "Glial Fibrillary Acidic Protein (GFAP) Astrocytopathy: An Emerging Cause of Meningoencephalomyelitis in Children and Adolescents.", "evidence": [ { "database": "RefSeq", "id": "NP_001124491", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124491" }, { "database": "PubMed", "id": "37981797", "url": "https://glygen.org/publication/PubMed/37981797" } ] }, { "annotation": "Neurofilament Light Chain and Glial Fibrillary Acidic Protein as early prognostic biomarkers after out-of-hospital cardiac arrest.", "evidence": [ { "database": "RefSeq", "id": "NP_001124491", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124491" }, { "database": "PubMed", "id": "37778613", "url": "https://glygen.org/publication/PubMed/37778613" } ] }, { "annotation": "Serum beta-synuclein, neurofilament light chain and glial fibrillary acidic protein as prognostic biomarkers in moderate-to-severe acute ischemic stroke. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001124491", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124491" }, { "database": "PubMed", "id": "38017278", "url": "https://glygen.org/publication/PubMed/38017278" } ] }, { "annotation": "This gene encodes one of the major intermediate filament proteins of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Oct 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001124491", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124491" } ] } ], "disease": [ { "disease_id": "DOID:4252", "recommended_name": { "id": "DOID:4252", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4252", "name": "Alexander disease", "description": "A leukodystrophy that is characterized by the destruction of white matter and the formation of Rosenthal fibers consisting of abnormal clumps of protein that accumulate in astrocytes." }, "synonyms": [ { "id": "DOID:4252", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4252", "name": "Alexander's disease", "description": "" }, { "id": "MONDO:0008752", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008752", "name": "Alexander disease", "description": "Alexander disease (AxD) is a rare neurodegenerative disorder of the astrocytes comprised of two clinical forms: AxD Type I and Type II manifesting with various degrees of macrocephaly, spasticity, ataxia and seizures and leading to psychomotor regression and death." }, { "id": "MONDO:0008752", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008752", "name": "Alexander disease", "description": "" }, { "id": "MONDO:0008752", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008752", "name": "Alexander's disease", "description": "" }, { "id": "MONDO:0008752", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008752", "name": "AxD", "description": "" }, { "id": "MONDO:0008752", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008752", "name": "ALXDRD", "description": "" }, { "id": "MONDO:0008752", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008752", "name": "alexanders leukodystrophy", "description": "" }, { "id": "MONDO:0008752", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008752", "name": "megalencephaly in infancy accompanied by progressive spasticity and dementia", "description": "" }, { "id": "MIM:203450", "resource": "MIM", "url": "https://www.omim.org/entry/203450", "name": "Alexander disease", "description": "Alexander disease" } ], "evidence": [ { "id": "203450", "database": "MIM", "url": "https://www.omim.org/entry/203450" } ] } ], "snv": [ { "evidence": [ { "id": "rs267607517", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs267607517" }, { "id": "rs267607517", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs267607517" }, { "id": "rs267607517", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs267607517#frequency_tab" }, { "id": "rs267607517", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs267607517" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 383, "end_pos": 383, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TFS->NFS); o-glyco-site-loss (T->N).", "chr_id": "17", "chr_pos": "44910638", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T383", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs544232705", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs544232705" }, { "id": "rs544232705", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs544232705#frequency_tab" }, { "id": "rs544232705", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs544232705" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 135, "end_pos": 135, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSA->NST).", "chr_id": "17", "chr_pos": "44915084", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A135", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs141400812", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141400812" }, { "id": "rs141400812", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs141400812" }, { "id": "rs141400812", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141400812" }, { "id": "rs141400812", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs141400812#frequency_tab" }, { "id": "rs141400812", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs141400812" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 145, "end_pos": 145, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLA->NLT).", "chr_id": "17", "chr_pos": "44915054", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.000998", "site_lbl": "A145", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs59291670", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs59291670" }, { "id": "rs59291670", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs59291670" }, { "id": "rs59291670", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs59291670" }, { "id": "rs59291670", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs59291670#frequency_tab" }, { "id": "rs59291670", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs59291670" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 157, "end_pos": 157, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DET->NET).", "chr_id": "17", "chr_pos": "44914081", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.003994", "site_lbl": "D157", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs749123868", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749123868" }, { "id": "rs749123868", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749123868" }, { "id": "rs749123868", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749123868" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 162, "end_pos": 162, "sequence_org": "R", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLR->NLS).", "chr_id": "17", "chr_pos": "44914064", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "R162", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs267607517", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs267607517" }, { "id": "rs267607517", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs267607517" }, { "id": "rs267607517", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs267607517#frequency_tab" }, { "id": "rs267607517", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs267607517" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 383, "end_pos": 383, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "17", "chr_pos": "44910638", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T383", "disease": [ { "disease_id": "DOID:4252", "recommended_name": { "id": "DOID:4252", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4252", "name": "Alexander disease", "description": "A leukodystrophy that is characterized by the destruction of white matter and the formation of Rosenthal fibers consisting of abnormal clumps of protein that accumulate in astrocytes." }, "synonyms": [ { "id": "DOID:4252", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4252", "name": "Alexander's disease", "description": "" }, { "id": "MONDO:0008752", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008752", "name": "Alexander disease", "description": "Alexander disease (AxD) is a rare neurodegenerative disorder of the astrocytes comprised of two clinical forms: AxD Type I and Type II manifesting with various degrees of macrocephaly, spasticity, ataxia and seizures and leading to psychomotor regression and death." }, { "id": "MONDO:0008752", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008752", "name": "Alexander disease", "description": "" }, { "id": "MONDO:0008752", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008752", "name": "Alexander's disease", "description": "" }, { "id": "MONDO:0008752", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008752", "name": "AxD", "description": "" }, { "id": "MONDO:0008752", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008752", "name": "ALXDRD", "description": "" }, { "id": "MONDO:0008752", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008752", "name": "alexanders leukodystrophy", "description": "" }, { "id": "MONDO:0008752", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008752", "name": "megalencephaly in infancy accompanied by progressive spasticity and dementia", "description": "" }, { "id": "MIM:203450", "resource": "MIM", "url": "https://www.omim.org/entry/203450", "name": "Alexander disease", "description": "Alexander disease" } ] } ], "keywords": [ "ebi", "germline", "disease" ] }, { "evidence": [ { "id": "rs1475697926", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1475697926" }, { "id": "rs1475697926", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1475697926" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 51, "end_pos": 51, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DFS->NFS).", "chr_id": "17", "chr_pos": "44915336", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D51", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs59793293", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs59793293" }, { "id": "rs59793293", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs59793293" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 79, "end_pos": 79, "sequence_org": "R", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDR->NDS).", "chr_id": "17", "chr_pos": "44915252", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "R79", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs768288825", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768288825" }, { "id": "rs768288825", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768288825" }, { "id": "rs768288825", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768288825" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 96, "end_pos": 96, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NKA->NKT).", "chr_id": "17", "chr_pos": "44915201", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A96", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "59.06", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131095", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131095" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "41.27", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000131095", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131095" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "47.95", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131095", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131095" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "57.82", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131095", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131095" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "61.34", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131095", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131095" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "51.97", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131095", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131095" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "59.62", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131095", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131095" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "54.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131095", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131095" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "69.3", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131095", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131095" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "52.99", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131095", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131095" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "58.78", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131095", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131095" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "64.74", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131095", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131095" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "75.82", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000131095", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131095" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P14136", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14136" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P14136", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14136" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P14136", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14136" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P14136", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14136" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P14136", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14136" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P14136", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14136" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P14136", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14136" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P14136", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14136" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P14136", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14136" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P14136", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14136" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P14136", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14136" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P14136", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P14136" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "common_name": "Human" } ], "gene": [ { "name": "GFAP", "url": "https://www.uniprot.org/uniprot/P14136", "locus": { "chromosome": "17", "start_pos": 44903159, "end_pos": 44916937, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000131095", "url": "https://www.ensembl.org/id/ENSG00000131095" } ] } } ], "crossref": [ { "id": "ENSG00000131095", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131095", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "GFAP", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GFAP", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "2670", "url": "https://www.ncbi.nlm.nih.gov/gene/2670", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "4235", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4235", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P14136", "url": "https://www.ebi.ac.uk/intact/interactors/id:P14136*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR006821", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006821", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018039", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018039", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039008", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039008", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:2670", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2670", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "137780", "url": "http://www.omim.org/entry/137780", "database": "MIM", "categories": [ "Other" ] }, { "id": "203450", "url": "http://www.omim.org/entry/203450", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P14136", "url": "https://www.nextprot.org/entry/NX_P14136", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P14136", "url": "https://oglcnac.org/atlas/detail/P14136", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P14136", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P14136", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "IMAHQVH", "url": "https://omabrowser.org/oma/group/IMAHQVH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4640531at2759", "url": "http://www.orthodb.org/?query=4640531at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR45652", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45652", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45652:SF9", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45652:SF9", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "6A9P", "url": "https://www.rcsb.org/structure/6A9P", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00038", "url": "http://pfam.xfam.org/family/PF00038", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF04732", "url": "http://pfam.xfam.org/family/PF04732", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P14136", "url": "https://pharos.nih.gov/targets/P14136", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P14136", "url": "http://purl.obolibrary.org/obo/PR_P14136", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001124491", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124491", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0G2JLI8", "url": "https://www.uniprot.org/uniprot/A0A0G2JLI8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JLI8-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JLI8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PP21", "url": "https://www.uniprot.org/uniprot/A0A1W2PP21", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PP21-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PP21-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PPA3", "url": "https://www.uniprot.org/uniprot/A0A1W2PPA3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PPA3-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PPA3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PPF0", "url": "https://www.uniprot.org/uniprot/A0A1W2PPF0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PPF0-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PPF0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PPL2", "url": "https://www.uniprot.org/uniprot/A0A1W2PPL2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PPL2-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PPL2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQ25", "url": "https://www.uniprot.org/uniprot/A0A1W2PQ25", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQ25-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PQ25-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQS4", "url": "https://www.uniprot.org/uniprot/A0A1W2PQS4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQS4-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PQS4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQU7", "url": "https://www.uniprot.org/uniprot/A0A1W2PQU7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQU7-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PQU7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PR46", "url": "https://www.uniprot.org/uniprot/A0A1W2PR46", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PR46-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PR46-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PRT3", "url": "https://www.uniprot.org/uniprot/A0A1W2PRT3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PRT3-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PRT3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PS58", "url": "https://www.uniprot.org/uniprot/A0A1W2PS58", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PS58-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PS58-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1X7SBR3", "url": "https://www.uniprot.org/uniprot/A0A1X7SBR3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1X7SBR3-1", "url": "https://www.uniprot.org/uniprot/A0A1X7SBR3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1X7SCE1", "url": "https://www.uniprot.org/uniprot/A0A1X7SCE1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1X7SCE1-1", "url": "https://www.uniprot.org/uniprot/A0A1X7SCE1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B4DIR1", "url": "https://www.uniprot.org/uniprot/B4DIR1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B4DIR1-1", "url": "https://www.uniprot.org/uniprot/B4DIR1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EJK1", "url": "https://www.uniprot.org/uniprot/K7EJK1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EJK1-1", "url": "https://www.uniprot.org/uniprot/K7EJK1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EJU1", "url": "https://www.uniprot.org/uniprot/K7EJU1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EJU1-1", "url": "https://www.uniprot.org/uniprot/K7EJU1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EKD1", "url": "https://www.uniprot.org/uniprot/K7EKD1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EKD1-1", "url": "https://www.uniprot.org/uniprot/K7EKD1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EKH9", "url": "https://www.uniprot.org/uniprot/K7EKH9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EKH9-1", "url": "https://www.uniprot.org/uniprot/K7EKH9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7ELP4", "url": "https://www.uniprot.org/uniprot/K7ELP4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7ELP4-1", "url": "https://www.uniprot.org/uniprot/K7ELP4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EPI4", "url": "https://www.uniprot.org/uniprot/K7EPI4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EPI4-1", "url": "https://www.uniprot.org/uniprot/K7EPI4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EPT8", "url": "https://www.uniprot.org/uniprot/K7EPT8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EPT8-1", "url": "https://www.uniprot.org/uniprot/K7EPT8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P14136-1", "url": "https://www.uniprot.org/uniprot/P14136-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P14136-2", "url": "https://www.uniprot.org/uniprot/P14136-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P14136-3", "url": "https://www.uniprot.org/uniprot/P14136-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM", "length": 432, "header": "sp|P14136-1|GFAP_HUMAN Isoform 1 of Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1 CANONICAL=P14136-1" }, "isoforms": [ { "isoform_ac": "A0A0G2JLI8-1", "url": "", "sequence": { "sequence": "MERRRITS", "length": 8, "header": "tr|A0A0G2JLI8-1|A0A0G2JLI8_HUMAN Computationally mapped isoform of Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=4 SV=4 CANONICAL=P14136-1" }, "locus": { "chromosome": "17", "start_pos": 44915486, "end_pos": 44915463, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000593179.1", "url": "https://www.ensembl.org/id/ENST00000593179.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000467106.1", "url": "https://www.ensembl.org/id/ENSP00000467106.1" } ] } }, { "isoform_ac": "A0A1W2PP21-1", "url": "", "sequence": { "sequence": "XSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEGTHPETSGII", "length": 46, "header": "tr|A0A1W2PP21-1|A0A1W2PP21_HUMAN Computationally mapped isoform of Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1 CANONICAL=P14136-1" }, "locus": { "chromosome": "17", "start_pos": 44910635, "end_pos": 44905119, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000639369.1", "url": "https://www.ensembl.org/id/ENST00000639369.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000491243.1", "url": "https://www.ensembl.org/id/ENSP00000491243.1" } ] } }, { "isoform_ac": "A0A1W2PPA3-1", "url": "", "sequence": { "sequence": "XEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEGTHPETSGII", "length": 69, "header": "tr|A0A1W2PPA3-1|A0A1W2PPA3_HUMAN Computationally mapped isoform of Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1 CANONICAL=P14136-1" }, "locus": { "chromosome": "17", "start_pos": 44911281, "end_pos": 44905119, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000638304.1", "url": "https://www.ensembl.org/id/ENST00000638304.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000491042.1", "url": "https://www.ensembl.org/id/ENSP00000491042.1" } ] } }, { "isoform_ac": "A0A1W2PPF0-1", "url": "", "sequence": { "sequence": "XRDGEGTHPETSGII", "length": 15, "header": "tr|A0A1W2PPF0-1|A0A1W2PPF0_HUMAN Computationally mapped isoform of Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=4 SV=1 CANONICAL=P14136-1" }, "locus": { "chromosome": "17", "start_pos": 44908076, "end_pos": 44905118, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000639243.1", "url": "https://www.ensembl.org/id/ENST00000639243.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000491375.1", "url": "https://www.ensembl.org/id/ENSP00000491375.1" } ] } }, { "isoform_ac": "A0A1W2PPL2-1", "url": "", "sequence": { "sequence": "XRETSLDTKSVSEGHLKRNIVVKTVEMRDGEGTHPETSGII", "length": 41, "header": "tr|A0A1W2PPL2-1|GFAP_HUMAN Computationally mapped isoform of Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1 CANONICAL=P14136-1" }, "locus": { "chromosome": "17", "start_pos": 44910620, "end_pos": 44905119, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000638400.1", "url": "https://www.ensembl.org/id/ENST00000638400.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000491466.1", "url": "https://www.ensembl.org/id/ENSP00000491466.1" } ] } }, { "isoform_ac": "A0A1W2PQ25-1", "url": "", "sequence": { "sequence": "VSEGHLKRNIVVKTVEMRDGEGTKQLRTSTSGVWSLALVRSFLGTALEPQDTTSGTALR", "length": 59, "header": "tr|A0A1W2PQ25-1|GFAP_HUMAN Computationally mapped isoform of Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1 CANONICAL=P14136-1" }, "locus": { "chromosome": "17", "start_pos": 44908126, "end_pos": 44904441, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000640545.1", "url": "https://www.ensembl.org/id/ENST00000640545.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000491735.1", "url": "https://www.ensembl.org/id/ENSP00000491735.1" } ] } }, { "isoform_ac": "A0A1W2PQS4-1", "url": "", "sequence": { "sequence": "XKSVSEGHLKRNIVVKTVEMRDGEGTHPETSGII", "length": 34, "header": "tr|A0A1W2PQS4-1|A0A1W2PQS4_HUMAN Computationally mapped isoform of Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1 CANONICAL=P14136-1" }, "locus": { "chromosome": "17", "start_pos": 44908134, "end_pos": 44905119, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000640859.1", "url": "https://www.ensembl.org/id/ENST00000640859.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000492300.1", "url": "https://www.ensembl.org/id/ENSP00000492300.1" } ] } }, { "isoform_ac": "A0A1W2PQU7-1", "url": "", "sequence": { "sequence": "XYQDLLNVKLALDIEIATYRKLLEGEENR", "length": 29, "header": "tr|A0A1W2PQU7-1|A0A1W2PQU7_HUMAN Computationally mapped isoform of Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1 CANONICAL=P14136-1" }, "locus": { "chromosome": "17", "start_pos": 44911319, "end_pos": 44910872, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000639921.1", "url": "https://www.ensembl.org/id/ENST00000639921.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000492156.1", "url": "https://www.ensembl.org/id/ENSP00000492156.1" } ] } }, { "isoform_ac": "A0A1W2PR46-1", "url": "", "sequence": { "sequence": "MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEGTKQLRTSTSGVWSLALVRSFLGTALEPQDTTSGTALRTLALTQEWVKGNRNEKGGPRCSGREISASVLQALPCQPGGKVFHQPGG", "length": 505, "header": "tr|A0A1W2PR46-1|A0A1W2PR46_HUMAN Computationally mapped isoform of Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1 CANONICAL=P14136-1" }, "locus": { "chromosome": "17", "start_pos": 44915486, "end_pos": 44903415, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000639277.1", "url": "https://www.ensembl.org/id/ENST00000639277.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000492432.1", "url": "https://www.ensembl.org/id/ENSP00000492432.1" } ] } }, { "isoform_ac": "A0A1W2PRT3-1", "url": "", "sequence": { "sequence": "YQAELRELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEAAPASEPLGLLLLNPSKPLPHV", "length": 326, "header": "tr|A0A1W2PRT3-1|A0A1W2PRT3_HUMAN Computationally mapped isoform of Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1 CANONICAL=P14136-1" }, "locus": { "chromosome": "17", "start_pos": 44915141, "end_pos": 44906099, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000638618.1", "url": "https://www.ensembl.org/id/ENST00000638618.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000492832.1", "url": "https://www.ensembl.org/id/ENSP00000492832.1" } ] } }, { "isoform_ac": "A0A1W2PS58-1", "url": "", "sequence": { "sequence": "XKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRGGKSTKDGENHKKPAWTPSLCQKATSRGTSW", "length": 67, "header": "tr|A0A1W2PS58-1|A0A1W2PS58_HUMAN Computationally mapped isoform of Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1 CANONICAL=P14136-1" }, "locus": { "chromosome": "17", "start_pos": 44911299, "end_pos": 44908092, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000639042.1", "url": "https://www.ensembl.org/id/ENST00000639042.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000492860.1", "url": "https://www.ensembl.org/id/ENSP00000492860.1" } ] } }, { "isoform_ac": "A0A1X7SBR3-1", "url": "", "sequence": { "sequence": "MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRGGKSTKDGENHKVTRYLKSLTIRVIPIQAHQIVNGTPPARETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM", "length": 472, "header": "tr|A0A1X7SBR3-1|A0A1X7SBR3_HUMAN Computationally mapped isoform of Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1 CANONICAL=P14136-1" }, "locus": { "chromosome": "17", "start_pos": 44915486, "end_pos": 44907350, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000253408.11", "url": "https://www.ensembl.org/id/ENST00000253408.11" }, { "database": "Ensembl Peptide", "id": "ENSP00000253408.5", "url": "https://www.ensembl.org/id/ENSP00000253408.5" } ] } }, { "isoform_ac": "A0A1X7SCE1-1", "url": "", "sequence": { "sequence": "MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLRGTEYQDLLNVKLALDIEIATYRKLLEGEENRITI", "length": 334, "header": "tr|A0A1X7SCE1-1|A0A1X7SCE1_HUMAN Computationally mapped isoform of Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1 CANONICAL=P14136-1" }, "locus": { "chromosome": "17", "start_pos": 44915486, "end_pos": 44910649, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000586793.6", "url": "https://www.ensembl.org/id/ENST00000586793.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000468500.2", "url": "https://www.ensembl.org/id/ENSP00000468500.2" } ] } }, { "isoform_ac": "B4DIR1-1", "url": "", "sequence": { "sequence": "MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLATVRQKKQMKPPWPVWIWRGRLSRWRRRSGS", "length": 179, "header": "tr|B4DIR1-1|B4DIR1_HUMAN Computationally mapped isoform of Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1 CANONICAL=P14136-1" }, "locus": { "chromosome": "17", "start_pos": 44915486, "end_pos": 44913748, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000376990.8", "url": "https://www.ensembl.org/id/ENST00000376990.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000366189.4", "url": "https://www.ensembl.org/id/ENSP00000366189.4" } ] } }, { "isoform_ac": "K7EJK1-1", "url": "", "sequence": { "sequence": "MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAG", "length": 61, "header": "tr|K7EJK1-1|K7EJK1_HUMAN Computationally mapped isoform of Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1 CANONICAL=P14136-1" }, "locus": { "chromosome": "17", "start_pos": 44915486, "end_pos": 44915134, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000585728.5", "url": "https://www.ensembl.org/id/ENST00000585728.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000465208.1", "url": "https://www.ensembl.org/id/ENSP00000465208.1" } ] } }, { "isoform_ac": "K7EJU1-1", "url": "", "sequence": { "sequence": "MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEYQDLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQI", "length": 248, "header": "tr|K7EJU1-1|GFAP_HUMAN Computationally mapped isoform of Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1 CANONICAL=P14136-1" }, "locus": { "chromosome": "17", "start_pos": 44915486, "end_pos": 44910619, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000592320.6", "url": "https://www.ensembl.org/id/ENST00000592320.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000465320.1", "url": "https://www.ensembl.org/id/ENSP00000465320.1" } ] } }, { "isoform_ac": "K7EKD1-1", "url": "", "sequence": { "sequence": "MASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLRG", "length": 57, "header": "tr|K7EKD1-1|K7EKD1_HUMAN Computationally mapped isoform of Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1 CANONICAL=P14136-1" }, "locus": { "chromosome": "17", "start_pos": 44913316, "end_pos": 44911675, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000588957.5", "url": "https://www.ensembl.org/id/ENST00000588957.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000465565.1", "url": "https://www.ensembl.org/id/ENSP00000465565.1" } ] } }, { "isoform_ac": "K7EKH9-1", "url": "", "sequence": { "sequence": "MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEVRELQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLT", "length": 261, "header": "tr|K7EKH9-1|K7EKH9_HUMAN Computationally mapped isoform of Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1 CANONICAL=P14136-1" }, "locus": { "chromosome": "17", "start_pos": 44915486, "end_pos": 44911699, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000588316.1", "url": "https://www.ensembl.org/id/ENST00000588316.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000465629.1", "url": "https://www.ensembl.org/id/ENSP00000465629.1" } ] } }, { "isoform_ac": "K7ELP4-1", "url": "", "sequence": { "sequence": "MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLATVRQKNVSPHSRLQDETNLRLEAENNLAAYRQEADEATLA", "length": 189, "header": "tr|K7ELP4-1|K7ELP4_HUMAN Computationally mapped isoform of Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1 CANONICAL=P14136-1" }, "locus": { "chromosome": "17", "start_pos": 44915486, "end_pos": 44913800, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000588037.1", "url": "https://www.ensembl.org/id/ENST00000588037.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000466163.1", "url": "https://www.ensembl.org/id/ENSP00000466163.1" } ] } }, { "isoform_ac": "K7EPI4-1", "url": "", "sequence": { "sequence": "KLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVRRDLGPVRLWLAPGILKARPWRKAWGWHIEGSQQLPVAPQGILEESKETECNSVSSVPP", "length": 124, "header": "tr|K7EPI4-1|K7EPI4_HUMAN Computationally mapped isoform of Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=2 CANONICAL=P14136-1" }, "locus": { "chromosome": "17", "start_pos": 44911297, "end_pos": 44907884, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000586125.2", "url": "https://www.ensembl.org/id/ENST00000586125.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000467397.2", "url": "https://www.ensembl.org/id/ENSP00000467397.2" } ] } }, { "isoform_ac": "K7EPT8-1", "url": "", "sequence": { "sequence": "XALDIEIATYRKLLEGEENRITIPVQTFSNLQIRGGKSTKDGENHKVTRYLKSLTIRVIPIQAHQIVNGTPPARG", "length": 75, "header": "tr|K7EPT8-1|K7EPT8_HUMAN Computationally mapped isoform of Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=2 CANONICAL=P14136-1" }, "locus": { "chromosome": "17", "start_pos": 44911292, "end_pos": 44910137, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000591880.2", "url": "https://www.ensembl.org/id/ENST00000591880.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000467530.2", "url": "https://www.ensembl.org/id/ENSP00000467530.2" } ] } }, { "isoform_ac": "P14136-1", "url": "", "sequence": { "sequence": "MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM", "length": 432, "header": "sp|P14136-1|GFAP_HUMAN Isoform 1 of Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1 CANONICAL=P14136-1" }, "locus": { "chromosome": "17", "start_pos": 44915486, "end_pos": 44907350, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000588735.3", "url": "https://www.ensembl.org/id/ENST00000588735.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000466598.2", "url": "https://www.ensembl.org/id/ENSP00000466598.2" } ] } }, { "isoform_ac": "P14136-2", "url": "", "sequence": { "sequence": "MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRGQYSRASWEGHWSPAPSSRACRLLQTGTEDQGKGIQLSLGAFVTLQRS", "length": 438, "header": "sp|P14136-2|GFAP_HUMAN Isoform 2 of Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1 CANONICAL=P14136-1" }, "locus": { "chromosome": "17", "start_pos": 44915486, "end_pos": 44910472, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000638281.1", "url": "https://www.ensembl.org/id/ENST00000638281.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000491088.1", "url": "https://www.ensembl.org/id/ENSP00000491088.1" } ] } }, { "isoform_ac": "P14136-3", "url": "", "sequence": { "sequence": "MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRGGKSTKDGENHKVTRYLKSLTIRVIPIQAHQIVNGTPPARG", "length": 431, "header": "sp|P14136-3|GFAP_HUMAN Isoform 3 of Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1 CANONICAL=P14136-1" }, "locus": { "chromosome": "17", "start_pos": 44915486, "end_pos": 44910139, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000435360.8", "url": "https://www.ensembl.org/id/ENST00000435360.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000403962.1", "url": "https://www.ensembl.org/id/ENSP00000403962.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 383, "start_aa": "Thr", "end_pos": 383, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr383", "evidence": [ { "id": "P14136", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P14136" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "P14136", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P14136" } ] } ], "phosphorylation": [ { "start_pos": 110, "end_pos": 110, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "site_lbl": "Thr110" }, { "start_pos": 13, "end_pos": 13, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" }, { "database": "PubMed", "id": "2114109", "url": "https://glygen.org/publication/PubMed/2114109" }, { "database": "PubMed", "id": "2155236", "url": "https://glygen.org/publication/PubMed/2155236" }, { "database": "PubMed", "id": "7822264", "url": "https://glygen.org/publication/PubMed/7822264" }, { "database": "PubMed", "id": "9099667", "url": "https://glygen.org/publication/PubMed/9099667" } ], "site_lbl": "Ser13" }, { "start_pos": 13, "end_pos": 13, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" }, { "database": "PubMed", "id": "2114109", "url": "https://glygen.org/publication/PubMed/2114109" }, { "database": "PubMed", "id": "2155236", "url": "https://glygen.org/publication/PubMed/2155236" }, { "database": "PubMed", "id": "7822264", "url": "https://glygen.org/publication/PubMed/7822264" }, { "database": "PubMed", "id": "9099667", "url": "https://glygen.org/publication/PubMed/9099667" }, { "database": "PubMed", "id": "12686604", "url": "https://glygen.org/publication/PubMed/12686604" } ], "site_lbl": "Ser13" }, { "start_pos": 13, "end_pos": 13, "kinase_uniprot_canonical_ac": "Q13464-1", "kinase_gene_name": "ROCK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" }, { "database": "PubMed", "id": "2114109", "url": "https://glygen.org/publication/PubMed/2114109" }, { "database": "PubMed", "id": "2155236", "url": "https://glygen.org/publication/PubMed/2155236" }, { "database": "PubMed", "id": "7822264", "url": "https://glygen.org/publication/PubMed/7822264" }, { "database": "PubMed", "id": "9099667", "url": "https://glygen.org/publication/PubMed/9099667" }, { "database": "phospho.ELM", "id": "P14136", "url": "http://phospho.elm.eu.org/byAccession/P14136.html" }, { "database": "PubMed", "id": "12686604", "url": "https://glygen.org/publication/PubMed/12686604" } ], "site_lbl": "Ser13" }, { "start_pos": 13, "end_pos": 13, "kinase_uniprot_canonical_ac": "Q96GD4-1", "kinase_gene_name": "AURKB", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" }, { "database": "PubMed", "id": "12686604", "url": "https://glygen.org/publication/PubMed/12686604" } ], "site_lbl": "Ser13" }, { "start_pos": 13, "end_pos": 13, "kinase_uniprot_canonical_ac": "Q9UQM7-1", "kinase_gene_name": "CAMK2A", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" }, { "database": "PubMed", "id": "2114109", "url": "https://glygen.org/publication/PubMed/2114109" }, { "database": "PubMed", "id": "2155236", "url": "https://glygen.org/publication/PubMed/2155236" }, { "database": "PubMed", "id": "7822264", "url": "https://glygen.org/publication/PubMed/7822264" }, { "database": "PubMed", "id": "9099667", "url": "https://glygen.org/publication/PubMed/9099667" } ], "site_lbl": "Ser13" }, { "start_pos": 13, "end_pos": 13, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by AURKB and ROCK1", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" }, { "database": "phospho.ELM", "id": "P14136", "url": "http://phospho.elm.eu.org/byAccession/P14136.html" }, { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" }, { "database": "PubMed", "id": "12686604", "url": "https://glygen.org/publication/PubMed/12686604" }, { "database": "PubMed", "id": "2155236", "url": "https://glygen.org/publication/PubMed/2155236" }, { "database": "PubMed", "id": "12177195", "url": "https://glygen.org/publication/PubMed/12177195" }, { "database": "PubMed", "id": "9099667", "url": "https://glygen.org/publication/PubMed/9099667" }, { "database": "PubMed", "id": "19170683", "url": "https://glygen.org/publication/PubMed/19170683" }, { "database": "PubMed", "id": "24749759", "url": "https://glygen.org/publication/PubMed/24749759" }, { "database": "PubMed", "id": "9832553", "url": "https://glygen.org/publication/PubMed/9832553" } ], "site_lbl": "Ser13" }, { "start_pos": 150, "end_pos": 150, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "site_lbl": "Thr150" }, { "start_pos": 17, "end_pos": 17, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" }, { "database": "PubMed", "id": "2114109", "url": "https://glygen.org/publication/PubMed/2114109" }, { "database": "PubMed", "id": "2155236", "url": "https://glygen.org/publication/PubMed/2155236" }, { "database": "PubMed", "id": "7822264", "url": "https://glygen.org/publication/PubMed/7822264" } ], "site_lbl": "Ser17" }, { "start_pos": 17, "end_pos": 17, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" }, { "database": "PubMed", "id": "2114109", "url": "https://glygen.org/publication/PubMed/2114109" }, { "database": "PubMed", "id": "2155236", "url": "https://glygen.org/publication/PubMed/2155236" }, { "database": "PubMed", "id": "7822264", "url": "https://glygen.org/publication/PubMed/7822264" } ], "site_lbl": "Ser17" }, { "start_pos": 17, "end_pos": 17, "kinase_uniprot_canonical_ac": "Q13464-1", "kinase_gene_name": "ROCK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" }, { "database": "PubMed", "id": "2114109", "url": "https://glygen.org/publication/PubMed/2114109" }, { "database": "PubMed", "id": "2155236", "url": "https://glygen.org/publication/PubMed/2155236" }, { "database": "PubMed", "id": "7822264", "url": "https://glygen.org/publication/PubMed/7822264" } ], "site_lbl": "Ser17" }, { "start_pos": 17, "end_pos": 17, "kinase_uniprot_canonical_ac": "Q9UQM7-1", "kinase_gene_name": "CAMK2A", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" }, { "database": "PubMed", "id": "2114109", "url": "https://glygen.org/publication/PubMed/2114109" }, { "database": "PubMed", "id": "2155236", "url": "https://glygen.org/publication/PubMed/2155236" }, { "database": "PubMed", "id": "7822264", "url": "https://glygen.org/publication/PubMed/7822264" } ], "site_lbl": "Ser17" }, { "start_pos": 17, "end_pos": 17, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P14136", "url": "http://phospho.elm.eu.org/byAccession/P14136.html" }, { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" }, { "database": "PubMed", "id": "2155236", "url": "https://glygen.org/publication/PubMed/2155236" }, { "database": "PubMed", "id": "7822264", "url": "https://glygen.org/publication/PubMed/7822264" }, { "database": "PubMed", "id": "12177195", "url": "https://glygen.org/publication/PubMed/12177195" } ], "site_lbl": "Ser17" }, { "start_pos": 323, "end_pos": 323, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "site_lbl": "Ser323" }, { "start_pos": 383, "end_pos": 383, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "site_lbl": "Thr383" }, { "start_pos": 385, "end_pos": 385, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "site_lbl": "Ser385" }, { "start_pos": 38, "end_pos": 38, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" }, { "database": "PubMed", "id": "2114109", "url": "https://glygen.org/publication/PubMed/2114109" }, { "database": "PubMed", "id": "2155236", "url": "https://glygen.org/publication/PubMed/2155236" }, { "database": "PubMed", "id": "7822264", "url": "https://glygen.org/publication/PubMed/7822264" } ], "site_lbl": "Ser38" }, { "start_pos": 38, "end_pos": 38, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" }, { "database": "PubMed", "id": "2114109", "url": "https://glygen.org/publication/PubMed/2114109" }, { "database": "PubMed", "id": "2155236", "url": "https://glygen.org/publication/PubMed/2155236" }, { "database": "PubMed", "id": "7822264", "url": "https://glygen.org/publication/PubMed/7822264" }, { "database": "PubMed", "id": "12686604", "url": "https://glygen.org/publication/PubMed/12686604" } ], "site_lbl": "Ser38" }, { "start_pos": 38, "end_pos": 38, "kinase_uniprot_canonical_ac": "Q13464-1", "kinase_gene_name": "ROCK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" }, { "database": "PubMed", "id": "2114109", "url": "https://glygen.org/publication/PubMed/2114109" }, { "database": "PubMed", "id": "2155236", "url": "https://glygen.org/publication/PubMed/2155236" }, { "database": "PubMed", "id": "7822264", "url": "https://glygen.org/publication/PubMed/7822264" }, { "database": "phospho.ELM", "id": "P14136", "url": "http://phospho.elm.eu.org/byAccession/P14136.html" }, { "database": "PubMed", "id": "12686604", "url": "https://glygen.org/publication/PubMed/12686604" }, { "database": "PubMed", "id": "9099667", "url": "https://glygen.org/publication/PubMed/9099667" } ], "site_lbl": "Ser38" }, { "start_pos": 38, "end_pos": 38, "kinase_uniprot_canonical_ac": "Q96GD4-1", "kinase_gene_name": "AURKB", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" }, { "database": "PubMed", "id": "12686604", "url": "https://glygen.org/publication/PubMed/12686604" } ], "site_lbl": "Ser38" }, { "start_pos": 38, "end_pos": 38, "kinase_uniprot_canonical_ac": "Q9UQM7-1", "kinase_gene_name": "CAMK2A", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" }, { "database": "PubMed", "id": "2114109", "url": "https://glygen.org/publication/PubMed/2114109" }, { "database": "PubMed", "id": "2155236", "url": "https://glygen.org/publication/PubMed/2155236" }, { "database": "PubMed", "id": "7822264", "url": "https://glygen.org/publication/PubMed/7822264" } ], "site_lbl": "Ser38" }, { "start_pos": 38, "end_pos": 38, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by AURKB and ROCK1", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" }, { "database": "phospho.ELM", "id": "P14136", "url": "http://phospho.elm.eu.org/byAccession/P14136.html" }, { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" }, { "database": "PubMed", "id": "12686604", "url": "https://glygen.org/publication/PubMed/12686604" }, { "database": "PubMed", "id": "2155236", "url": "https://glygen.org/publication/PubMed/2155236" }, { "database": "PubMed", "id": "7822264", "url": "https://glygen.org/publication/PubMed/7822264" }, { "database": "PubMed", "id": "12177195", "url": "https://glygen.org/publication/PubMed/12177195" }, { "database": "PubMed", "id": "9832553", "url": "https://glygen.org/publication/PubMed/9832553" }, { "database": "PubMed", "id": "9099667", "url": "https://glygen.org/publication/PubMed/9099667" } ], "site_lbl": "Ser38" }, { "start_pos": 393, "end_pos": 393, "kinase_uniprot_canonical_ac": "Q9UQM7-1", "kinase_gene_name": "CAMK2A", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" }, { "database": "PubMed", "id": "2114109", "url": "https://glygen.org/publication/PubMed/2114109" }, { "database": "PubMed", "id": "7822264", "url": "https://glygen.org/publication/PubMed/7822264" } ], "site_lbl": "Ser393" }, { "start_pos": 7, "end_pos": 7, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" }, { "database": "PubMed", "id": "12686604", "url": "https://glygen.org/publication/PubMed/12686604" } ], "site_lbl": "Thr7" }, { "start_pos": 7, "end_pos": 7, "kinase_uniprot_canonical_ac": "Q13464-1", "kinase_gene_name": "ROCK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" }, { "database": "PubMed", "id": "9099667", "url": "https://glygen.org/publication/PubMed/9099667" }, { "database": "phospho.ELM", "id": "P14136", "url": "http://phospho.elm.eu.org/byAccession/P14136.html" }, { "database": "PubMed", "id": "12686604", "url": "https://glygen.org/publication/PubMed/12686604" } ], "site_lbl": "Thr7" }, { "start_pos": 7, "end_pos": 7, "kinase_uniprot_canonical_ac": "Q96GD4-1", "kinase_gene_name": "AURKB", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" }, { "database": "PubMed", "id": "12686604", "url": "https://glygen.org/publication/PubMed/12686604" } ], "site_lbl": "Thr7" }, { "start_pos": 7, "end_pos": 7, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by AURKB and ROCK1", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" }, { "database": "phospho.ELM", "id": "P14136", "url": "http://phospho.elm.eu.org/byAccession/P14136.html" }, { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" }, { "database": "PubMed", "id": "12686604", "url": "https://glygen.org/publication/PubMed/12686604" }, { "database": "PubMed", "id": "12177195", "url": "https://glygen.org/publication/PubMed/12177195" }, { "database": "PubMed", "id": "9099667", "url": "https://glygen.org/publication/PubMed/9099667" }, { "database": "PubMed", "id": "9832553", "url": "https://glygen.org/publication/PubMed/9832553" } ], "site_lbl": "Thr7" }, { "start_pos": 82, "end_pos": 82, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "site_lbl": "Ser82" }, { "start_pos": 8, "end_pos": 8, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" }, { "database": "PubMed", "id": "12177195", "url": "https://glygen.org/publication/PubMed/12177195" }, { "database": "PubMed", "id": "7822264", "url": "https://glygen.org/publication/PubMed/7822264" } ], "site_lbl": "Ser8" }, { "start_pos": 8, "end_pos": 8, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" }, { "database": "PubMed", "id": "12686604", "url": "https://glygen.org/publication/PubMed/12686604" } ], "site_lbl": "Ser8" }, { "start_pos": 8, "end_pos": 8, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P14136", "url": "http://phospho.elm.eu.org/byAccession/P14136.html" }, { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" }, { "database": "PubMed", "id": "12177195", "url": "https://glygen.org/publication/PubMed/12177195" }, { "database": "PubMed", "id": "7822264", "url": "https://glygen.org/publication/PubMed/7822264" }, { "database": "PubMed", "id": "1379174", "url": "https://glygen.org/publication/PubMed/1379174" }, { "database": "PubMed", "id": "19170683", "url": "https://glygen.org/publication/PubMed/19170683" }, { "database": "PubMed", "id": "8439181", "url": "https://glygen.org/publication/PubMed/8439181" }, { "database": "PubMed", "id": "9832553", "url": "https://glygen.org/publication/PubMed/9832553" } ], "site_lbl": "Ser8" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Critical Illness Polyneuropathy and Myopathy in COVID-19 Patients: A Prospective Observational Intensive Care Unit Cross-Sectional Cohort Study", "journal": "Preprint at Research Square", "date": "2020", "authors": "Frithiof R., Rostami E., Kumlien E., Virhammar J., F\u00e4llmar D., Hultstr\u00f6m M., Lipcsey M., Ashton N., Blennow K., Zetterberg H., Punga A.R.", "evidence": [ { "database": "GlyGen", "id": "A0136", "url": "https://data.glygen.org/GLY_000625" } ], "reference": [ { "type": "DOI", "id": "10.21203/rs.3.rs-78038/v2", "url": "https://glygen.org/publication/DOI/10.21203/rs.3.rs-78038/v2" } ] }, { "title": "Unique properties of lamp2a compared to other lamp2 isoforms.", "journal": "Journal of cell science", "date": "2000", "authors": "Cuervo AM, Dice JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "11082038", "url": "https://glygen.org/publication/PubMed/11082038" } ] }, { "title": "Mutations in GFAP, encoding glial fibrillary acidic protein, are associated with Alexander disease.", "journal": "Nature genetics", "date": "2001", "authors": "Brenner M, Johnson AB, Boespflug-Tanguy O, Rodriguez D, Goldman JE, Messing A", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "11138011", "url": "https://glygen.org/publication/PubMed/11138011" } ] }, { "title": "Infantile Alexander disease: spectrum of GFAP mutations and genotype-phenotype correlation.", "journal": "American journal of human genetics", "date": "2001", "authors": "Rodriguez D, Gauthier F, Bertini E, Bugiani M, Brenner M, N'guyen S, Goizet C, Gelot A, Surtees R, Pedespan JM, Hernandorena X, Troncoso M, Uziel G, Messing A, Ponsot G, Pham-Dinh D, Dautigny A, Boespflug-Tanguy O", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "11567214", "url": "https://glygen.org/publication/PubMed/11567214" } ] }, { "title": "A novel mutation in glial fibrillary acidic protein gene in a patient with Alexander disease.", "journal": "Neuroscience letters", "date": "2001", "authors": "Aoki Y, Haginoya K, Munakata M, Yokoyama H, Nishio T, Togashi N, Ito T, Suzuki Y, Kure S, Iinuma K, Brenner M, Matsubara Y", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "11595337", "url": "https://glygen.org/publication/PubMed/11595337" } ] }, { "title": "gamma -Secretase cleavage and nuclear localization of ErbB-4 receptor tyrosine kinase.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Ni CY, Murphy MP, Golde TE, Carpenter G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "11679632", "url": "https://glygen.org/publication/PubMed/11679632" } ] }, { "title": "Molecular findings in symptomatic and pre-symptomatic Alexander disease patients.", "journal": "Neurology", "date": "2002", "authors": "Gorospe JR, Naidu S, Johnson AB, Puri V, Raymond GV, Jenkins SD, Pedersen RC, Lewis D, Knowles P, Fernandez R, De Vivo D, van der Knaap MS, Messing A, Brenner M, Hoffman EP", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "12034785", "url": "https://glygen.org/publication/PubMed/12034785" } ] }, { "title": "Juvenile Alexander disease with a novel mutation in glial fibrillary acidic protein gene.", "journal": "Neurology", "date": "2002", "authors": "Sawaishi Y, Yano T, Takaku I, Takada G", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "12034796", "url": "https://glygen.org/publication/PubMed/12034796" } ] }, { "title": "A new splice variant of glial fibrillary acidic protein GFAPepsilon, interacts with the presenilin proteins.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Nielsen AL, Holm IE, Johansen M, Bonven B, Jorgensen P, Jorgensen AL", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "12058025", "url": "https://glygen.org/publication/PubMed/12058025" } ] }, { "title": "Protective role of phosphorylation in turnover of glial fibrillary acidic protein in mice.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2002", "authors": "Takemura M, Gomi H, Colucci-Guyon E, Itohara S", "evidence": [ { "database": "iPTMnet", "id": "P14136-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136-1" } ], "reference": [ { "type": "PubMed", "id": "12177195", "url": "https://glygen.org/publication/PubMed/12177195" } ] }, { "title": "Molecular genetic study in Japanese patients with Alexander disease: a novel mutation, R79L.", "journal": "Brain & development", "date": "2003", "authors": "Shiroma N, Kanazawa N, Kato Z, Shimozawa N, Imamura A, Ito M, Ohtani K, Oka A, Wakabayashi K, Iai M, Sugai K, Sasaki M, Kaga M, Ohta T, Tsujino S", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "12581808", "url": "https://glygen.org/publication/PubMed/12581808" } ] }, { "title": "Functional significance of the specific sites phosphorylated in desmin at cleavage furrow: Aurora-B may phosphorylate and regulate type III intermediate filaments during cytokinesis coordinatedly with Rho-kinase.", "journal": "Molecular biology of the cell", "date": "2003", "authors": "Kawajiri A, Yasui Y, Goto H, Tatsuka M, Takahashi M, Nagata K, Inagaki M", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" }, { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" } ], "reference": [ { "type": "PubMed", "id": "12686604", "url": "https://glygen.org/publication/PubMed/12686604" } ] }, { "title": "WW domain-containing protein YAP associates with ErbB-4 and acts as a co-transcriptional activator for the carboxyl-terminal fragment of ErbB-4 that translocates to the nucleus.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Komuro A, Nagai M, Navin NE, Sudol M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "12807903", "url": "https://glygen.org/publication/PubMed/12807903" } ] }, { "title": "Genetic polymorphism and sequence evolution of an alternatively spliced exon of the glial fibrillary acidic protein gene, GFAP.", "journal": "Genomics", "date": "2003", "authors": "Singh Ripudaman, Nielsen Anders L, Johansen Marianne G, J\u00f8rgensen Arne L", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "12837269", "url": "https://glygen.org/publication/PubMed/12837269" } ] }, { "title": "A novel GFAP mutation and disseminated white matter lesions: adult Alexander disease?", "journal": "Eur. Neurol.", "date": "2003", "authors": "Brockmann Knut, Meins Moritz, Taubert Angelika, Trappe Ralf, Grond Martin, Hanefeld Folker", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "12944715", "url": "https://glygen.org/publication/PubMed/12944715" } ] }, { "title": "Adult Alexander disease with autosomal dominant transmission: a distinct entity caused by mutation in the glial fibrillary acid protein gene.", "journal": "Archives of neurology", "date": "2003", "authors": "Stumpf E, Masson H, Duquette A, Berthelet F, McNabb J, Lortie A, Lesage J, Montplaisir J, Brais B, Cossette P", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "12975300", "url": "https://glygen.org/publication/PubMed/12975300" } ] }, { "title": "Two different protein kinases act on a different time schedule as glial filament kinases during mitosis.", "journal": "The EMBO journal", "date": "1992", "authors": "Matsuoka Y, Nishizawa K, Yano T, Shibata M, Ando S, Takahashi T, Inagaki M", "evidence": [ { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" } ], "reference": [ { "type": "PubMed", "id": "1379174", "url": "https://glygen.org/publication/PubMed/1379174" } ] }, { "title": "Ligand-regulated association of ErbB-4 to the transcriptional co-activator YAP65 controls transcription at the nuclear level.", "journal": "Experimental cell research", "date": "2004", "authors": "Omerovic J, Puggioni EM, Napoletano S, Visco V, Fraioli R, Frati L, Gulino A, Alimandi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "15023535", "url": "https://glygen.org/publication/PubMed/15023535" } ] }, { "title": "A case of infantile Alexander disease with a milder phenotype and a novel GFAP mutation, L90P.", "journal": "Brain & development", "date": "2004", "authors": "Suzuki Y, Kanazawa N, Takenaka J, Okumura A, Negoro T, Tsujino S", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "15030911", "url": "https://glygen.org/publication/PubMed/15030911" } ] }, { "title": "The ERBB4/HER4 receptor tyrosine kinase regulates gene expression by functioning as a STAT5A nuclear chaperone.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Williams CC, Allison JG, Vidal GA, Burow ME, Beckman BS, Marrero L, Jones FE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "15534001", "url": "https://glygen.org/publication/PubMed/15534001" } ] }, { "title": "Glial fibrillary acidic protein mutations in infantile, juvenile, and adult forms of Alexander disease.", "journal": "Annals of neurology", "date": "2005", "authors": "Li R, Johnson AB, Salomons G, Goldman JE, Naidu S, Quinlan R, Cree B, Ruyle SZ, Banwell B, D'Hooghe M, Siebert JR, Rolf CM, Cox H, Reddy A, Gutierrez-Solana LG, Collins A, Weller RO, Messing A, van der Knaap MS, Brenner M", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "15732097", "url": "https://glygen.org/publication/PubMed/15732097" } ] }, { "title": "WW domain-containing proteins, WWOX and YAP, compete for interaction with ErbB-4 and modulate its transcriptional function.", "journal": "Cancer research", "date": "2005", "authors": "Aqeilan RI, Donati V, Palamarchuk A, Trapasso F, Kaou M, Pekarsky Y, Sudol M, Croce CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "16061658", "url": "https://glygen.org/publication/PubMed/16061658" } ] }, { "title": "Human glial fibrillary acidic protein (GFAP): molecular cloning of the complete cDNA sequence and chromosomal localization (chromosome 17) of the GFAP gene.", "journal": "Acta Neuropathol.", "date": "1992", "authors": "Kumanishi T, Usui H, Ichikawa T, Nishiyama A, Katagiri T, Abe S, Yoshida Y, Washiyama K, Kuwano R, Sakimura K", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "1636374", "url": "https://glygen.org/publication/PubMed/1636374" } ] }, { "title": "Coregulation of estrogen receptor by ERBB4/HER4 establishes a growth-promoting autocrine signal in breast tumor cells.", "journal": "Cancer research", "date": "2006", "authors": "Zhu Y, Sullivan LL, Nair SS, Williams CC, Pandey AK, Marrero L, Vadlamudi RK, Jones FE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "16912174", "url": "https://glygen.org/publication/PubMed/16912174" } ] }, { "title": "Presenilin-dependent ErbB4 nuclear signaling regulates the timing of astrogenesis in the developing brain.", "journal": "Cell", "date": "2006", "authors": "Sardi SP, Murtie J, Koirala S, Patten BA, Corfas G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "17018285", "url": "https://glygen.org/publication/PubMed/17018285" } ] }, { "title": "A case of infantile Alexander disease accompanied by infantile spasms diagnosed by DNA analysis.", "journal": "Journal of Korean medical science", "date": "2006", "authors": "Lee JM, Kim AS, Lee SJ, Cho SM, Lee DS, Choi SM, Kim DK, Ki CS, Kim JW", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "17043438", "url": "https://glygen.org/publication/PubMed/17043438" } ] }, { "title": "Identification and characterization of GFAPkappa, a novel glial fibrillary acidic protein isoform.", "journal": "Glia", "date": "2007", "authors": "Blechingberg Jenny, Holm Ida Elisabeth, Nielsen Karsten Bork, Jensen Torben Heick, J\u00f8rgensen Arne Lund, Nielsen Anders Lade", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "17203480", "url": "https://glygen.org/publication/PubMed/17203480" } ] }, { "title": "Alexander disease with occipital predominance and a novel c.799G>C mutation in the GFAP gene.", "journal": "Acta neuropathologica", "date": "2007", "authors": "Hinttala R, Karttunen V, Karttunen A, Herva R, Uusimaa J, Remes AM", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "17805552", "url": "https://glygen.org/publication/PubMed/17805552" } ] }, { "title": "GFAP mutations and polymorphisms in 13 unrelated Italian patients affected by Alexander disease.", "journal": "Clinical genetics", "date": "2007", "authors": "Caroli F, Biancheri R, Seri M, Rossi A, Pessagno A, Bugiani M, Corsolini F, Savasta S, Romano S, Antonelli C, Romano A, Pareyson D, Gambero P, Uziel G, Ravazzolo R, Ceccherini I, Filocamo M", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "17894839", "url": "https://glygen.org/publication/PubMed/17894839" } ] }, { "title": "An adult form of Alexander disease: a novel mutation in glial fibrillary acidic protein.", "journal": "Journal of neurology", "date": "2007", "authors": "Ohnari K, Yamano M, Uozumi T, Hashimoto T, Tsuji S, Nakagawa M", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "17934883", "url": "https://glygen.org/publication/PubMed/17934883" } ] }, { "title": "Adult-onset Alexander disease with progressive ataxia and palatal tremor.", "journal": "Movement disorders : official journal of the Movement Disorder Society", "date": "2008", "authors": "Howard KL, Hall DA, Moon M, Agarwal P, Newman E, Brenner M", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "17960815", "url": "https://glygen.org/publication/PubMed/17960815" } ] }, { "title": "Adult-onset Alexander disease : report on a family.", "journal": "Journal of neurology", "date": "2008", "authors": "Balbi P, Seri M, Ceccherini I, Uggetti C, Casale R, Fundaro C, Caroli F, Santoro L", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "18004641", "url": "https://glygen.org/publication/PubMed/18004641" } ] }, { "title": "Clinical and genetic study in Chinese patients with Alexander disease.", "journal": "Journal of child neurology", "date": "2008", "authors": "Ye Wu, Qiang Gu, Jingmin Wang, Yanling Yang, Xiru Wu, Yuwu Jiang", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "18079314", "url": "https://glygen.org/publication/PubMed/18079314" } ] }, { "title": "Human glial fibrillary acidic protein: complementary DNA cloning, chromosome localization, and messenger RNA expression in human glioma cell lines of various phenotypes.", "journal": "Cancer Res.", "date": "1991", "authors": "Bongcam-Rudloff E, Nister M, Betsholtz C, Wang JL, Stenman G, Huebner K, Croce CM, Westermark B", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "1847665", "url": "https://glygen.org/publication/PubMed/1847665" } ] }, { "title": "The chaperone-mediated autophagy receptor organizes in dynamic protein complexes at the lysosomal membrane.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Bandyopadhyay U, Kaushik S, Varticovski L, Cuervo AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "18644871", "url": "https://glygen.org/publication/PubMed/18644871" } ] }, { "title": "Prolactin and ErbB4/HER4 signaling interact via Janus kinase 2 to induce mammary epithelial cell gene expression differentiation.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2008", "authors": "Muraoka-Cook RS, Sandahl M, Hunter D, Miraglia L, Earp HS 3rd", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "18653779", "url": "https://glygen.org/publication/PubMed/18653779" } ] }, { "title": "The E3 ubiquitin ligase WWP1 selectively targets HER4 and its proteolytically derived signaling isoforms for degradation.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Feng SM, Muraoka-Cook RS, Hunter D, Sandahl MA, Caskey LS, Miyazawa K, Atfi A, Earp HS 3rd", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "19047365", "url": "https://glygen.org/publication/PubMed/19047365" } ] }, { "title": "Immunolocalization of fascin, an actin-bundling protein and glial fibrillary acidic protein in human astrocytoma cells.", "journal": "Brain pathology (Zurich, Switzerland)", "date": "2010", "authors": "Mondal S, Dirks P, Rutka JT", "evidence": [ { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" } ], "reference": [ { "type": "PubMed", "id": "19170683", "url": "https://glygen.org/publication/PubMed/19170683" } ] }, { "title": "Novel GFAP mutation in patient with adult-onset Alexander disease presenting with spastic ataxia.", "journal": "Movement disorders : official journal of the Movement Disorder Society", "date": "2009", "authors": "Kaneko H, Hirose M, Katada S, Takahashi T, Naruse S, Tsuchiya M, Yoshida T, Nakagawa M, Onodera O, Nishizawa M, Ikeuchi T", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "19412928", "url": "https://glygen.org/publication/PubMed/19412928" } ] }, { "title": "ErbB4 splice variants Cyt1 and Cyt2 differ by 16 amino acids and exert opposing effects on the mammary epithelium in vivo.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Muraoka-Cook RS, Sandahl MA, Strunk KE, Miraglia LC, Husted C, Hunter DM, Elenius K, Chodosh LA, Earp HS 3rd", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "19596786", "url": "https://glygen.org/publication/PubMed/19596786" } ] }, { "title": "Adult-onset Alexander disease with typical `tadpole` brainstem atrophy and unusual bilateral basal ganglia involvement: a case report and review of the literature.", "journal": "BMC neurology", "date": "2010", "authors": "Namekawa M, Takiyama Y, Honda J, Shimazaki H, Sakoe K, Nakano I", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "20359319", "url": "https://glygen.org/publication/PubMed/20359319" } ] }, { "title": "Identification of regulators of chaperone-mediated autophagy.", "journal": "Molecular cell", "date": "2010", "authors": "Bandyopadhyay U, Sridhar S, Kaushik S, Kiffin R, Cuervo AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "20797626", "url": "https://glygen.org/publication/PubMed/20797626" } ] }, { "title": "Ca2(+)-calmodulin-dependent protein kinase II phosphorylates various types of non-epithelial intermediate filament proteins.", "journal": "Biochemical and biophysical research communications", "date": "1990", "authors": "Tokui T, Yamauchi T, Yano T, Nishi Y, Kusagawa M, Yatani R, Inagaki M", "evidence": [ { "database": "iPTMnet", "id": "P14136-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136-1" } ], "reference": [ { "type": "PubMed", "id": "2114109", "url": "https://glygen.org/publication/PubMed/2114109" } ] }, { "title": "Chaperone-mediated autophagy at a glance.", "journal": "Journal of cell science", "date": "2011", "authors": "Kaushik S, Bandyopadhyay U, Sridhar S, Kiffin R, Martinez-Vicente M, Kon M, Orenstein SJ, Wong E, Cuervo AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "21282471", "url": "https://glygen.org/publication/PubMed/21282471" } ] }, { "title": "Phosphorylation sites linked to glial filament disassembly in vitro locate in a non-alpha-helical head domain.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Inagaki M, Gonda Y, Nishizawa K, Kitamura S, Sato C, Ando S, Tanabe K, Kikuchi K, Tsuiki S, Nishi Y", "evidence": [ { "database": "iPTMnet", "id": "P14136-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136-1" } ], "reference": [ { "type": "PubMed", "id": "2155236", "url": "https://glygen.org/publication/PubMed/2155236" } ] }, { "title": "Characterization of human cDNA and genomic clones for glial fibrillary acidic protein.", "journal": "Brain Res. Mol. Brain Res.", "date": "1990", "authors": "Brenner M, Lampel K, Nakatani Y, Mill J, Banner C, Mearow K, Dohadwala M, Lipsky R, Freese E", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "2163003", "url": "https://glygen.org/publication/PubMed/2163003" } ] }, { "title": "GFAP mutations, age at onset, and clinical subtypes in Alexander disease.", "journal": "Neurology", "date": "2011", "authors": "Prust M, Wang J, Morizono H, Messing A, Brenner M, Gordon E, Hartka T, Sokohl A, Schiffmann R, Gordish-Dressman H, Albin R, Amartino H, Brockman K, Dinopoulos A, Dotti MT, Fain D, Fernandez R, Ferreira J, Fleming J, Gill D, Griebel M, Heilstedt H, Kaplan P, Lewis D, Nakagawa M, Pedersen R, Reddy A, Sawaishi Y, Schneider M, Sherr E, Takiyama Y, Wakabayashi K, Gorospe JR, Vanderver A", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "21917775", "url": "https://glygen.org/publication/PubMed/21917775" } ] }, { "title": "Nuclear ErbB4 signaling through H3K9me3 is antagonized by EGFR-activated c-Src.", "journal": "Journal of cell science", "date": "2013", "authors": "Ishibashi K, Fukumoto Y, Hasegawa H, Abe K, Kubota S, Aoyama K, Kubota S, Nakayama Y, Yamaguchi N", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "23230144", "url": "https://glygen.org/publication/PubMed/23230144" } ] }, { "title": "Follow-up study of 22 Chinese children with Alexander disease and analysis of parental origin of de novo GFAP mutations.", "journal": "Journal of human genetics", "date": "2013", "authors": "Zang L, Wang J, Jiang Y, Gu Q, Gao Z, Yang Y, Xiao J, Wu Y", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "23364391", "url": "https://glygen.org/publication/PubMed/23364391" } ] }, { "title": "An RNA polymerase II promoter containing sequences upstream and downstream from the RNA startpoint that direct initiation of transcription from the same site.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1990", "authors": "Nakatani Y, Brenner M, Freese E", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "2349237", "url": "https://glygen.org/publication/PubMed/2349237" } ] }, { "title": "Familial adult-onset Alexander disease with a novel mutation (D78N) in the glial fibrillary acidic protein gene with unusual bilateral basal ganglia involvement.", "journal": "Journal of the neurological sciences", "date": "2013", "authors": "Wada Y, Yanagihara C, Nishimura Y, Namekawa M", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "23743246", "url": "https://glygen.org/publication/PubMed/23743246" } ] }, { "title": "Identification and characterization of citrulline-modified brain proteins by combining HCD and CID fragmentation.", "journal": "Proteomics", "date": "2013", "authors": "Jin Z, Fu Z, Yang J, Troncosco J, Everett AD, Van Eyk JE", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "23828821", "url": "https://glygen.org/publication/PubMed/23828821" } ] }, { "title": "Molecular origin of the binding of WWOX tumor suppressor to ErbB4 receptor tyrosine kinase.", "journal": "Biochemistry", "date": "2013", "authors": "Schuchardt BJ, Bhat V, Mikles DC, McDonald CB, Sudol M, Farooq A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "24308844", "url": "https://glygen.org/publication/PubMed/24308844" } ] }, { "title": "Diagnosis by whole exome sequencing of atypical infantile onset Alexander disease masquerading as a mitochondrial disorder.", "journal": "European journal of paediatric neurology : EJPN : official journal of the European Paediatric Neurology Society", "date": "2014", "authors": "Nishri D, Edvardson S, Lev D, Leshinsky-Silver E, Ben-Sira L, Henneke M, Lerman-Sagie T, Blumkin L", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "24742911", "url": "https://glygen.org/publication/PubMed/24742911" } ] }, { "title": "Enteric GFAP expression and phosphorylation in Parkinson's disease.", "journal": "Journal of neurochemistry", "date": "2014", "authors": "Clairembault T, Kamphuis W, Leclair-Visonneau L, Rolli-Derkinderen M, Coron E, Neunlist M, Hol EM, Derkinderen P", "evidence": [ { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" } ], "reference": [ { "type": "PubMed", "id": "24749759", "url": "https://glygen.org/publication/PubMed/24749759" } ] }, { "title": "Convergent and divergent cellular responses by ErbB4 isoforms in mammary epithelial cells.", "journal": "Molecular cancer research : MCR", "date": "2014", "authors": "Wali VB, Haskins JW, Gilmore-Hebert M, Platt JT, Liu Z, Stern DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1251985", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985" } ], "reference": [ { "type": "PubMed", "id": "24829397", "url": "https://glygen.org/publication/PubMed/24829397" } ] }, { "title": "An autopsied case of adult-onset bulbospinalform Alexander disease with a novel S393R mutation in the GFAP gene.", "journal": "Clinical neuropathology", "date": "2015", "authors": "Iwasaki Y, Saito Y, Mori K, Ito M, Mimuro M, Aiba I, Saito K, Mizuta I, Yoshida T, Nakagawa M, Yoshida M", "evidence": [ { "database": "Entrez", "id": "2670", "url": "https://www.ncbi.nlm.nih.gov/gene/2670" } ], "reference": [ { "type": "PubMed", "id": "25828773", "url": "https://glygen.org/publication/PubMed/25828773" } ] }, { "title": "Lysosomal mTORC2/PHLPP1/Akt Regulate Chaperone-Mediated Autophagy.", "journal": "Molecular cell", "date": "2015", "authors": "Arias E, Koga H, Diaz A, Mocholi E, Patel B, Cuervo AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "26118642", "url": "https://glygen.org/publication/PubMed/26118642" } ] }, { "title": "Molecular cloning and primary structure of human glial fibrillary acidic protein.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1989", "authors": "Reeves S A, Helman L J, Allison A, Israel M A", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "2740350", "url": "https://glygen.org/publication/PubMed/2740350" } ] }, { "title": "Changes in brain gene expression shared by scrapie and Alzheimer disease.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1989", "authors": "Duguid J R, Bohmont C W, Liu N G, Tourtellotte W W", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "2780570", "url": "https://glygen.org/publication/PubMed/2780570" } ] }, { "title": "Quantitative proteomics identifies altered O-GlcNAcylation of structural, synaptic and memory-associated proteins in Alzheimer's disease.", "journal": "The Journal of pathology", "date": "2017", "authors": "Wang S, Yang F, Petyuk VA, Shukla AK, Monroe ME, Gritsenko MA, Rodland KD, Smith RD, Qian WJ, Gong CX, Liu T", "evidence": [ { "database": "O-GlcNAc Database", "id": "P14136", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P14136" }, { "database": "O-GlcNAc Atlas", "id": "P14136", "url": "https://oglcnac.org/atlas/detail/P14136" } ], "reference": [ { "type": "PubMed", "id": "28657654", "url": "https://glygen.org/publication/PubMed/28657654" } ] }, { "title": "The coming of age of chaperone-mediated autophagy.", "journal": "Nature reviews. Molecular cell biology", "date": "2018", "authors": "Kaushik S, Cuervo AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "29626215", "url": "https://glygen.org/publication/PubMed/29626215" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "P14136", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P14136" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "title": "Combinatorial regulation of hepatic cytoplasmic signaling and nuclear transcriptional events by the OGT/REV-ERBalpha complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018", "authors": "Berthier A, Vinod M, Porez G, Steenackers A, Alexandre J, Yamakawa N, Gheeraert C, Ploton M, Marechal X, Dubois-Chevalier J, Hovasse A, Schaeffer-Reiss C, Cianferani S, Rolando C, Bray F, Duez H, Eeckhoute J, Lefebvre T, Staels B, Lefebvre P", "evidence": [ { "database": "O-GlcNAc Database", "id": "P14136", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P14136" } ], "reference": [ { "type": "PubMed", "id": "30397120", "url": "https://glygen.org/publication/PubMed/30397120" } ] }, { "title": "Neurofilament Light Chain and Glial Fibrillary Acidic Protein as early prognostic biomarkers after out-of-hospital cardiac arrest.", "journal": "Resuscitation", "date": "2023-12", "authors": "Klitholm Maibritt, Jeppesen Anni N\u00f8rgaard, Christensen Steffen, Parkner Tina, Tybirk Lea, Kirkegaard Hans, Sandfeld-Paulsen Birgitte, Grejs Anders Morten", "evidence": [ { "database": "RefSeq", "id": "NP_001124491", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124491" } ], "reference": [ { "type": "PubMed", "id": "37778613", "url": "https://glygen.org/publication/PubMed/37778613" } ] }, { "title": "Glial Fibrillary Acidic Protein (GFAP) Astrocytopathy: An Emerging Cause of Meningoencephalomyelitis in Children and Adolescents.", "journal": "Journal of child neurology", "date": "2023-12", "authors": "Uppal Prayerna, Smith Jacklyn, Castillo-Pinto Carlos, Wells Elizabeth M, Jayakar Anuj, Harrar Dana", "evidence": [ { "database": "RefSeq", "id": "NP_001124491", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124491" } ], "reference": [ { "type": "PubMed", "id": "37981797", "url": "https://glygen.org/publication/PubMed/37981797" } ] }, { "title": "Alexander disease genetics: Beyond GFAP exon sequencing?", "journal": "Journal of neuropathology and experimental neurology", "date": "2023-12-22", "authors": "Cypers Gert", "evidence": [ { "database": "RefSeq", "id": "NP_001124491", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124491" } ], "reference": [ { "type": "PubMed", "id": "37990643", "url": "https://glygen.org/publication/PubMed/37990643" } ] }, { "title": "Serum \u03b2-synuclein, neurofilament light chain and glial fibrillary acidic protein as prognostic biomarkers in moderate-to-severe acute ischemic stroke.", "journal": "Scientific reports", "date": "2023-11-28", "authors": "Barba Lorenzo, Vollmuth Christoph, Abu-Rumeileh Samir, Halbgebauer Steffen, Oeckl Patrick, Steinacker Petra, Kollikowski Alexander M, Schultz Cara, Wolf Judith, Pham Mirko, Schuhmann Michael K, Heuschmann Peter U, Haeusler Karl Georg, Stoll Guido, Neugebauer Hermann, Otto Markus", "evidence": [ { "database": "RefSeq", "id": "NP_001124491", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124491" } ], "reference": [ { "type": "PubMed", "id": "38017278", "url": "https://glygen.org/publication/PubMed/38017278" } ] }, { "title": "Identification of phosphorylation sites on glial fibrillary acidic protein for cdc2 kinase and Ca(2+)-calmodulin-dependent protein kinase II.", "journal": "Journal of biochemistry", "date": "1994", "authors": "Tsujimura K, Tanaka J, Ando S, Matsuoka Y, Kusubata M, Sugiura H, Yamauchi T, Inagaki M", "evidence": [ { "database": "iPTMnet", "id": "P14136-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136-1" } ], "reference": [ { "type": "PubMed", "id": "7822264", "url": "https://glygen.org/publication/PubMed/7822264" } ] }, { "title": "[Visualization of phosphorylation events occurring in the intermediate filaments].", "journal": "Gan to kagaku ryoho. Cancer & chemotherapy", "date": "1993", "authors": "Matsuoka Y, Inagaki M", "evidence": [ { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" } ], "reference": [ { "type": "PubMed", "id": "8439181", "url": "https://glygen.org/publication/PubMed/8439181" } ] }, { "title": "A receptor for the selective uptake and degradation of proteins by lysosomes.", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Cuervo AM, Dice JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "8662539", "url": "https://glygen.org/publication/PubMed/8662539" } ] }, { "title": "A population of rat liver lysosomes responsible for the selective uptake and degradation of cytosolic proteins.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Cuervo AM, Dice JF, Knecht E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "9038169", "url": "https://glygen.org/publication/PubMed/9038169" } ] }, { "title": "Phosphorylation of glial fibrillary acidic protein at the same sites by cleavage furrow kinase and Rho-associated kinase.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Kosako H, Amano M, Yanagida M, Tanabe K, Nishi Y, Kaibuchi K, Inagaki M", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" }, { "database": "iPTMnet", "id": "P14136-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136-1" } ], "reference": [ { "type": "PubMed", "id": "9099667", "url": "https://glygen.org/publication/PubMed/9099667" } ] }, { "title": "An intralysosomal hsp70 is required for a selective pathway of lysosomal protein degradation.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Agarraberes FA, Terlecky SR, Dice JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9613829", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829" } ], "reference": [ { "type": "PubMed", "id": "9151685", "url": "https://glygen.org/publication/PubMed/9151685" } ] }, { "title": "Domain-specific phosphorylation of vimentin and glial fibrillary acidic protein by PKN.", "journal": "Biochemical and biophysical research communications", "date": "1997", "authors": "Matsuzawa K, Kosako H, Inagaki N, Shibata H, Mukai H, Ono Y, Amano M, Kaibuchi K, Matsuura Y, Azuma I, Inagaki M", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "9175763", "url": "https://glygen.org/publication/PubMed/9175763" } ] }, { "title": "Determination of the gene structure of human GFAP and absence of coding region mutations associated with frontotemporal dementia with parkinsonism linked to chromosome 17.", "journal": "Genomics", "date": "1998", "authors": "Isaacs A, Baker M, Wavrant-De Vri\u00e8ze F, Hutton M", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "reference": [ { "type": "PubMed", "id": "9693047", "url": "https://glygen.org/publication/PubMed/9693047" } ] }, { "title": "Roles of Rho-associated kinase in cytokinesis; mutations in Rho-associated kinase phosphorylation sites impair cytokinetic segregation of glial filaments.", "journal": "The Journal of cell biology", "date": "1998", "authors": "Yasui Y, Amano M, Nagata K, Inagaki N, Nakamura H, Saya H, Kaibuchi K, Inagaki M", "evidence": [ { "database": "iPTMnet", "id": "P14136", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14136" } ], "reference": [ { "type": "PubMed", "id": "9832553", "url": "https://glygen.org/publication/PubMed/9832553" } ] } ], "pathway": [ { "id": "hsa:2670", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2670", "resource": "KEGG Pathway" }, { "id": "R-HSA-1251985", "name": "Nuclear signaling by ERBB4", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1251985", "resource": "Reactome", "description": "Nuclear signaling by ERBB4" }, { "id": "R-HSA-9613829", "name": "Chaperone Mediated Autophagy", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9613829", "resource": "Reactome", "description": "Chaperone Mediated Autophagy" } ], "orthologs": [ { "uniprot_canonical_ac": "P03995-1", "protein_name": "Glial fibrillary acidic protein", "gene_name": "Gfap", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MERRRITSARRSYASETVVRGLGPSRQLGTMPRFSLSRMTPPLPARVDFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNFAQDLGTLRQKLQDETNLRLEAENNLAAYRQEADEATLARVDLERKVESLEEEIQFLRKIYEEEVRELREQLAQQQVHVEMDVAKPDLTAALREIRTQYEAVATSNMQETEEWYRSKFADLTDAASRNAELLRQAKHEANDYRRQLQALTCDLESLRGTNESLERQMREQEERHARESASYQEALARLEEEGQSLKEEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKDSKQEHKDVVM", "length": 430 }, "evidence": [ { "id": "45917044", "url": "http://www.informatics.jax.org/homology/45917044", "database": "MGI" }, { "id": "P14136", "url": "https://omabrowser.org/oma/group/P14136/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P47819-1", "protein_name": "Glial fibrillary acidic protein", "gene_name": "Gfap", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MERRRITSARRSYASSETMVRGHGPTRHLGTIPRLSLSRMTPPLPARVDFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTTNSARLEVERDNLTQDLGTLRQKLQDETNLRLEAENNLAVYRQEADEATLARVDLERKVESLEEEIQFLRKIHEEEVRELQEQLAQQQVHVEMDVAKPDLTAALREIRTQYEAVATSNMQETEEWYRSKFADLTDVASRNAELLRQAKHEANDYRRQLQALTCDLESLRGTNESLERQMREQEERHARESASYQEALARLEEEGQSLKEEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM", "length": 430 }, "evidence": [ { "id": "45917044", "url": "http://www.informatics.jax.org/homology/45917044", "database": "MGI" }, { "id": "P14136", "url": "https://omabrowser.org/oma/group/P14136/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "intermediate filament", "id": "GO:0005882", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005882", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" }, { "name": "intermediate filament cytoskeleton", "id": "GO:0045111", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045111", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" }, { "name": "cell body", "id": "GO:0044297", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044297", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" }, { "name": "cell projection", "id": "GO:0042995", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042995", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" }, { "name": "cytoplasmic side of lysosomal membrane", "id": "GO:0098574", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098574", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" }, { "name": "astrocyte end-foot", "id": "GO:0097450", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097450", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "integrin binding", "id": "GO:0005178", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005178", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" }, { "name": "structural constituent of cytoskeleton", "id": "GO:0005200", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005200", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" }, { "name": "kinase binding", "id": "GO:0019900", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019900", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 15, "go_terms": [ { "name": "intracellular protein transport", "id": "GO:0006886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006886", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" }, { "name": "extracellular matrix organization", "id": "GO:0030198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030198", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" }, { "name": "negative regulation of neuron projection development", "id": "GO:0010977", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010977", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" }, { "name": "Bergmann glial cell differentiation", "id": "GO:0060020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060020", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" }, { "name": "neuron projection regeneration", "id": "GO:0031102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031102", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" }, { "name": "intermediate filament organization", "id": "GO:0045109", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045109", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" }, { "name": "long-term synaptic potentiation", "id": "GO:0060291", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060291", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" }, { "name": "regulation of protein-containing complex assembly", "id": "GO:0043254", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043254", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" }, { "name": "regulation of chaperone-mediated autophagy", "id": "GO:1904714", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904714", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" }, { "name": "astrocyte development", "id": "GO:0014002", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014002", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" }, { "name": "Schwann cell proliferation", "id": "GO:0014010", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014010", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" }, { "name": "positive regulation of Schwann cell proliferation", "id": "GO:0010625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010625", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" }, { "name": "regulation of neurotransmitter uptake", "id": "GO:0051580", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051580", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" }, { "name": "gene expression", "id": "GO:0010467", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010467", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" }, { "name": "D-aspartate import across plasma membrane", "id": "GO:0070779", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070779", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 303, "end_pos": 305, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated by PKN1.", "evidence": [ { "database": "UniProtKB", "id": "P14136", "url": "https://www.uniprot.org/uniprot/P14136" }, { "database": "PubMed", "id": "9175763", "url": "https://glygen.org/publication/PubMed/9175763" }, { "database": "PubMed", "id": "9099667", "url": "https://glygen.org/publication/PubMed/9099667" }, { "database": "PubMed", "id": "12686604", "url": "https://glygen.org/publication/PubMed/12686604" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [ { "assessed_biomarker_entity": "Glial fibrillary acidic protein (GFAP)", "biomarker_id": "A0136", "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" } ], "instances": [ { "best_biomarker_type": "prognostic", "status": "increased GFAP level", "disease": { "disease_id": "DOID:0080600", "recommended_name": { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "COVID-19", "description": "A Coronavirus infection that is characterized by fever, cough and shortness of breath and that has_material_basis_in SARS-CoV-2." }, "synonyms": [ { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "2019 Novel Coronavirus (2019-nCoV)", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "2019-nCoV infection", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "Wuhan coronavirus infection", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "Wuhan seafood market pneumonia virus infection", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "COVID19", "description": "" }, { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080600", "name": "SARS-CoV-2 infection", "description": "" } ] }, "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "evidence": [ { "id": "GLY_000625", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000625" }, { "id": "10.21203/rs.3.rs-78038/v2", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.21203/rs.3.rs-78038/v2" } ] } ] } ], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 383 ], "snv_sites": [ 51, 79, 96, 135, 145, 157, 162, 383 ], "glycation_sites": [], "phosphorylation_sites": [ 7, 8, 13, 17, 38, 82, 110, 150, 323, 383, 385, 393 ], "sequon_annotation_sites": [ { "start_pos": 303, "end_pos": 305 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 31 }, { "field": "total_sites", "count": 12 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }