{ "uniprot_canonical_ac": "P13987-1", "uniprot_ac": "P13987", "uniprot_id": "CD59_HUMAN", "mass": { "chemical_mass": 14177.0, "monoisotopic_mass": 14177.0 }, "refseq": { "ac": "NP_000602", "name": "CD59 glycoprotein preproprotein", "summary": "This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000602" }, "gene_names": [ { "name": "CD59", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P13987", "id": "P13987" }, { "name": "16.3A5; 1F5; EJ16; EJ30; EL32; G344; HRF-20; HRF20; MAC-IP; MACIF; MEM43; MIC11; MIN1; MIN2; MIN3; MIRL; MSK21; p18-20", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000602", "id": "NP_000602" }, { "name": "CD59", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000602", "id": "NP_000602" }, { "name": "MIC11", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P13987", "id": "P13987" }, { "name": "MIN1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P13987", "id": "P13987" }, { "name": "MIN2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P13987", "id": "P13987" }, { "name": "MIN3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P13987", "id": "P13987" }, { "name": "MSK21", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P13987", "id": "P13987" } ], "protein_names": [ { "name": "CD59 glycoprotein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P13987" }, { "name": "1F5 antigen", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13987" }, { "name": "20 kDa homologous restriction factor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13987" }, { "name": "CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344); protectin; human leukocyte antigen MIC11; CD59 molecule, complement regulatory protein; surface anitgen recognized by monoclonal antibody 16.3A5; lymphocytic antigen CD59/MEM43; T cell-activating protein; Ly-6-like protein; CD59 glycoprotein; membrane inhibitor of reactive lysis; 20 kDa homologous restriction factor; membrane attack complex (MAC) inhibition factor; CD59 blood group antigen; 1F5 antigen; MEM43 antigen; membrane attack complex inhibition factor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000602", "id": "NP_000602" }, { "name": "CD59 glycoprotein preproprotein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000602", "id": "NP_000602" }, { "name": "HRF-20", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13987" }, { "name": "HRF20", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13987" }, { "name": "MAC-IP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13987" }, { "name": "MAC-inhibitory protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13987" }, { "name": "MACIF", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13987" }, { "name": "MEM43 antigen", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13987" }, { "name": "MIRL", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13987" }, { "name": "Membrane attack complex inhibition factor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13987" }, { "name": "Membrane inhibitor of reactive lysis", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13987" }, { "name": "Protectin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13987" } ], "function": [ { "annotation": "Alternative splicing encodes functional intracellular CD59 isoforms that mediate insulin secretion and are down-regulated in diabetic islets.", "evidence": [ { "database": "RefSeq", "id": "NP_000602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000602" }, { "database": "PubMed", "id": "35666870", "url": "https://glygen.org/publication/PubMed/35666870" } ] }, { "annotation": "CD59 Expression in Skeletal Muscles and Its Role in Myasthenia Gravis. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000602" }, { "database": "PubMed", "id": "36396448", "url": "https://glygen.org/publication/PubMed/36396448" } ] }, { "annotation": "Multiple CD59 Polymorphisms in Chinese Patients with Mycobacterium tuberculosis Infection. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000602" }, { "database": "PubMed", "id": "37050931", "url": "https://glygen.org/publication/PubMed/37050931" } ] }, { "annotation": "Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987#function" } ] }, { "annotation": "The bioinformatics analysis of CD59 in Helicobacter pylori infected gastric cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_000602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000602" }, { "database": "PubMed", "id": "37522198", "url": "https://glygen.org/publication/PubMed/37522198" } ] }, { "annotation": "The soluble form from urine retains its specific complement binding activity, but exhibits greatly reduced ability to inhibit MAC assembly on cell membranes.", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987#function" } ] }, { "annotation": "The utility of first trimester plasma glycated CD59 (pGCD59) in predicting gestational diabetes mellitus: A prospective study of non-diabetic pregnant women in Ireland.", "evidence": [ { "database": "RefSeq", "id": "NP_000602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000602" }, { "database": "PubMed", "id": "35907507", "url": "https://glygen.org/publication/PubMed/35907507" } ] }, { "annotation": "This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_000602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000602" } ] } ], "disease": [ { "disease_id": "MONDO:0012858", "recommended_name": { "id": "MONDO:0012858", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012858", "name": "primary CD59 deficiency", "description": "" }, "synonyms": [ { "id": "MONDO:0012858", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012858", "name": "primary CD59 deficiency", "description": "" }, { "id": "MONDO:0012858", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012858", "name": "CD59 deficiency", "description": "" }, { "id": "MONDO:0012858", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012858", "name": "HACD59", "description": "" }, { "id": "MONDO:0012858", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012858", "name": "hemolytic anemia, CD59-mediated, with or without immune-mediated polyneuropathy", "description": "" }, { "id": "MIM:612300", "resource": "MIM", "url": "https://www.omim.org/entry/612300", "name": "Hemolytic anemia, CD59-mediated, with or without polyneuropathy", "description": "Hemolytic anemia, CD59-mediated, with or without polyneuropathy" } ], "evidence": [ { "id": "612300", "database": "MIM", "url": "https://www.omim.org/entry/612300" } ] } ], "snv": [ { "evidence": [ { "id": "P13987", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13987" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 34, "end_pos": 34, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "P", "sequence_mut": "Q", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NPT->NQT).", "chr_id": "11", "chr_pos": "33717438", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "P34", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs370913821", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs370913821" }, { "id": "rs370913821", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs370913821#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 40, "end_pos": 40, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "11", "chr_pos": "33717420", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T40", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1351382260", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1351382260" }, { "id": "rs1351382260", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1351382260" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 43, "end_pos": 43, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->SCS).", "chr_id": "11", "chr_pos": "33717411", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N43", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13987", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13987" }, { "id": "rs144931418", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs144931418" }, { "id": "rs144931418", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs144931418" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 74, "end_pos": 74, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DVT->NVT).", "chr_id": "11", "chr_pos": "33710293", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "D74", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 29, "end_pos": 29, "sequence_org": "Y", "sequence_mut": "R", "comment": "No loss of function.", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" }, { "database": "PubMed", "id": "9053451", "url": "https://glygen.org/publication/PubMed/9053451" } ] }, { "start_pos": 33, "end_pos": 33, "sequence_org": "N", "sequence_mut": "Q", "comment": "No loss of function.", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" }, { "database": "PubMed", "id": "9053451", "url": "https://glygen.org/publication/PubMed/9053451" } ] }, { "start_pos": 33, "end_pos": 33, "sequence_org": "N", "sequence_mut": "R", "comment": "No loss of function.", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" }, { "database": "PubMed", "id": "9053451", "url": "https://glygen.org/publication/PubMed/9053451" } ] }, { "start_pos": 37, "end_pos": 37, "sequence_org": "D", "sequence_mut": "R", "comment": "No loss of function.", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" }, { "database": "PubMed", "id": "9053451", "url": "https://glygen.org/publication/PubMed/9053451" } ] }, { "start_pos": 48, "end_pos": 48, "sequence_org": "F", "sequence_mut": "R", "comment": "Some loss of function. Some lysis.", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" }, { "database": "PubMed", "id": "9053451", "url": "https://glygen.org/publication/PubMed/9053451" } ] }, { "start_pos": 49, "end_pos": 49, "sequence_org": "D", "sequence_mut": "R", "comment": "Loss of function. Lysis.", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" }, { "database": "PubMed", "id": "9053451", "url": "https://glygen.org/publication/PubMed/9053451" } ] }, { "start_pos": 58, "end_pos": 58, "sequence_org": "L", "sequence_mut": "E", "comment": "No loss of function.", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" }, { "database": "PubMed", "id": "9053451", "url": "https://glygen.org/publication/PubMed/9053451" } ] }, { "start_pos": 63, "end_pos": 63, "sequence_org": "K", "sequence_mut": "E", "comment": "No loss of function.", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" }, { "database": "PubMed", "id": "9053451", "url": "https://glygen.org/publication/PubMed/9053451" } ] }, { "start_pos": 65, "end_pos": 65, "sequence_org": "W", "sequence_mut": "E", "comment": "Complete loss of function. Lysis.", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" }, { "database": "PubMed", "id": "9053451", "url": "https://glygen.org/publication/PubMed/9053451" } ] }, { "start_pos": 66, "end_pos": 66, "sequence_org": "K", "sequence_mut": "D", "comment": "No loss of function.", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" }, { "database": "PubMed", "id": "10805801", "url": "https://glygen.org/publication/PubMed/10805801" } ] }, { "start_pos": 66, "end_pos": 66, "sequence_org": "K", "sequence_mut": "Q", "comment": "Loss of glycation mediated inactivation.", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" }, { "database": "PubMed", "id": "10805801", "url": "https://glygen.org/publication/PubMed/10805801" } ] }, { "start_pos": 67, "end_pos": 67, "sequence_org": "F", "sequence_mut": "K", "comment": "No loss of function.", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" }, { "database": "PubMed", "id": "9053451", "url": "https://glygen.org/publication/PubMed/9053451" } ] }, { "start_pos": 69, "end_pos": 69, "sequence_org": "H", "sequence_mut": "Q", "comment": "Loss of glycation mediated inactivation.", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" }, { "database": "PubMed", "id": "10805801", "url": "https://glygen.org/publication/PubMed/10805801" } ] }, { "start_pos": 72, "end_pos": 72, "sequence_org": "F", "sequence_mut": "E", "comment": "Almost complete loss of function. Lysis.", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" }, { "database": "PubMed", "id": "9053451", "url": "https://glygen.org/publication/PubMed/9053451" } ] }, { "start_pos": 78, "end_pos": 78, "sequence_org": "R", "sequence_mut": "E", "comment": "Loss of function. Lysis.", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" }, { "database": "PubMed", "id": "9053451", "url": "https://glygen.org/publication/PubMed/9053451" } ] }, { "start_pos": 79, "end_pos": 79, "sequence_org": "L", "sequence_mut": "D", "comment": "No loss of function.", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" }, { "database": "PubMed", "id": "9053451", "url": "https://glygen.org/publication/PubMed/9053451" } ] }, { "start_pos": 81, "end_pos": 81, "sequence_org": "E", "sequence_mut": "R", "comment": "Almost complete loss of function. Lysis.", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" }, { "database": "PubMed", "id": "9053451", "url": "https://glygen.org/publication/PubMed/9053451" } ] }, { "start_pos": 82, "end_pos": 82, "sequence_org": "N", "sequence_mut": "K", "comment": "No loss of function.", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" }, { "database": "PubMed", "id": "9053451", "url": "https://glygen.org/publication/PubMed/9053451" } ] }, { "start_pos": 87, "end_pos": 87, "sequence_org": "Y", "sequence_mut": "R", "comment": "No loss of function.", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" }, { "database": "PubMed", "id": "9053451", "url": "https://glygen.org/publication/PubMed/9053451" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "98.9", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000085063", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000085063" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "98.89", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000085063", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000085063" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "98.92", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000085063", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000085063" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "97.3", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000085063", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000085063" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.48", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000085063", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000085063" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "99.12", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000085063", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000085063" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "96.8", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000085063", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000085063" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "99.13", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000085063", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000085063" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "99.31", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000085063", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000085063" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "99.05", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000085063", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000085063" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "97.38", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000085063", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000085063" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "98.69", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000085063", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000085063" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "99.39", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000085063", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000085063" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P13987", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13987" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P13987", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13987" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P13987", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13987" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P13987", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13987" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P13987", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13987" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P13987", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13987" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P13987", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13987" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P13987", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13987" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P13987", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13987" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P13987", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13987" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P13987", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13987" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P13987", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13987" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "common_name": "Human" } ], "gene": [ { "name": "CD59", "url": "https://www.uniprot.org/uniprot/P13987", "locus": { "chromosome": "11", "start_pos": 38469, "end_pos": 5000, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "LRG_41", "url": "https://www.ensembl.org/id/LRG_41" } ] } } ], "crossref": [ { "id": "ENSG00000085063", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000085063", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P13987", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13987", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd00117", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00117", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CD59", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CD59", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "966", "url": "https://www.ncbi.nlm.nih.gov/gene/966", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "79", "url": "https://glyconnect.expasy.org/browser/proteins/79", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "1689", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=1689", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P13987", "url": "https://www.ebi.ac.uk/intact/interactors/id:P13987*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR016054", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016054", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018363", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018363", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045860", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045860", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:966", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:966", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "107271", "url": "http://www.omim.org/entry/107271", "database": "MIM", "categories": [ "Other" ] }, { "id": "612300", "url": "http://www.omim.org/entry/612300", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P13987", "url": "https://www.nextprot.org/entry/NX_P13987", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P13987", "url": "https://oglcnac.org/atlas/detail/P13987", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P13987", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P13987", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "CEYSRLA", "url": "https://omabrowser.org/oma/group/CEYSRLA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4299809at2759", "url": "http://www.orthodb.org/?query=4299809at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10036", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10036", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10036:SF24", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10036:SF24", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1CDQ", "url": "https://www.rcsb.org/structure/1CDQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1CDR", "url": "https://www.rcsb.org/structure/1CDR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1CDS", "url": "https://www.rcsb.org/structure/1CDS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1ERG", "url": "https://www.rcsb.org/structure/1ERG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1ERH", "url": "https://www.rcsb.org/structure/1ERH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2J8B", "url": "https://www.rcsb.org/structure/2J8B", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2OFS", "url": "https://www.rcsb.org/structure/2OFS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2UWR", "url": "https://www.rcsb.org/structure/2UWR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2UX2", "url": "https://www.rcsb.org/structure/2UX2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4BIK", "url": "https://www.rcsb.org/structure/4BIK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5IMT", "url": "https://www.rcsb.org/structure/5IMT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5IMY", "url": "https://www.rcsb.org/structure/5IMY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ZD0", "url": "https://www.rcsb.org/structure/6ZD0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8B0F", "url": "https://www.rcsb.org/structure/8B0F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8B0G", "url": "https://www.rcsb.org/structure/8B0G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8B0H", "url": "https://www.rcsb.org/structure/8B0H", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00021", "url": "http://pfam.xfam.org/family/PF00021", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P13987", "url": "https://pharos.nih.gov/targets/P13987", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000055365", "url": "https://proconsortium.org/app/entry/PR:000055365", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055366", "url": "https://proconsortium.org/app/entry/PR:000055366", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055367", "url": "https://proconsortium.org/app/entry/PR:000055367", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055368", "url": "https://proconsortium.org/app/entry/PR:000055368", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055369", "url": "https://proconsortium.org/app/entry/PR:000055369", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055370", "url": "https://proconsortium.org/app/entry/PR:000055370", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055371", "url": "https://proconsortium.org/app/entry/PR:000055371", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055372", "url": "https://proconsortium.org/app/entry/PR:000055372", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055373", "url": "https://proconsortium.org/app/entry/PR:000055373", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055374", "url": "https://proconsortium.org/app/entry/PR:000055374", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055375", "url": "https://proconsortium.org/app/entry/PR:000055375", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055376", "url": "https://proconsortium.org/app/entry/PR:000055376", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055377", "url": "https://proconsortium.org/app/entry/PR:000055377", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055378", "url": "https://proconsortium.org/app/entry/PR:000055378", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055379", "url": "https://proconsortium.org/app/entry/PR:000055379", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055380", "url": "https://proconsortium.org/app/entry/PR:000055380", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055381", "url": "https://proconsortium.org/app/entry/PR:000055381", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055382", "url": "https://proconsortium.org/app/entry/PR:000055382", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055383", "url": "https://proconsortium.org/app/entry/PR:000055383", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055384", "url": "https://proconsortium.org/app/entry/PR:000055384", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055385", "url": "https://proconsortium.org/app/entry/PR:000055385", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055386", "url": "https://proconsortium.org/app/entry/PR:000055386", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055387", "url": "https://proconsortium.org/app/entry/PR:000055387", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055388", "url": "https://proconsortium.org/app/entry/PR:000055388", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055389", "url": "https://proconsortium.org/app/entry/PR:000055389", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055390", "url": "https://proconsortium.org/app/entry/PR:000055390", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055391", "url": "https://proconsortium.org/app/entry/PR:000055391", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055392", "url": "https://proconsortium.org/app/entry/PR:000055392", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055393", "url": "https://proconsortium.org/app/entry/PR:000055393", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055394", "url": "https://proconsortium.org/app/entry/PR:000055394", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055395", "url": "https://proconsortium.org/app/entry/PR:000055395", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055396", "url": "https://proconsortium.org/app/entry/PR:000055396", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055397", "url": "https://proconsortium.org/app/entry/PR:000055397", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P13987", "url": "http://purl.obolibrary.org/obo/PR_P13987", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000602", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P13987", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A0A2U3TZL5", "url": "https://www.uniprot.org/uniprot/A0A2U3TZL5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2U3TZL5-1", "url": "https://www.uniprot.org/uniprot/A0A2U3TZL5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C059", "url": "https://www.uniprot.org/uniprot/A0A494C059", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C059-1", "url": "https://www.uniprot.org/uniprot/A0A494C059-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C0W4", "url": "https://www.uniprot.org/uniprot/A0A494C0W4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A494C0W4-1", "url": "https://www.uniprot.org/uniprot/A0A494C0W4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A499FJN7", "url": "https://www.uniprot.org/uniprot/A0A499FJN7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A499FJN7-1", "url": "https://www.uniprot.org/uniprot/A0A499FJN7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A9L9PXZ4", "url": "https://www.uniprot.org/uniprot/A0A9L9PXZ4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A9L9PXZ4-1", "url": "https://www.uniprot.org/uniprot/A0A9L9PXZ4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PI80", "url": "https://www.uniprot.org/uniprot/E9PI80", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PI80-1", "url": "https://www.uniprot.org/uniprot/E9PI80-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13987-1", "url": "https://www.uniprot.org/uniprot/P13987-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13987-2", "url": "https://www.uniprot.org/uniprot/P13987-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP", "length": 128, "header": "sp|P13987-1|CD59_HUMAN Isoform 1 of CD59 glycoprotein OS=Homo sapiens OX=9606 GN=CD59 PE=1 SV=1 CANONICAL=P13987-1" }, "isoforms": [ { "isoform_ac": "A0A2U3TZL5-1", "url": "", "sequence": { "sequence": "MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFL", "length": 120, "header": "tr|A0A2U3TZL5-1|CD59_HUMAN Computationally mapped isoform of CD59 glycoprotein OS=Homo sapiens OX=9606 GN=CD59 PE=1 SV=1 CANONICAL=P13987-1" }, "locus": { "chromosome": "11", "start_pos": 33722445, "end_pos": 33710153, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000528700.2", "url": "https://www.ensembl.org/id/ENST00000528700.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000434617.2", "url": "https://www.ensembl.org/id/ENSP00000434617.2" } ] } }, { "isoform_ac": "A0A494C059-1", "url": "", "sequence": { "sequence": "MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKADTHPLRGGGQDSYACSYKLRSVVFQALHGIGVGISLCCPGWPQAILSLQPPKVLGLQV", "length": 114, "header": "tr|A0A494C059-1|CD59_HUMAN Computationally mapped isoform of CD59 glycoprotein OS=Homo sapiens OX=9606 GN=CD59 PE=1 SV=1 CANONICAL=P13987-1" }, "locus": { "chromosome": "11", "start_pos": 33722445, "end_pos": 33711424, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000652086.1", "url": "https://www.ensembl.org/id/ENST00000652086.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000498387.1", "url": "https://www.ensembl.org/id/ENSP00000498387.1" } ] } }, { "isoform_ac": "A0A494C0W4-1", "url": "", "sequence": { "sequence": "XTADCKTAVNCSSDFDACLITKAES", "length": 25, "header": "tr|A0A494C0W4-1|A0A494C0W4_HUMAN Computationally mapped isoform of CD59 molecule (CD59 blood group) OS=Homo sapiens OX=9606 GN=CD59 PE=4 SV=1 CANONICAL=P13987-1" }, "locus": { "chromosome": "11", "start_pos": 33717437, "end_pos": 33716862, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000651485.1", "url": "https://www.ensembl.org/id/ENST00000651485.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000498762.1", "url": "https://www.ensembl.org/id/ENSP00000498762.1" } ] } }, { "isoform_ac": "A0A499FJN7-1", "url": "", "sequence": { "sequence": "MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKADTHPLRGGGQDSYACSYKLRSVVFQALHGIGVTSV", "length": 91, "header": "tr|A0A499FJN7-1|CD59_HUMAN Computationally mapped isoform of CD59 glycoprotein OS=Homo sapiens OX=9606 GN=CD59 PE=1 SV=1 CANONICAL=P13987-1" }, "locus": { "chromosome": "11", "start_pos": 33722445, "end_pos": 33710331, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000426650.7", "url": "https://www.ensembl.org/id/ENST00000426650.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000402425.3", "url": "https://www.ensembl.org/id/ENSP00000402425.3" } ] } }, { "isoform_ac": "A0A9L9PXZ4-1", "url": "", "sequence": { "sequence": "MGIQGGSVLFGLLLVLAVFCHSACSATTVLTQLLTAKQPSIVHLILMRVSLPKLGYKCITSVGSLSIAISTTSQPA", "length": 76, "header": "tr|A0A9L9PXZ4-1|CD59_HUMAN Computationally mapped isoform of CD59 glycoprotein OS=Homo sapiens OX=9606 GN=CD59 PE=1 SV=1 CANONICAL=P13987-1" }, "locus": { "chromosome": "11", "start_pos": 33722445, "end_pos": 33710278, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000706436.1", "url": "https://www.ensembl.org/id/ENST00000706436.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000516379.1", "url": "https://www.ensembl.org/id/ENSP00000516379.1" } ] } }, { "isoform_ac": "E9PI80-1", "url": "", "sequence": { "sequence": "MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAELGYHYVAQAGRRQSSHFSLLKCWDYRCEPSHWPHCPYFNWGYKCITSVGSLSIAISTTSQPA", "length": 119, "header": "tr|E9PI80-1|CD59_HUMAN Computationally mapped isoform of CD59 glycoprotein OS=Homo sapiens OX=9606 GN=CD59 PE=1 SV=1 CANONICAL=P13987-1" }, "locus": { "chromosome": "11", "start_pos": 33722445, "end_pos": 33710278, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000643183.1", "url": "https://www.ensembl.org/id/ENST00000643183.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000495784.1", "url": "https://www.ensembl.org/id/ENSP00000495784.1" } ] } }, { "isoform_ac": "P13987-1", "url": "", "sequence": { "sequence": "MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP", "length": 128, "header": "sp|P13987-1|CD59_HUMAN Isoform 1 of CD59 glycoprotein OS=Homo sapiens OX=9606 GN=CD59 PE=1 SV=1 CANONICAL=P13987-1" }, "locus": { "chromosome": "11", "start_pos": 33722445, "end_pos": 33710129, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000642928.2", "url": "https://www.ensembl.org/id/ENST00000642928.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000494884.1", "url": "https://www.ensembl.org/id/ENSP00000494884.1" } ] } }, { "isoform_ac": "P13987-2", "url": "", "sequence": { "sequence": "MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENDTFLKALKDEKLQGLKTKQPGKKSASLS", "length": 130, "header": "sp|P13987-2|CD59_HUMAN Isoform 2 of CD59 glycoprotein OS=Homo sapiens OX=9606 GN=CD59 PE=1 SV=1 CANONICAL=P13987-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G51287LK", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 105, "start_aa": "Thr", "end_pos": 105, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr105", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G60554YG", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 105, "start_aa": "Thr", "end_pos": 105, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr105", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G74724QE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 105, "start_aa": "Thr", "end_pos": 105, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr105", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G31685JQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 106, "start_aa": "Ser", "end_pos": 106, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser106", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G12728EY", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 40, "start_aa": "Thr", "end_pos": 40, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr40", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G22625SJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 40, "start_aa": "Thr", "end_pos": 40, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr40", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G47448YK", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 40, "start_aa": "Thr", "end_pos": 40, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr40", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 40, "start_aa": "Thr", "end_pos": 40, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr40", "evidence": [ { "id": "P13987", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P13987" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" } ] }, { "glytoucan_ac": "G00176HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Asn43", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G02315DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G03382KH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G06290IR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G06330RB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G07483YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: Asn43 ; Asn43", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G08520NM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Asn43", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G12793SR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G13728QT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G14456RI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G14882EB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Asn43", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G15488CF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G16828VN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Asn43", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G20312EM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G22625SJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G22768VO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: Asn43 ; Asn43", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G23133OF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G23984SE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G24835MQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G24954UD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G27919IH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: Asn43 ; Asn43", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G29501UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G30751OD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G30799SW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G31596VW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G31615DN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G34617SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G36013ES", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G36134VO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: Asn43 ; Asn43", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Asn43", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G37773JL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G39064KU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G39213VZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Asn43", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G39595FH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G40124HY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: Asn43 ; Asn43", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G41405QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: Asn43 ; Asn43", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G44173IH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G44413JJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G44778BV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G45883VE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G46487SG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G46665ZP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G46902YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G50120TH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G50427EO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G51413EV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G52114WE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G52358QA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G52589SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G55220VL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Asn43", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G56087PR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G57557NS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G57888GL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G57939IT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G58596DI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G58598BO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G58667NI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Asn43", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G60177UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G61207RZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: Asn43 ; Asn43", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G61505ZR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G61806WR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G63628AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G63640QH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G63889NK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: Asn43 ; Asn43", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G64227LK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G65019XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G65092SV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G66621EA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G66760KM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G67900CJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G68833MP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G70822IO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G70894RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G71146HJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G71919QK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Asn43", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G72667IM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G72886NH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G75607BQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G76417NN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G77023TY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G77149EE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Asn43", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Asn43", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G78502KD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G80858MF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Asn43", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G80966KZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: Asn43 ; Asn43", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G81198YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G82348BZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Asn43", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G83229XP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G85737WG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G86182NS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G86226EA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G86234IN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G86357DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Asn43", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G86408JD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G87618BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G90717TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "Asn43", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G92062TF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G92081HT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G93141AZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: Asn43 ; Asn43", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G93993PD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: Asn43 ; Asn43", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G94831VI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G95977AE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 43, "start_aa": "Asn", "end_pos": 43, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn43", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" }, { "id": "P13987", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13987#ptm_processing" }, { "id": "18780401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18780401" }, { "id": "8670172", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8670172" }, { "id": "1CDR", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1CDR" }, { "id": "1CDS", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1CDS" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "FEHCNFNDVTTR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 67, "start_aa": "Phe", "end_pos": 78, "end_aa": "Arg", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 76, "start_aa": "Thr", "end_pos": 76, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr76", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 76, "start_aa": "Thr", "end_pos": 76, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr76", "evidence": [ { "id": "P13987", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13987#ptm_processing" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "TT", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 76, "start_aa": "Thr", "end_pos": 77, "end_aa": "Thr", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 77, "start_aa": "Thr", "end_pos": 77, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr77", "evidence": [ { "id": "P13987", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 77, "start_aa": "Thr", "end_pos": 77, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr77", "evidence": [ { "id": "P13987", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13987#ptm_processing" } ] }, { "glytoucan_ac": "G01079KY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G16389EC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G31544HA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G39213VZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P13987", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P13987" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G51519NL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G70894RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G71269BI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G75727PF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G80218BM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "glytoucan_ac": "G83461WR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "7514386", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "79", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/79" }, { "id": "10207177", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/10207177" } ] } ], "phosphorylation": [], "glycation": [ { "start_pos": 66, "end_pos": 66, "glytoucan_ac": "", "type": "N-linked", "residue": "Lys", "comment": "N-linked (Glc) (glycation) lysine", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987#ptm_processing" }, { "database": "PubMed", "id": "10805801", "url": "https://glygen.org/publication/PubMed/10805801" } ], "relation": "attached" } ], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported", "glycatedprotein", "glycatedprotein_reported" ], "publication": [ { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "P13987", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "Probing the O-Glycoproteome of Gastric Cancer Cell Lines for Biomarker Discovery", "journal": "Molecular & Cellular Proteomics", "date": "2015", "authors": "Campos D., Freitas D., Gomes J., Magalh\u00e3es A., Steentoft C., Gomes C., Vester-Christensen M. B., Ferreira J. A., Afonso L. P., Santos L. L., Pinto de Sousa J., Mandel U., Clausen H., Vakhrushev S. Y., Reis C. A.", "evidence": [ { "database": "UniCarbKB", "id": "P13987", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1074/mcp.M114.046862", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "title": "Coupling of coat assembly and vesicle budding to packaging of putative cargo receptors.", "journal": "Cell", "date": "1999", "authors": "Bremser M, Nickel W, Schweikert M, Ravazzola M, Amherdt M, Hughes CA, Sollner TH, Rothman JE, Wieland FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "10052452", "url": "https://glygen.org/publication/PubMed/10052452" } ] }, { "title": "Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells.", "journal": "Glycobiology", "date": "1999", "authors": "Rudd PM, Wormald MR, Harvey DJ, Devasahayam M, McAlister MS, Brown MH, Davis SJ, Barclay AN, Dwek RA", "evidence": [ { "database": "UniCarbKB", "id": "P13987", "url": "" }, { "database": "GlyConnect", "id": "79", "url": "https://glyconnect.expasy.org/browser/proteins/79" } ], "reference": [ { "type": "PubMed", "id": "10207177", "url": "https://glygen.org/publication/PubMed/10207177" } ] }, { "title": "GTP-dependent binding of ADP-ribosylation factor to coatomer in close proximity to the binding site for dilysine retrieval motifs and p23.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Zhao L, Helms JB, Brunner J, Wieland FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "10318838", "url": "https://glygen.org/publication/PubMed/10318838" } ] }, { "title": "NSF N-terminal domain crystal structure: models of NSF function.", "journal": "Molecular cell", "date": "1999", "authors": "Yu RC, Jahn R, Brunger AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "10445031", "url": "https://glygen.org/publication/PubMed/10445031" } ] }, { "title": "Decay accelerating activity of complement receptor type 1 (CD35). Two active sites are required for dissociating C5 convertases.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Krych-Goldberg M, Hauhart RE, Subramanian VB, Yurcisin BM 2nd, Crimmins DL, Hourcade DE, Atkinson JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "10531307", "url": "https://glygen.org/publication/PubMed/10531307" } ] }, { "title": "The lectin ERGIC-53 is a cargo transport receptor for glycoproteins.", "journal": "Nature cell biology", "date": "1999", "authors": "Appenzeller C, Andersson H, Kappeler F, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "10559958", "url": "https://glygen.org/publication/PubMed/10559958" } ] }, { "title": "An NSF function distinct from ATPase-dependent SNARE disassembly is essential for Golgi membrane fusion.", "journal": "Nature cell biology", "date": "1999", "authors": "Muller JM, Rabouille C, Newman R, Shorter J, Freemont P, Schiavo G, Warren G, Shima DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "10559959", "url": "https://glygen.org/publication/PubMed/10559959" } ] }, { "title": "ERGIC-53 and traffic in the secretory pathway.", "journal": "Journal of cell science", "date": "2000", "authors": "Hauri HP, Kappeler F, Andersson H, Appenzeller C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "10652252", "url": "https://glygen.org/publication/PubMed/10652252" } ] }, { "title": "Control of the amplification convertase of complement by the plasma protein beta1H.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1976", "authors": "Weiler JM, Daha MR, Austen KF, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "1067618", "url": "https://glygen.org/publication/PubMed/1067618" } ] }, { "title": "The role of the tethering proteins p115 and GM130 in transport through the Golgi apparatus in vivo.", "journal": "Molecular biology of the cell", "date": "2000", "authors": "Seemann J, Jokitalo EJ, Warren G", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "10679020", "url": "https://glygen.org/publication/PubMed/10679020" } ] }, { "title": "Asymmetric requirements for a Rab GTPase and SNARE proteins in fusion of COPII vesicles with acceptor membranes.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Cao X, Barlowe C", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "10747087", "url": "https://glygen.org/publication/PubMed/10747087" } ] }, { "title": "Decoding of sorting signals by coatomer through a GTPase switch in the COPI coat complex.", "journal": "Cell", "date": "2000", "authors": "Goldberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "10761932", "url": "https://glygen.org/publication/PubMed/10761932" } ] }, { "title": "Molecular basis for a link between complement and the vascular complications of diabetes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Acosta J, Hettinga J, Fluckiger R, Krumrei N, Goldfine A, Angarita L, Halperin J", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987#ptm_processing" }, { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "reference": [ { "type": "PubMed", "id": "10805801", "url": "https://glygen.org/publication/PubMed/10805801" } ] }, { "title": "COPI-coated ER-to-Golgi transport complexes segregate from COPII in close proximity to ER exit sites.", "journal": "Journal of cell science", "date": "2000", "authors": "Stephens DJ, Lin-Marq N, Pagano A, Pepperkok R, Paccaud JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "10825291", "url": "https://glygen.org/publication/PubMed/10825291" } ] }, { "title": "Rab1 recruitment of p115 into a cis-SNARE complex: programming budding COPII vesicles for fusion.", "journal": "Science (New York, N.Y.)", "date": "2000", "authors": "Allan BB, Moyer BD, Balch WE", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "10903204", "url": "https://glygen.org/publication/PubMed/10903204" } ] }, { "title": "COP I domains required for coatomer integrity, and novel interactions with ARF and ARF-GAP.", "journal": "The EMBO journal", "date": "2000", "authors": "Eugster A, Frigerio G, Dale M, Duden R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "10921873", "url": "https://glygen.org/publication/PubMed/10921873" } ] }, { "title": "Dynamics of transitional endoplasmic reticulum sites in vertebrate cells.", "journal": "Molecular biology of the cell", "date": "2000", "authors": "Hammond AT, Glick BS", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "10982397", "url": "https://glygen.org/publication/PubMed/10982397" } ] }, { "title": "Subunit structure of a mammalian ER/Golgi SNARE complex.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Xu D, Joglekar AP, Williams AL, Hay JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "11035026", "url": "https://glygen.org/publication/PubMed/11035026" } ] }, { "title": "The p115-interactive proteins GM130 and giantin participate in endoplasmic reticulum-Golgi traffic.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Alvarez C, Garcia-Mata R, Hauri HP, Sztul E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "11035033", "url": "https://glygen.org/publication/PubMed/11035033" } ] }, { "title": "Functional characterization of novel human ARFGAP3.", "journal": "FEBS letters", "date": "2001", "authors": "Liu X, Zhang C, Xing G, Chen Q, He F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "11172815", "url": "https://glygen.org/publication/PubMed/11172815" } ] }, { "title": "Rab1 interaction with a GM130 effector complex regulates COPII vesicle cis--Golgi tethering.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2001", "authors": "Moyer BD, Allan BB, Balch WE", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "11285137", "url": "https://glygen.org/publication/PubMed/11285137" } ] }, { "title": "The Golgi matrix protein GM130: a specific interacting partner of the small GTPase rab1b.", "journal": "EMBO reports", "date": "2001", "authors": "Weide T, Bayer M, Koster M, Siebrasse JP, Peters R, Barnekow A", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "11306556", "url": "https://glygen.org/publication/PubMed/11306556" } ] }, { "title": "beta III spectrin binds to the Arp1 subunit of dynactin.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Holleran EA, Ligon LA, Tokito M, Stankewich MC, Morrow JS, Holzbaur EL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "11461920", "url": "https://glygen.org/publication/PubMed/11461920" } ] }, { "title": "Chimaerins, novel non-protein kinase C phorbol ester receptors, associate with Tmp21-I (p23): evidence for a novel anchoring mechanism involving the chimaerin C1 domain.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Wang H, Kazanietz MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "11689559", "url": "https://glygen.org/publication/PubMed/11689559" } ] }, { "title": "Decay-accelerating factor (DAF), complement receptor 1 (CR1), and factor H dissociate the complement AP C3 convertase (C3bBb) via sites on the type A domain of Bb.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Hourcade DE, Mitchell L, Kuttner-Kondo LA, Atkinson JP, Medof ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "11694537", "url": "https://glygen.org/publication/PubMed/11694537" } ] }, { "title": "KDEL-cargo regulates interactions between proteins involved in COPI vesicle traffic: measurements in living cells using FRET.", "journal": "Developmental cell", "date": "2001", "authors": "Majoul I, Straub M, Hell SW, Duden R, Soling HD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "11703931", "url": "https://glygen.org/publication/PubMed/11703931" } ] }, { "title": "Recruitment to Golgi membranes of ADP-ribosylation factor 1 is mediated by the cytoplasmic domain of p23.", "journal": "The EMBO journal", "date": "2001", "authors": "Gommel DU, Memon AR, Heiss A, Lottspeich F, Pfannstiel J, Lechner J, Reinhard C, Helms JB, Nickel W, Wieland FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "11726511", "url": "https://glygen.org/publication/PubMed/11726511" } ] }, { "title": "Sorting of Golgi resident proteins into different subpopulations of COPI vesicles: a role for ArfGAP1.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Lanoix J, Ouwendijk J, Stark A, Szafer E, Cassel D, Dejgaard K, Weiss M, Nilsson T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "11748249", "url": "https://glygen.org/publication/PubMed/11748249" } ] }, { "title": "Sequential tethering of Golgins and catalysis of SNAREpin assembly by the vesicle-tethering protein p115.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Shorter J, Beard MB, Seemann J, Dirac-Svejstrup AB, Warren G", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "11927603", "url": "https://glygen.org/publication/PubMed/11927603" } ] }, { "title": "Inactivation of C3a and C5a octapeptides by carboxypeptidase R and carboxypeptidase N.", "journal": "Microbiology and immunology", "date": "2002", "authors": "Campbell WD, Lazoura E, Okada N, Okada H", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "11939578", "url": "https://glygen.org/publication/PubMed/11939578" } ] }, { "title": "GBF1, a guanine nucleotide exchange factor for ADP-ribosylation factors, is localized to the cis-Golgi and involved in membrane association of the COPI coat.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2002", "authors": "Kawamoto K, Yoshida Y, Tamaki H, Torii S, Shinotsuka C, Yamashina S, Nakayama K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "12047556", "url": "https://glygen.org/publication/PubMed/12047556" } ] }, { "title": "Role of membrane cofactor protein (CD46) in regulation of C4b and C3b deposited on cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2002", "authors": "Barilla-LaBarca ML, Liszewski MK, Lambris JD, Hourcade D, Atkinson JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "12055245", "url": "https://glygen.org/publication/PubMed/12055245" } ] }, { "title": "Sequential SNARE disassembly and GATE-16-GOS-28 complex assembly mediated by distinct NSF activities drives Golgi membrane fusion.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Muller JM, Shorter J, Newman R, Deinhardt K, Sagiv Y, Elazar Z, Warren G, Shima DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "12070132", "url": "https://glygen.org/publication/PubMed/12070132" } ] }, { "title": "Sec16p potentiates the action of COPII proteins to bud transport vesicles.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Supek F, Madden DT, Hamamoto S, Orci L, Schekman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "12235121", "url": "https://glygen.org/publication/PubMed/12235121" } ] }, { "title": "Oligomeric state and stoichiometry of p24 proteins in the early secretory pathway.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Jenne N, Frey K, Brugger B, Wieland FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "12237308", "url": "https://glygen.org/publication/PubMed/12237308" } ] }, { "title": "GS15 forms a SNARE complex with syntaxin 5, GS28, and Ykt6 and is implicated in traffic in the early cisternae of the Golgi apparatus.", "journal": "Molecular biology of the cell", "date": "2002", "authors": "Xu Y, Martin S, James DE, Hong W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "12388752", "url": "https://glygen.org/publication/PubMed/12388752" } ] }, { "title": "The membrane-tethering protein p115 interacts with GBF1, an ARF guanine-nucleotide-exchange factor.", "journal": "EMBO reports", "date": "2003", "authors": "Garcia-Mata R, Sztul E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "12634853", "url": "https://glygen.org/publication/PubMed/12634853" } ] }, { "title": "The human complement regulatory protein CD59 binds to the alpha-chain of C8 and to the ''b'' domain of C9.", "journal": "J. Biol. Chem.", "date": "1992", "authors": "Ninomiya H, Sims P J", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "reference": [ { "type": "PubMed", "id": "1377690", "url": "https://glygen.org/publication/PubMed/1377690" } ] }, { "title": "Structure of the CD59-encoding gene: further evidence of a relationship to murine lymphocyte antigen Ly-6 protein.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1992", "authors": "Petranka J G, Fleenor D E, Sykes K, Kaufman R E, Rosse W F", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "reference": [ { "type": "PubMed", "id": "1381503", "url": "https://glygen.org/publication/PubMed/1381503" } ] }, { "title": "Paroxysmal nocturnal hemoglobinuria due to hereditary nucleotide deletion in the HRF20 (CD59) gene.", "journal": "Eur. J. Immunol.", "date": "1992", "authors": "Motoyama N, Okada N, Yamashina M, Okada H", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "reference": [ { "type": "PubMed", "id": "1382994", "url": "https://glygen.org/publication/PubMed/1382994" } ] }, { "title": "Gene structure of human CD59 and demonstration that discrete mRNAs are generated by alternative polyadenylation.", "journal": "J. Mol. Biol.", "date": "1992", "authors": "Tone M, Walsh L A, Waldmann H", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "reference": [ { "type": "PubMed", "id": "1383553", "url": "https://glygen.org/publication/PubMed/1383553" } ] }, { "title": "Factor I-dependent inactivation of human complement C4b of the classical pathway by C3b/C4b receptor (CR1, CD35) and membrane cofactor protein (MCP, CD46).", "journal": "Journal of biochemistry", "date": "1992", "authors": "Masaki T, Matsumoto M, Nakanishi I, Yasuda R, Seya T", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "1386357", "url": "https://glygen.org/publication/PubMed/1386357" } ] }, { "title": "Lipid packing sensed by ArfGAP1 couples COPI coat disassembly to membrane bilayer curvature.", "journal": "Nature", "date": "2003", "authors": "Bigay J, Gounon P, Robineau S, Antonny B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "14654841", "url": "https://glygen.org/publication/PubMed/14654841" } ] }, { "title": "Countercurrent distribution of two distinct SNARE complexes mediating transport within the Golgi stack.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Volchuk A, Ravazzola M, Perrelet A, Eng WS, Di Liberto M, Varlamov O, Fukasawa M, Engel T, Sollner TH, Rothman JE, Orci L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "14742712", "url": "https://glygen.org/publication/PubMed/14742712" } ] }, { "title": "Multiple binding proteins suggest diverse functions for the N-ethylmaleimide sensitive factor.", "journal": "Journal of structural biology", "date": "2004", "authors": "Whiteheart SW, Matveeva EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "15037235", "url": "https://glygen.org/publication/PubMed/15037235" } ] }, { "title": "Dynamics of GBF1, a Brefeldin A-sensitive Arf1 exchange factor at the Golgi.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Niu TK, Pfeifer AC, Lippincott-Schwartz J, Jackson CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "15616190", "url": "https://glygen.org/publication/PubMed/15616190" } ] }, { "title": "Live imaging of bidirectional traffic from the ERGIC.", "journal": "Journal of cell science", "date": "2005", "authors": "Ben-Tekaya H, Miura K, Pepperkok R, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "15632110", "url": "https://glygen.org/publication/PubMed/15632110" } ] }, { "title": "Cog3p depletion blocks vesicle-mediated Golgi retrograde trafficking in HeLa cells.", "journal": "The Journal of cell biology", "date": "2005", "authors": "Zolov SN, Lupashin VV", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "15728195", "url": "https://glygen.org/publication/PubMed/15728195" } ] }, { "title": "Dissection of membrane dynamics of the ARF-guanine nucleotide exchange factor GBF1.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2005", "authors": "Szul T, Garcia-Mata R, Brandon E, Shestopal S, Alvarez C, Sztul E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "15813748", "url": "https://glygen.org/publication/PubMed/15813748" } ] }, { "title": "A cryptic Rab1-binding site in the p115 tethering protein.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Beard M, Satoh A, Shorter J, Warren G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "15878873", "url": "https://glygen.org/publication/PubMed/15878873" } ] }, { "title": "Isoform-selective effects of the depletion of ADP-ribosylation factors 1-5 on membrane traffic.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Volpicelli-Daley LA, Li Y, Zhang CJ, Kahn RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "16030262", "url": "https://glygen.org/publication/PubMed/16030262" } ] }, { "title": "Insights into the human CD59 complement binding interface toward engineering new therapeutics.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Huang Y, Smith CA, Song H, Morgan BP, Abagyan R, Tomlinson S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "16079145", "url": "https://glygen.org/publication/PubMed/16079145" } ] }, { "title": "Sugar-binding properties of VIP36, an intracellular animal lectin operating as a cargo receptor.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Kamiya Y, Yamaguchi Y, Takahashi N, Arata Y, Kasai K, Ihara Y, Matsuo I, Ito Y, Yamamoto K, Kato K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "16129679", "url": "https://glygen.org/publication/PubMed/16129679" } ] }, { "title": "Binding of complement factor H to endothelial cells is mediated by the carboxy-terminal glycosaminoglycan binding site.", "journal": "The American journal of pathology", "date": "2005", "authors": "Jokiranta TS, Cheng ZZ, Seeberger H, Jozsi M, Heinen S, Noris M, Remuzzi G, Ormsby R, Gordon DL, Meri S, Hellwage J, Zipfel PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "16192651", "url": "https://glygen.org/publication/PubMed/16192651" } ] }, { "title": "Cysteine-disulfide cross-linking to monitor SNARE complex assembly during endoplasmic reticulum-Golgi transport.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Flanagan JJ, Barlowe C", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "16303754", "url": "https://glygen.org/publication/PubMed/16303754" } ] }, { "title": "ADP-ribosylation factor, a small GTP-binding protein, is required for binding of the coatomer protein beta-COP to Golgi membranes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Donaldson JG, Cassel D, Kahn RA, Klausner RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "1631136", "url": "https://glygen.org/publication/PubMed/1631136" } ] }, { "title": "On and off membrane dynamics of the endoplasmic reticulum-golgi tethering factor p115 in vivo.", "journal": "Molecular biology of the cell", "date": "2006", "authors": "Brandon E, Szul T, Alvarez C, Grabski R, Benjamin R, Kawai R, Sztul E", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "16624868", "url": "https://glygen.org/publication/PubMed/16624868" } ] }, { "title": "ARF proteins: roles in membrane traffic and beyond.", "journal": "Nature reviews. Molecular cell biology", "date": "2006", "authors": "D'Souza-Schorey C, Chavrier P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "16633337", "url": "https://glygen.org/publication/PubMed/16633337" } ] }, { "title": "The ER-Golgi intermediate compartment (ERGIC): in search of its identity and function.", "journal": "Journal of cell science", "date": "2006", "authors": "Appenzeller-Herzog C, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "16723730", "url": "https://glygen.org/publication/PubMed/16723730" } ] }, { "title": "ADP-ribosylation factor is a subunit of the coat of Golgi-derived COP-coated vesicles: a novel role for a GTP-binding protein.", "journal": "Cell", "date": "1991", "authors": "Serafini T, Orci L, Amherdt M, Brunner M, Kahn RA, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "1680566", "url": "https://glygen.org/publication/PubMed/1680566" } ] }, { "title": "The CD59 antigen is a structural homologue of murine Ly-6 antigens but lacks interferon inducibility.", "journal": "Eur. J. Immunol.", "date": "1990", "authors": "Philbrick W M, Palfree R G, Maher S E, Bridgett M M, Sirlin S, Bothwell A L", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "reference": [ { "type": "PubMed", "id": "1689664", "url": "https://glygen.org/publication/PubMed/1689664" } ] }, { "title": "SNAREs--engines for membrane fusion.", "journal": "Nature reviews. Molecular cell biology", "date": "2006", "authors": "Jahn R, Scheller RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "16912714", "url": "https://glygen.org/publication/PubMed/16912714" } ] }, { "title": "GBF1, a cis-Golgi and VTCs-localized ARF-GEF, is implicated in ER-to-Golgi protein traffic.", "journal": "Journal of cell science", "date": "2006", "authors": "Zhao X, Claude A, Chun J, Shields DJ, Presley JF, Melancon P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "16926190", "url": "https://glygen.org/publication/PubMed/16926190" } ] }, { "title": "Isolation and expression of the full-length cDNA encoding CD59 antigen of human lymphocytes.", "journal": "DNA Cell Biol.", "date": "1990", "authors": "Sawada R, Ohashi K, Anaguchi H, Okazaki H, Hattori M, Minato N, Naruto M", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "reference": [ { "type": "PubMed", "id": "1692709", "url": "https://glygen.org/publication/PubMed/1692709" } ] }, { "title": "Coatomer, the coat protein of COPI transport vesicles, discriminates endoplasmic reticulum residents from p24 proteins.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Bethune J, Kol M, Hoffmann J, Reckmann I, Brugger B, Wieland F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "16940185", "url": "https://glygen.org/publication/PubMed/16940185" } ] }, { "title": "Levels of expression of complement regulatory proteins CD46, CD55 and CD59 on resting and activated human peripheral blood leucocytes.", "journal": "Immunology", "date": "2006", "authors": "Christmas SE, de la Mata Espinosa CT, Halliday D, Buxton CA, Cummerson JA, Johnson PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "16999828", "url": "https://glygen.org/publication/PubMed/16999828" } ] }, { "title": "Sec16 defines endoplasmic reticulum exit sites and is required for secretory cargo export in mammalian cells.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2006", "authors": "Watson P, Townley AK, Koka P, Palmer KJ, Stephens DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "17005010", "url": "https://glygen.org/publication/PubMed/17005010" } ] }, { "title": "Cargo selectivity of the ERGIC-53/MCFD2 transport receptor complex.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2006", "authors": "Nyfeler B, Zhang B, Ginsburg D, Kaufman RJ, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "17010120", "url": "https://glygen.org/publication/PubMed/17010120" } ] }, { "title": "SNARE status regulates tether recruitment and function in homotypic COPII vesicle fusion.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Bentley M, Liang Y, Mullen K, Xu D, Sztul E, Hay JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "17038314", "url": "https://glygen.org/publication/PubMed/17038314" } ] }, { "title": "Decay-accelerating factor must bind both components of the complement alternative pathway C3 convertase to mediate efficient decay.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Harris CL, Pettigrew DM, Lea SM, Morgan BP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "17182573", "url": "https://glygen.org/publication/PubMed/17182573" } ] }, { "title": "Two mammalian Sec16 homologues have nonredundant functions in endoplasmic reticulum (ER) export and transitional ER organization.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Bhattacharyya D, Glick BS", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "17192411", "url": "https://glygen.org/publication/PubMed/17192411" } ] }, { "title": "Two lipid-packing sensor motifs contribute to the sensitivity of ArfGAP1 to membrane curvature.", "journal": "Biochemistry", "date": "2007", "authors": "Mesmin B, Drin G, Levi S, Rawet M, Cassel D, Bigay J, Antonny B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "17253781", "url": "https://glygen.org/publication/PubMed/17253781" } ] }, { "title": "The interaction of two tethering factors, p115 and COG complex, is required for Golgi integrity.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2007", "authors": "Sohda M, Misumi Y, Yoshimura S, Nakamura N, Fusano T, Ogata S, Sakisaka S, Ikehara Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "17274799", "url": "https://glygen.org/publication/PubMed/17274799" } ] }, { "title": "TRAPPI tethers COPII vesicles by binding the coat subunit Sec23.", "journal": "Nature", "date": "2007", "authors": "Cai H, Yu S, Menon S, Cai Y, Lazarova D, Fu C, Reinisch K, Hay JC, Ferro-Novick S", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "17287728", "url": "https://glygen.org/publication/PubMed/17287728" } ] }, { "title": "Mechanisms of COPII vesicle formation and protein sorting.", "journal": "FEBS letters", "date": "2007", "authors": "Sato K, Nakano A", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "17316621", "url": "https://glygen.org/publication/PubMed/17316621" } ] }, { "title": "Differential localization of coatomer complex isoforms within the Golgi apparatus.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Moelleken J, Malsam J, Betts MJ, Movafeghi A, Reckmann I, Meissner I, Hellwig A, Russell RB, Sollner T, Brugger B, Wieland FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "17360540", "url": "https://glygen.org/publication/PubMed/17360540" } ] }, { "title": "Rab1b interacts with GBF1 and modulates both ARF1 dynamics and COPI association.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Monetta P, Slavin I, Romero N, Alvarez C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "17429068", "url": "https://glygen.org/publication/PubMed/17429068" } ] }, { "title": "Multiple and stepwise interactions between coatomer and ADP-ribosylation factor-1 (Arf1)-GTP.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2007", "authors": "Sun Z, Anderl F, Frohlich K, Zhao L, Hanke S, Brugger B, Wieland F, Bethune J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "17451557", "url": "https://glygen.org/publication/PubMed/17451557" } ] }, { "title": "The transport signal on Sec22 for packaging into COPII-coated vesicles is a conformational epitope.", "journal": "Molecular cell", "date": "2007", "authors": "Mancias JD, Goldberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "17499046", "url": "https://glygen.org/publication/PubMed/17499046" } ] }, { "title": "Crystal structure of CD59: implications for molecular recognition of the complement proteins C8 and C9 in the membrane-attack complex.", "journal": "Acta crystallographica. Section D, Biological crystallography", "date": "2007", "authors": "Huang Y, Fedarovich A, Tomlinson S, Davies C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "17505110", "url": "https://glygen.org/publication/PubMed/17505110" } ] }, { "title": "Specific Rab GTPase-activating proteins define the Shiga toxin and epidermal growth factor uptake pathways.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Fuchs E, Haas AK, Spooner RA, Yoshimura S, Lord JM, Barr FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "17562788", "url": "https://glygen.org/publication/PubMed/17562788" } ] }, { "title": "Computational approach for identification and characterization of GPI-anchored peptides in proteomics experiments.", "journal": "Proteomics", "date": "2007", "authors": "Omaetxebarria Miren J, Elortza Felix, Rodr\u00edguez-Su\u00e1rez Eva, Aloria Kerman, Arizmendi Jesus M, Jensen Ole N, Matthiesen Rune", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "reference": [ { "type": "PubMed", "id": "17566972", "url": "https://glygen.org/publication/PubMed/17566972" } ] }, { "title": "Cornichon regulates transport and secretion of TGFalpha-related proteins in metazoan cells.", "journal": "Journal of cell science", "date": "2007", "authors": "Castro CP, Piscopo D, Nakagawa T, Derynck R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "17607000", "url": "https://glygen.org/publication/PubMed/17607000" } ] }, { "title": "Analysis of GTPase-activating proteins: Rab1 and Rab43 are key Rabs required to maintain a functional Golgi complex in human cells.", "journal": "Journal of cell science", "date": "2007", "authors": "Haas AK, Yoshimura S, Stephens DJ, Preisinger C, Fuchs E, Barr FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "17684057", "url": "https://glygen.org/publication/PubMed/17684057" } ] }, { "title": "Two human ARFGAPs associated with COP-I-coated vesicles.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2007", "authors": "Frigerio G, Grimsey N, Dale M, Majoul I, Duden R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "17760859", "url": "https://glygen.org/publication/PubMed/17760859" } ] }, { "title": "Mammalian GPI-anchored proteins require p24 proteins for their efficient transport from the ER to the plasma membrane.", "journal": "The Biochemical journal", "date": "2008", "authors": "Takida S, Maeda Y, Kinoshita T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "17927562", "url": "https://glygen.org/publication/PubMed/17927562" } ] }, { "title": "Dissecting the role of the ARF guanine nucleotide exchange factor GBF1 in Golgi biogenesis and protein trafficking.", "journal": "Journal of cell science", "date": "2007", "authors": "Szul T, Grabski R, Lyons S, Morohashi Y, Shestopal S, Lowe M, Sztul E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "17956946", "url": "https://glygen.org/publication/PubMed/17956946" } ] }, { "title": "Molecular basis of sugar recognition by the human L-type lectins ERGIC-53, VIPL, and VIP36.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Kamiya Y, Kamiya D, Yamamoto K, Nyfeler B, Hauri HP, Kato K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "18025080", "url": "https://glygen.org/publication/PubMed/18025080" } ] }, { "title": "Interaction of the conserved oligomeric Golgi complex with t-SNARE Syntaxin5a/Sed5 enhances intra-Golgi SNARE complex stability.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Shestakova A, Suvorova E, Pavliv O, Khaidakova G, Lupashin V", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "18086915", "url": "https://glygen.org/publication/PubMed/18086915" } ] }, { "title": "A conformational change in the alpha-subunit of coatomer induced by ligand binding to gamma-COP revealed by single-pair FRET.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2008", "authors": "Langer JD, Roth CM, Bethune J, Stoops EH, Brugger B, Herten DP, Wieland FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "18182008", "url": "https://glygen.org/publication/PubMed/18182008" } ] }, { "title": "Identification of ERGIC-53 as an intracellular transport receptor of alpha1-antitrypsin.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Nyfeler B, Reiterer V, Wendeler MW, Stefan E, Zhang B, Michnick SW, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "18283111", "url": "https://glygen.org/publication/PubMed/18283111" } ] }, { "title": "The yeast p24 complex is required for the formation of COPI retrograde transport vesicles from the Golgi apparatus.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Aguilera-Romero A, Kaminska J, Spang A, Riezman H, Muniz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "18283113", "url": "https://glygen.org/publication/PubMed/18283113" } ] }, { "title": "The cargo receptors Surf4, endoplasmic reticulum-Golgi intermediate compartment (ERGIC)-53, and p25 are required to maintain the architecture of ERGIC and Golgi.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Mitrovic S, Ben-Tekaya H, Koegler E, Gruenberg J, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "18287528", "url": "https://glygen.org/publication/PubMed/18287528" } ] }, { "title": "Characterization of class I and II ADP-ribosylation factors (Arfs) in live cells: GDP-bound class II Arfs associate with the ER-Golgi intermediate compartment independently of GBF1.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Chun J, Shapovalova Z, Dejgaard SY, Presley JF, Melancon P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "18524849", "url": "https://glygen.org/publication/PubMed/18524849" } ] }, { "title": "Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.", "journal": "Proteomics", "date": "2008", "authors": "Picariello G, Ferranti P, Mamone G, Roepstorff P, Addeo F", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987#ptm_processing" }, { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "reference": [ { "type": "PubMed", "id": "18780401", "url": "https://glygen.org/publication/PubMed/18780401" } ] }, { "title": "Consensus nomenclature for the human ArfGAP domain-containing proteins.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Kahn RA, Bruford E, Inoue H, Logsdon JM Jr, Nie Z, Premont RT, Randazzo PA, Satake M, Theibert AB, Zapp ML, Cassel D", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "18809720", "url": "https://glygen.org/publication/PubMed/18809720" } ] }, { "title": "Structural basis of cargo membrane protein discrimination by the human COPII coat machinery.", "journal": "The EMBO journal", "date": "2008", "authors": "Mancias JD, Goldberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "18843296", "url": "https://glygen.org/publication/PubMed/18843296" } ] }, { "title": "'Coatomer': a cytosolic protein complex containing subunits of non-clathrin-coated Golgi transport vesicles.", "journal": "Nature", "date": "1991", "authors": "Waters MG, Serafini T, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "1898986", "url": "https://glygen.org/publication/PubMed/1898986" } ] }, { "title": "Differential roles of ArfGAP1, ArfGAP2, and ArfGAP3 in COPI trafficking.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Weimer C, Beck R, Eckert P, Reckmann I, Moelleken J, Brugger B, Wieland F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "19015319", "url": "https://glygen.org/publication/PubMed/19015319" } ] }, { "title": "Discrete determinants in ArfGAP2/3 conferring Golgi localization and regulation by the COPI coat.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Kliouchnikov L, Bigay J, Mesmin B, Parnis A, Rawet M, Goldfeder N, Antonny B, Cassel D", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "19109418", "url": "https://glygen.org/publication/PubMed/19109418" } ] }, { "title": "Membrane fusion: grappling with SNARE and SM proteins.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Sudhof TC, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "19164740", "url": "https://glygen.org/publication/PubMed/19164740" } ] }, { "title": "Functional proteomics identify cornichon proteins as auxiliary subunits of AMPA receptors.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Schwenk J, Harmel N, Zolles G, Bildl W, Kulik A, Heimrich B, Chisaka O, Jonas P, Schulte U, Fakler B, Klocker N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "19265014", "url": "https://glygen.org/publication/PubMed/19265014" } ] }, { "title": "TANGO1 facilitates cargo loading at endoplasmic reticulum exit sites.", "journal": "Cell", "date": "2009", "authors": "Saito K, Chen M, Bard F, Chen S, Zhou H, Woodley D, Polischuk R, Schekman R, Malhotra V", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "19269366", "url": "https://glygen.org/publication/PubMed/19269366" } ] }, { "title": "Arf GAP2 is positively regulated by coatomer and cargo.", "journal": "Cellular signalling", "date": "2009", "authors": "Luo R, Ha VL, Hayashi R, Randazzo PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "19296914", "url": "https://glygen.org/publication/PubMed/19296914" } ] }, { "title": "The p24 family and selective transport processes at the ER-Golgi interface.", "journal": "Biology of the cell", "date": "2009", "authors": "Strating JR, Martens GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "19566487", "url": "https://glygen.org/publication/PubMed/19566487" } ] }, { "title": "Binding of ARF and beta-COP to Golgi membranes: possible regulation by a trimeric G protein.", "journal": "Science (New York, N.Y.)", "date": "1991", "authors": "Donaldson JG, Kahn RA, Lippincott-Schwartz J, Klausner RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "1957170", "url": "https://glygen.org/publication/PubMed/1957170" } ] }, { "title": "The COPI system: molecular mechanisms and function.", "journal": "FEBS letters", "date": "2009", "authors": "Beck R, Rawet M, Wieland FT, Cassel D", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "19631211", "url": "https://glygen.org/publication/PubMed/19631211" } ] }, { "title": "Organisation of human ER-exit sites: requirements for the localisation of Sec16 to transitional ER.", "journal": "Journal of cell science", "date": "2009", "authors": "Hughes H, Budnik A, Schmidt K, Palmer KJ, Mantell J, Noakes C, Johnson A, Carter DA, Verkade P, Watson P, Stephens DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "19638414", "url": "https://glygen.org/publication/PubMed/19638414" } ] }, { "title": "mTrs130 is a component of a mammalian TRAPPII complex, a Rab1 GEF that binds to COPI-coated vesicles.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Yamasaki A, Menon S, Yu S, Barrowman J, Meerloo T, Oorschot V, Klumperman J, Satoh A, Ferro-Novick S", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "19656848", "url": "https://glygen.org/publication/PubMed/19656848" } ] }, { "title": "A link between ER tethering and COP-I vesicle uncoating.", "journal": "Developmental cell", "date": "2009", "authors": "Zink S, Wenzel D, Wurm CA, Schmitt HD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "19758564", "url": "https://glygen.org/publication/PubMed/19758564" } ] }, { "title": "Arf3 is activated uniquely at the trans-Golgi network by brefeldin A-inhibited guanine nucleotide exchange factors.", "journal": "Molecular biology of the cell", "date": "2010", "authors": "Manolea F, Chun J, Chen DW, Clarke I, Summerfeldt N, Dacks JB, Melancon P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "20357002", "url": "https://glygen.org/publication/PubMed/20357002" } ] }, { "title": "Selective export of human GPI-anchored proteins from the endoplasmic reticulum.", "journal": "Journal of cell science", "date": "2010", "authors": "Bonnon C, Wendeler MW, Paccaud JP, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "20427317", "url": "https://glygen.org/publication/PubMed/20427317" } ] }, { "title": "Role of the lectin VIP36 in post-ER quality control of human alpha1-antitrypsin.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2010", "authors": "Reiterer V, Nyfeler B, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "20477988", "url": "https://glygen.org/publication/PubMed/20477988" } ] }, { "title": "Protein sorting receptors in the early secretory pathway.", "journal": "Annual review of biochemistry", "date": "2010", "authors": "Dancourt J, Barlowe C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "20533886", "url": "https://glygen.org/publication/PubMed/20533886" } ] }, { "title": "A targeted siRNA screen to identify SNAREs required for constitutive secretion in mammalian cells.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2010", "authors": "Gordon DE, Bond LM, Sahlender DA, Peden AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "20545907", "url": "https://glygen.org/publication/PubMed/20545907" } ] }, { "title": "Models for the functions of Arf GAPs.", "journal": "Seminars in cell & developmental biology", "date": "2011", "authors": "East MP, Kahn RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "20637885", "url": "https://glygen.org/publication/PubMed/20637885" } ] }, { "title": "p125A exists as part of the mammalian Sec13/Sec31 COPII subcomplex to facilitate ER-Golgi transport.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Ong YS, Tang BL, Loo LS, Hong W", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "20679433", "url": "https://glygen.org/publication/PubMed/20679433" } ] }, { "title": "Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Shi Y, Suh YH, Milstein AD, Isozaki K, Schmid SM, Roche KW, Nicoll RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "20805473", "url": "https://glygen.org/publication/PubMed/20805473" } ] }, { "title": "TRAPP complexes in membrane traffic: convergence through a common Rab.", "journal": "Nature reviews. Molecular cell biology", "date": "2010", "authors": "Barrowman J, Bhandari D, Reinisch K, Ferro-Novick S", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "20966969", "url": "https://glygen.org/publication/PubMed/20966969" } ] }, { "title": "Proteinase-activated receptors, nucleotide P2Y receptors, and mu-opioid receptor-1B are under the control of the type I transmembrane proteins p23 and p24A in post-Golgi trafficking.", "journal": "Journal of neurochemistry", "date": "2011", "authors": "Luo W, Wang Y, Reiser G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "21219331", "url": "https://glygen.org/publication/PubMed/21219331" } ] }, { "title": "TFG-1 function in protein secretion and oncogenesis.", "journal": "Nature cell biology", "date": "2011", "authors": "Witte K, Schuh AL, Hegermann J, Sarkeshik A, Mayers JR, Schwarze K, Yates JR 3rd, Eimer S, Audhya A", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "21478858", "url": "https://glygen.org/publication/PubMed/21478858" } ] }, { "title": "cTAGE5 mediates collagen secretion through interaction with TANGO1 at endoplasmic reticulum exit sites.", "journal": "Molecular biology of the cell", "date": "2011", "authors": "Saito K, Yamashiro K, Ichikawa Y, Erlmann P, Kontani K, Malhotra V, Katada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "21525241", "url": "https://glygen.org/publication/PubMed/21525241" } ] }, { "title": "Sequential interactions with Sec23 control the direction of vesicle traffic.", "journal": "Nature", "date": "2011", "authors": "Lord C, Bhandari D, Menon S, Ghassemian M, Nycz D, Hay J, Ghosh P, Ferro-Novick S", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "21532587", "url": "https://glygen.org/publication/PubMed/21532587" } ] }, { "title": "Requirements for the catalytic cycle of the N-ethylmaleimide-Sensitive Factor (NSF).", "journal": "Biochimica et biophysica acta", "date": "2012", "authors": "Zhao C, Smith EC, Whiteheart SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "21689688", "url": "https://glygen.org/publication/PubMed/21689688" } ] }, { "title": "Unique structure of iC3b resolved at a resolution of 24 A by 3D-electron microscopy.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Alcorlo M, Martinez-Barricarte R, Fernandez FJ, Rodriguez-Gallego C, Round A, Vega MC, Harris CL, de Cordoba SR, Llorca O", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "21788512", "url": "https://glygen.org/publication/PubMed/21788512" } ] }, { "title": "COPI budding within the Golgi stack.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2011", "authors": "Popoff V, Adolf F, Brugger B, Wieland F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "21844168", "url": "https://glygen.org/publication/PubMed/21844168" } ] }, { "title": "Protein export at the ER: loading big collagens into COPII carriers.", "journal": "The EMBO journal", "date": "2011", "authors": "Malhotra V, Erlmann P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "21878990", "url": "https://glygen.org/publication/PubMed/21878990" } ] }, { "title": "COPII and COPI traffic at the ER-Golgi interface.", "journal": "Physiology (Bethesda, Md.)", "date": "2011", "authors": "Szul T, Sztul E", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "22013193", "url": "https://glygen.org/publication/PubMed/22013193" } ] }, { "title": "p24 proteins are required for secretion of Wnt ligands.", "journal": "EMBO reports", "date": "2011", "authors": "Buechling T, Chaudhary V, Spirohn K, Weiss M, Boutros M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "22094269", "url": "https://glygen.org/publication/PubMed/22094269" } ] }, { "title": "Sec24p and Sec16p cooperate to regulate the GTP cycle of the COPII coat.", "journal": "The EMBO journal", "date": "2012", "authors": "Kung LF, Pagant S, Futai E, D'Arcangelo JG, Buchanan R, Dittmar JC, Reid RJ, Rothstein R, Hamamoto S, Snapp EL, Schekman R, Miller EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "22157747", "url": "https://glygen.org/publication/PubMed/22157747" } ] }, { "title": "A structure-based mechanism for Arf1-dependent recruitment of coatomer to membranes.", "journal": "Cell", "date": "2012", "authors": "Yu X, Breitman M, Goldberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "22304919", "url": "https://glygen.org/publication/PubMed/22304919" } ] }, { "title": "Insights into structural and regulatory roles of Sec16 in COPII vesicle formation at ER exit sites.", "journal": "Molecular biology of the cell", "date": "2012", "authors": "Yorimitsu T, Sato K", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "22675024", "url": "https://glygen.org/publication/PubMed/22675024" } ] }, { "title": "Thrombin generates previously unidentified C5 products that support the terminal complement activation pathway.", "journal": "Blood", "date": "2012", "authors": "Krisinger MJ, Goebeler V, Lu Z, Meixner SC, Myles T, Pryzdial EL, Conway EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "22802338", "url": "https://glygen.org/publication/PubMed/22802338" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "CD59 deficiency is associated with chronic hemolysis and childhood relapsing immune-mediated polyneuropathy.", "journal": "Blood", "date": "2013", "authors": "Nevo Y, Ben-Zeev B, Tabib A, Straussberg R, Anikster Y, Shorer Z, Fattal-Valevski A, Ta-Shma A, Aharoni S, Rabie M, Zenvirt S, Goldshmidt H, Fellig Y, Shaag A, Mevorach D, Elpeleg O", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "reference": [ { "type": "PubMed", "id": "23149847", "url": "https://glygen.org/publication/PubMed/23149847" } ] }, { "title": "Glycoproteomic analysis of the secretome of human endothelial cells.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M", "evidence": [ { "database": "UniCarbKB", "id": "P13987", "url": "" }, { "database": "GlyConnect", "id": "79", "url": "https://glyconnect.expasy.org/browser/proteins/79" } ], "reference": [ { "type": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "title": "The highly conserved COPII coat complex sorts cargo from the endoplasmic reticulum and targets it to the golgi.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2013", "authors": "Lord C, Ferro-Novick S, Miller EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "23378591", "url": "https://glygen.org/publication/PubMed/23378591" } ] }, { "title": "Inhibition of TFG function causes hereditary axon degeneration by impairing endoplasmic reticulum structure.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Beetz C, Johnson A, Schuh AL, Thakur S, Varga RE, Fothergill T, Hertel N, Bomba-Warczak E, Thiele H, Nurnberg G, Altmuller J, Saxena R, Chapman ER, Dent EW, Nurnberg P, Audhya A", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "23479643", "url": "https://glygen.org/publication/PubMed/23479643" } ] }, { "title": "Dimerization of complement factor H-related proteins modulates complement activation in vivo.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Goicoechea de Jorge E, Caesar JJ, Malik TH, Patel M, Colledge M, Johnson S, Hakobyan S, Morgan BP, Harris CL, Pickering MC, Lea SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "23487775", "url": "https://glygen.org/publication/PubMed/23487775" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "P13987", "url": "" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "Proteome profiling of human neutrophil granule subsets, secretory vesicles, and cell membrane: correlation with transcriptome profiling of neutrophil precursors.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Rorvig S, Ostergaard O, Heegaard NH, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "23650620", "url": "https://glygen.org/publication/PubMed/23650620" } ] }, { "title": "Organization of the ER-Golgi interface for membrane traffic control.", "journal": "Nature reviews. Molecular cell biology", "date": "2013", "authors": "Brandizzi F, Barlowe C", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "23698585", "url": "https://glygen.org/publication/PubMed/23698585" } ] }, { "title": "The Golgi puppet master: COG complex at center stage of membrane trafficking interactions.", "journal": "Histochemistry and cell biology", "date": "2013", "authors": "Willett R, Ungar D, Lupashin V", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "23839779", "url": "https://glygen.org/publication/PubMed/23839779" } ] }, { "title": "Combined deficiency of coagulation factors V and VIII: an update.", "journal": "Seminars in thrombosis and hemostasis", "date": "2013", "authors": "Zheng C, Zhang B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "23852824", "url": "https://glygen.org/publication/PubMed/23852824" } ] }, { "title": "Sit4p/PP6 regulates ER-to-Golgi traffic by controlling the dephosphorylation of COPII coat subunits.", "journal": "Molecular biology of the cell", "date": "2013", "authors": "Bhandari D, Zhang J, Menon S, Lord C, Chen S, Helm JR, Thorsen K, Corbett KD, Hay JC, Ferro-Novick S", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "23864707", "url": "https://glygen.org/publication/PubMed/23864707" } ] }, { "title": "Tethering the assembly of SNARE complexes.", "journal": "Trends in cell biology", "date": "2014", "authors": "Hong W, Lev S", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "24119662", "url": "https://glygen.org/publication/PubMed/24119662" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "Endogenous association of decay-accelerating factor (DAF) with C4b and C3b on cell membranes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1986", "authors": "Kinoshita T, Medof ME, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2420889", "url": "https://glygen.org/publication/PubMed/2420889" } ] }, { "title": "SC5b-7, SC5b-8 and SC5b-9 complexes of complement: ultrastructure and localization of the S-protein (vitronectin) within the macromolecules.", "journal": "European journal of immunology", "date": "1989", "authors": "Preissner KP, Podack ER, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2465906", "url": "https://glygen.org/publication/PubMed/2465906" } ] }, { "title": "Complement S-protein (vitronectin) is associated with cytolytic membrane-bound C5b-9 complexes.", "journal": "Clinical and experimental immunology", "date": "1988", "authors": "Bhakdi S, Kaflein R, Halstensen TS, Hugo F, Preissner KT, Mollnes TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2466593", "url": "https://glygen.org/publication/PubMed/2466593" } ] }, { "title": "20 KDa homologous restriction factor of complement resembles T cell activating protein.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1989", "authors": "Okada H, Nagami Y, Takahashi K, Okada N, Hideshima T, Takizawa H, Kondo J", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "reference": [ { "type": "PubMed", "id": "2475111", "url": "https://glygen.org/publication/PubMed/2475111" } ] }, { "title": "CD59, an LY-6-like protein expressed in human lymphoid cells, regulates the action of the complement membrane attack complex on homologous cells.", "journal": "J. Exp. Med.", "date": "1989", "authors": "Davies A, Simmons D L, Hale G, Harrison R A, Tighe H, Lachmann P J, Waldmann H", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "reference": [ { "type": "PubMed", "id": "2475570", "url": "https://glygen.org/publication/PubMed/2475570" } ] }, { "title": "Complementary DNA sequence and deduced peptide sequence for CD59/MEM-43 antigen, the human homologue of murine lymphocyte antigen Ly-6C.", "journal": "Nucleic Acids Res.", "date": "1989", "authors": "Sawada R, Ohashi K, Okano K, Hattori M, Minato N, Naruto M", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "reference": [ { "type": "PubMed", "id": "2476718", "url": "https://glygen.org/publication/PubMed/2476718" } ] }, { "title": "TMEM115 is an integral membrane protein of the Golgi complex involved in retrograde transport.", "journal": "Journal of cell science", "date": "2014", "authors": "Ong YS, Tran TH, Gounko NV, Hong W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "24806965", "url": "https://glygen.org/publication/PubMed/24806965" } ] }, { "title": "Functional properties of membrane cofactor protein of complement.", "journal": "The Biochemical journal", "date": "1989", "authors": "Seya T, Atkinson JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2481448", "url": "https://glygen.org/publication/PubMed/2481448" } ] }, { "title": "In sickness and in health: the role of TRAPP and associated proteins in disease.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2014", "authors": "Brunet S, Sacher M", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "24917561", "url": "https://glygen.org/publication/PubMed/24917561" } ] }, { "title": "Concentration of Sec12 at ER exit sites via interaction with cTAGE5 is required for collagen export.", "journal": "The Journal of cell biology", "date": "2014", "authors": "Saito K, Yamashiro K, Shimazu N, Tanabe T, Kontani K, Katada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "25202031", "url": "https://glygen.org/publication/PubMed/25202031" } ] }, { "title": "p115-SNARE interactions: a dynamic cycle of p115 binding monomeric SNARE motifs and releasing assembled bundles.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2015", "authors": "Wang T, Grabski R, Sztul E, Hay JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "25406594", "url": "https://glygen.org/publication/PubMed/25406594" } ] }, { "title": "Diverse roles for the p24 family of proteins in eukaryotic cells.", "journal": "Biomolecular concepts", "date": "2012", "authors": "Schuiki I, Volchuk A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "25436559", "url": "https://glygen.org/publication/PubMed/25436559" } ] }, { "title": "Three alphaSNAP and 10 ATP molecules are used in SNARE complex disassembly by N-ethylmaleimide-sensitive factor (NSF).", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Shah N, Colbert KN, Enos MD, Herschlag D, Weis WI", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "25492864", "url": "https://glygen.org/publication/PubMed/25492864" } ] }, { "title": "TFG clusters COPII-coated transport carriers and promotes early secretory pathway organization.", "journal": "The EMBO journal", "date": "2015", "authors": "Johnson A, Bhattacharya N, Hanna M, Pennington JG, Schuh AL, Wang L, Otegui MS, Stagg SM, Audhya A", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "25586378", "url": "https://glygen.org/publication/PubMed/25586378" } ] }, { "title": "SEC16 in COPII coat dynamics at ER exit sites.", "journal": "Biochemical Society transactions", "date": "2015", "authors": "Sprangers J, Rabouille C", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "25619252", "url": "https://glygen.org/publication/PubMed/25619252" } ] }, { "title": "Procollagen export from the endoplasmic reticulum.", "journal": "Biochemical Society transactions", "date": "2015", "authors": "Malhotra V, Erlmann P, Nogueira C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "25619253", "url": "https://glygen.org/publication/PubMed/25619253" } ] }, { "title": "Probing the O-glycoproteome of gastric cancer cell lines for biomarker discovery.", "journal": "Molecular & cellular proteomics : MCP", "date": "2015", "authors": "Campos D, Freitas D, Gomes J, Magalhaes A, Steentoft C, Gomes C, Vester-Christensen MB, Ferreira JA, Afonso LP, Santos LL, Pinto de Sousa J, Mandel U, Clausen H, Vakhrushev SY, Reis CA", "evidence": [ { "database": "UniCarbKB", "id": "P13987", "url": "" } ], "reference": [ { "type": "PubMed", "id": "25813380", "url": "https://glygen.org/publication/PubMed/25813380" } ] }, { "title": "Molecular cloning and characterization of MACIF, an inhibitor of membrane channel formation of complement.", "journal": "J. Biochem.", "date": "1989", "authors": "Sugita Y, Tobe T, Oda E, Tomita M, Yasukawa K, Yamaji N, Takemoto T, Furuichi K, Takayama M, Yano S", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "reference": [ { "type": "PubMed", "id": "2606909", "url": "https://glygen.org/publication/PubMed/2606909" } ] }, { "title": "N-Glycoproteomics of Human Seminal Plasma Glycoproteins.", "journal": "Journal of proteome research", "date": "2016", "authors": "Saraswat M, Joenvaara S, Tomar AK, Singh S, Yadav S, Renkonen R", "evidence": [ { "database": "UniCarbKB", "id": "P13987", "url": "" } ], "reference": [ { "type": "PubMed", "id": "26791533", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.", "journal": "Analytical chemistry", "date": "2017", "authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P13987", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P13987" } ], "reference": [ { "type": "PubMed", "id": "28510447", "url": "https://glygen.org/publication/PubMed/28510447" } ] }, { "title": "Regulation of the amplification C3 convertase of human complement by an inhibitory protein isolated from human erythrocyte membrane.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1979", "authors": "Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "293688", "url": "https://glygen.org/publication/PubMed/293688" } ] }, { "title": "Modulation of the classical pathway C3 convertase by plasma proteins C4 binding protein and C3b inactivator.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1979", "authors": "Gigli I, Fujita T, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "293746", "url": "https://glygen.org/publication/PubMed/293746" } ] }, { "title": "Human complement factor I: analysis of cDNA-derived primary structure and assignment of its gene to chromosome 4.", "journal": "The Journal of biological chemistry", "date": "1987", "authors": "Goldberger G, Bruns GA, Rits M, Edge MD, Kwiatkowski DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2956252", "url": "https://glygen.org/publication/PubMed/2956252" } ] }, { "title": "Identification of the C3b receptor-binding domain in third component of complement.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Becherer JD, Lambris JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2971659", "url": "https://glygen.org/publication/PubMed/2971659" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "GlyConnect", "id": "79", "url": "https://glyconnect.expasy.org/browser/proteins/79" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Human complement C3b inactivator: isolation, characterization, and demonstration of an absolute requirement for the serum protein beta1H for cleavage of C3b and C4b in solution.", "journal": "The Journal of experimental medicine", "date": "1977", "authors": "Pangburn MK, Schreiber RD, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "301546", "url": "https://glygen.org/publication/PubMed/301546" } ] }, { "title": "Distinct urinary glycoprotein signatures in prostate cancer patients.", "journal": "Oncotarget", "date": "2018", "authors": "Kawahara R, Ortega F, Rosa-Fernandes L, Guimaraes V, Quina D, Nahas W, Schwammle V, Srougi M, Leite KRM, Thaysen-Andersen M, Larsen MR, Palmisano G", "evidence": [ { "database": "GlyConnect", "id": "79", "url": "https://glyconnect.expasy.org/browser/proteins/79" } ], "reference": [ { "type": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "title": "Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes.", "journal": "Journal of proteome research", "date": "2020", "authors": "Zhu J, Lin YH, Dingess KA, Mank M, Stahl B, Heck AJR", "evidence": [ { "database": "GlyConnect", "id": "79", "url": "https://glyconnect.expasy.org/browser/proteins/79" } ], "reference": [ { "type": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P13987", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P13987" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P13987", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P13987" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Highly Efficient Enrichment of O-GlcNAc Glycopeptides Based on Chemical Oxidation and Reversible Hydrazide Chemistry.", "journal": "Analytical chemistry", "date": "2021", "authors": "Chen Y, Qin H, Yue X, Zhou J, Liu L, Nie Y, Ye M", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "P13987", "url": "https://oglcnac.org/atlas/detail/P13987" } ], "reference": [ { "type": "PubMed", "id": "34846842", "url": "https://glygen.org/publication/PubMed/34846842" } ] }, { "title": "Alternative splicing encodes functional intracellular CD59 isoforms that mediate insulin secretion and are down-regulated in diabetic islets.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2022", "authors": "Golec E, Ekstrom A, Noga M, Omar-Hmeadi M, Lund PE, Villoutreix BO, Krus U, Wozniak K, Korsgren O, Renstrom E, Barg S, King BC, Blom AM", "evidence": [ { "database": "RefSeq", "id": "NP_000602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000602" } ], "reference": [ { "type": "PubMed", "id": "35666870", "url": "https://glygen.org/publication/PubMed/35666870" } ] }, { "title": "The utility of first trimester plasma glycated CD59 (pGCD59) in predicting gestational diabetes mellitus: A prospective study of non-diabetic pregnant women in Ireland.", "journal": "Diabetes research and clinical practice", "date": "2022", "authors": "Bogdanet D, Toth Castillo M, Doheny H, Dervan L, Angel Luque-Fernandez M, Halperin J, O'Shea PM, Dunne FP", "evidence": [ { "database": "RefSeq", "id": "NP_000602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000602" } ], "reference": [ { "type": "PubMed", "id": "35907507", "url": "https://glygen.org/publication/PubMed/35907507" } ] }, { "title": "CD59 Expression in Skeletal Muscles and Its Role in Myasthenia Gravis.", "journal": "Neurology(R) neuroimmunology & neuroinflammation", "date": "2023-01", "authors": "Iwasa Kazuo, Furukawa Yutaka, Yoshikawa Hiroaki, Yamada Masahito, Ono Kenjiro", "evidence": [ { "database": "RefSeq", "id": "NP_000602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000602" } ], "reference": [ { "type": "PubMed", "id": "36396448", "url": "https://glygen.org/publication/PubMed/36396448" } ] }, { "title": "Multiple CD59 Polymorphisms in Chinese Patients with Mycobacterium tuberculosis Infection.", "journal": "Journal of immunology research", "date": "2023", "authors": "Tang J, Zhao Z, Zhou J, Jiao L, Zhou W, Ying B, Yang Y", "evidence": [ { "database": "RefSeq", "id": "NP_000602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000602" } ], "reference": [ { "type": "PubMed", "id": "37050931", "url": "https://glygen.org/publication/PubMed/37050931" } ] }, { "title": "The bioinformatics analysis of CD59 in Helicobacter pylori infected gastric cancer.", "journal": "Cancer biomarkers : section A of Disease markers", "date": "2023", "authors": "Sun Jun, Cao Hui, Wen Tingting, Xu Zi, Zhang Xian, Wang Jianjun, Zhu Hong", "evidence": [ { "database": "RefSeq", "id": "NP_000602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000602" } ], "reference": [ { "type": "PubMed", "id": "37522198", "url": "https://glygen.org/publication/PubMed/37522198" } ] }, { "title": "C3 nephritic factor protects bound C3bBb from cleavage by factor I and human erythrocytes.", "journal": "Molecular immunology", "date": "1985", "authors": "Mold C, Medof ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "3848661", "url": "https://glygen.org/publication/PubMed/3848661" } ] }, { "title": "Anaphylatoxin inactivator of human plasma: its isolation and characterization as a carboxypeptidase.", "journal": "The Journal of clinical investigation", "date": "1970", "authors": "Bokisch VA, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "4098172", "url": "https://glygen.org/publication/PubMed/4098172" } ] }, { "title": "Generation of three different fragments of bound C3 with purified factor I or serum. I. Requirements for factor H vs CR1 cofactor activity.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1982", "authors": "Ross GD, Lambris JD, Cain JA, Newman SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6214588", "url": "https://glygen.org/publication/PubMed/6214588" } ] }, { "title": "Kinetic and thermodynamic analysis of the control of C3b by the complement regulatory proteins factors H and I.", "journal": "Biochemistry", "date": "1983", "authors": "Pangburn MK, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6219696", "url": "https://glygen.org/publication/PubMed/6219696" } ] }, { "title": "Visualization of human C4b-binding protein and its complexes with vitamin K-dependent protein S and complement protein C4b.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1983", "authors": "Dahlback B, Smith CA, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6222381", "url": "https://glygen.org/publication/PubMed/6222381" } ] }, { "title": "Identification of a 145,000 Mr membrane protein as the C3d receptor (CR2) of human B lymphocytes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1984", "authors": "Weis JJ, Tedder TF, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6230668", "url": "https://glygen.org/publication/PubMed/6230668" } ] }, { "title": "Inhibition of complement activation on the surface of cells after incorporation of decay-accelerating factor (DAF) into their membranes.", "journal": "The Journal of experimental medicine", "date": "1984", "authors": "Medof ME, Kinoshita T, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6238120", "url": "https://glygen.org/publication/PubMed/6238120" } ] }, { "title": "Characterization of the interaction of human C4b-binding protein with physiological ligands.", "journal": "The Journal of biological chemistry", "date": "1984", "authors": "Ziccardi RJ, Dahlback B, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6334079", "url": "https://glygen.org/publication/PubMed/6334079" } ] }, { "title": "High molecular weight complex in human plasma between vitamin K-dependent protein S and complement component C4b-binding protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1981", "authors": "Dahlback B, Stenflo J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6454142", "url": "https://glygen.org/publication/PubMed/6454142" } ] }, { "title": "Physiologic inactivation of fluid phase C3b: isolation and structural analysis of C3c, C3d,g (alpha 2D), and C3g.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1984", "authors": "Davis AE 3rd, Harrison RA, Lachmann PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6607952", "url": "https://glygen.org/publication/PubMed/6607952" } ] }, { "title": "Human C4-binding protein. I. Isolation and characterization.", "journal": "The Journal of experimental medicine", "date": "1978", "authors": "Scharfstein J, Ferreira A, Gigli I, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "670886", "url": "https://glygen.org/publication/PubMed/670886" } ] }, { "title": "The human complement system: assembly of the classical pathway C3 convertase.", "journal": "The Biochemical journal", "date": "1980", "authors": "Kerr MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6906228", "url": "https://glygen.org/publication/PubMed/6906228" } ] }, { "title": "Human C4-binding protein. II. Role in proteolysis of C4b by C3b-inactivator.", "journal": "The Journal of experimental medicine", "date": "1978", "authors": "Fujita T, Gigli I, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "702059", "url": "https://glygen.org/publication/PubMed/702059" } ] }, { "title": "Cleavage of C4b by C3b inactivator: production of a nicked form of C4b, C4b', as an intermediate cleavage product of C4b by C3b inactivator.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1980", "authors": "Nagasawa S, Ichihara C, Stroud RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "7391570", "url": "https://glygen.org/publication/PubMed/7391570" } ] }, { "title": "Three-dimensional solution structure of the extracellular region of the complement regulatory protein CD59, a new cell-surface protein domain related to snake venom neurotoxins.", "journal": "Biochemistry", "date": "1994", "authors": "Kieffer B, Driscoll P C, Campbell I D, Willis A C, van der Merwe P A, Davis S J", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "reference": [ { "type": "PubMed", "id": "7512825", "url": "https://glygen.org/publication/PubMed/7512825" } ] }, { "title": "Structural study on the glycosyl-phosphatidylinositol anchor and the asparagine-linked sugar chain of a soluble form of CD59 in human urine.", "journal": "Archives of biochemistry and biophysics", "date": "1994", "authors": "Nakano Y, Noda K, Endo T, Kobata A, Tomita M", "evidence": [ { "database": "UniCarbKB", "id": "P13987", "url": "" }, { "database": "GlyConnect", "id": "79", "url": "https://glyconnect.expasy.org/browser/proteins/79" } ], "reference": [ { "type": "PubMed", "id": "7514386", "url": "https://glygen.org/publication/PubMed/7514386" } ] }, { "title": "Structure of a soluble, glycosylated form of the human complement regulatory protein CD59.", "journal": "Structure", "date": "1994", "authors": "Fletcher C M, Harrison R A, Lachmann P J, Neuhaus D", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "reference": [ { "type": "PubMed", "id": "7520819", "url": "https://glygen.org/publication/PubMed/7520819" } ] }, { "title": "Complement inhibition by human vitronectin involves non-heparin binding domains.", "journal": "Clinical and experimental immunology", "date": "1995", "authors": "Sheehan M, Morris CA, Pussell BA, Charlesworth JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "7542572", "url": "https://glygen.org/publication/PubMed/7542572" } ] }, { "title": "Interaction of C1-inhibitor with the C1r and C1s subcomponents in human C1.", "journal": "Biochimica et biophysica acta", "date": "1979", "authors": "Arlaud GJ, Reboul A, Sim RB, Colomb MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "760802", "url": "https://glygen.org/publication/PubMed/760802" } ] }, { "title": "Interaction of 125I-labelled complement subcomponents C-1r and C-1s with protease inhibitors in plasma.", "journal": "FEBS letters", "date": "1979", "authors": "Sim RB, Reboul A, Arlaud GJ, Villiers CL, Colomb MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "761607", "url": "https://glygen.org/publication/PubMed/761607" } ] }, { "title": "Functional dissection of the CD21/CD19/TAPA-1/Leu-13 complex of B lymphocytes.", "journal": "The Journal of experimental medicine", "date": "1993", "authors": "Matsumoto AK, Martin DR, Carter RH, Klickstein LB, Ahearn JM, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "7690834", "url": "https://glygen.org/publication/PubMed/7690834" } ] }, { "title": "Giantin, a novel conserved Golgi membrane protein containing a cytoplasmic domain of at least 350 kDa.", "journal": "Molecular biology of the cell", "date": "1993", "authors": "Linstedt AD, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "7691276", "url": "https://glygen.org/publication/PubMed/7691276" } ] }, { "title": "Interactions of soluble CD59 with the terminal complement complexes. CD59 and C9 compete for a nascent epitope on C8.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1993", "authors": "Lehto T, Meri S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "7691959", "url": "https://glygen.org/publication/PubMed/7691959" } ] }, { "title": "Coatomer is essential for retrieval of dilysine-tagged proteins to the endoplasmic reticulum.", "journal": "Cell", "date": "1994", "authors": "Letourneur F, Gaynor EC, Hennecke S, Demolliere C, Duden R, Emr SD, Riezman H, Cosson P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "8001155", "url": "https://glygen.org/publication/PubMed/8001155" } ] }, { "title": "Coatomer interaction with di-lysine endoplasmic reticulum retention motifs.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Cosson P, Letourneur F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "8128252", "url": "https://glygen.org/publication/PubMed/8128252" } ] }, { "title": "En bloc incorporation of coatomer subunits during the assembly of COP-coated vesicles.", "journal": "The Journal of cell biology", "date": "1994", "authors": "Hara-Kuge S, Kuge O, Orci L, Amherdt M, Ravazzola M, Wieland FT, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "8132710", "url": "https://glygen.org/publication/PubMed/8132710" } ] }, { "title": "A protein assembly-disassembly pathway in vitro that may correspond to sequential steps of synaptic vesicle docking, activation, and fusion.", "journal": "Cell", "date": "1993", "authors": "Sollner T, Bennett MK, Whiteheart SW, Scheller RH, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "8221884", "url": "https://glygen.org/publication/PubMed/8221884" } ] }, { "title": "Hydrolysis of bound GTP by ARF protein triggers uncoating of Golgi-derived COP-coated vesicles.", "journal": "The Journal of cell biology", "date": "1993", "authors": "Tanigawa G, Orci L, Amherdt M, Ravazzola M, Helms JB, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "8253837", "url": "https://glygen.org/publication/PubMed/8253837" } ] }, { "title": "Determination of carboxyl-terminal residue and disulfide bonds of MACIF (CD59), a glycosyl-phosphatidylinositol-anchored membrane protein.", "journal": "J. Biochem.", "date": "1993", "authors": "Sugita Y, Nakano Y, Oda E, Noda K, Tobe T, Miura N H, Tomita M", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "reference": [ { "type": "PubMed", "id": "8276756", "url": "https://glygen.org/publication/PubMed/8276756" } ] }, { "title": "Clusterin, the human apolipoprotein and complement inhibitor, binds to complement C7, C8 beta, and the b domain of C9.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1993", "authors": "Tschopp J, Chonn A, Hertig S, French LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "8345200", "url": "https://glygen.org/publication/PubMed/8345200" } ] }, { "title": "Covalent binding properties of the human complement protein C4 and hydrolysis rate of the internal thioester upon activation.", "journal": "Protein science : a publication of the Protein Society", "date": "1993", "authors": "Sepp A, Dodds AW, Anderson MJ, Campbell RD, Willis AC, Law SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "8495193", "url": "https://glygen.org/publication/PubMed/8495193" } ] }, { "title": "Binding of coatomer to Golgi membranes requires ADP-ribosylation factor.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Palmer DJ, Helms JB, Beckers CJ, Orci L, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "8505331", "url": "https://glygen.org/publication/PubMed/8505331" } ] }, { "title": "Sec18p (NSF)-driven release of Sec17p (alpha-SNAP) can precede docking and fusion of yeast vacuoles.", "journal": "Cell", "date": "1996", "authors": "Mayer A, Wickner W, Haas A", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "8620540", "url": "https://glygen.org/publication/PubMed/8620540" } ] }, { "title": "A v-SNARE implicated in intra-Golgi transport.", "journal": "The Journal of cell biology", "date": "1996", "authors": "Nagahama M, Orci L, Ravazzola M, Amherdt M, Lacomis L, Tempst P, Rothman JE, Sollner TH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "8636227", "url": "https://glygen.org/publication/PubMed/8636227" } ] }, { "title": "Mammalian Sly1 regulates syntaxin 5 function in endoplasmic reticulum to Golgi transport.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Dascher C, Balch WE", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "8663406", "url": "https://glygen.org/publication/PubMed/8663406" } ] }, { "title": "Structural composition and functional characterization of soluble CD59: heterogeneity of the oligosaccharide and glycophosphoinositol (GPI) anchor revealed by laser-desorption mass spectrometric analysis.", "journal": "The Biochemical journal", "date": "1996", "authors": "Meri S, Lehto T, Sutton CW, Tyynela J, Baumann M", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987#ptm_processing" }, { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "reference": [ { "type": "PubMed", "id": "8670172", "url": "https://glygen.org/publication/PubMed/8670172" } ] }, { "title": "Targeting of proteins to granule subsets is determined by timing and not by sorting: The specific granule protein NGAL is localized to azurophil granules when expressed in HL-60 cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Le Cabec V, Cowland JB, Calafat J, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "8692836", "url": "https://glygen.org/publication/PubMed/8692836" } ] }, { "title": "Localization of classical and alternative pathway regulatory activity within the decay-accelerating factor.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1996", "authors": "Brodbeck WG, Liu D, Sperry J, Mold C, Medof ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "8786315", "url": "https://glygen.org/publication/PubMed/8786315" } ] }, { "title": "Centractin (ARP1) associates with spectrin revealing a potential mechanism to link dynactin to intracellular organelles.", "journal": "The Journal of cell biology", "date": "1996", "authors": "Holleran EA, Tokito MK, Karki S, Holzbaur EL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "8991093", "url": "https://glygen.org/publication/PubMed/8991093" } ] }, { "title": "Binding of human and rat CD59 to the terminal complement complexes.", "journal": "Immunology", "date": "1997", "authors": "Lehto T, Morgan BP, Meri S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "9038722", "url": "https://glygen.org/publication/PubMed/9038722" } ] }, { "title": "Mutational analysis of the active site and antibody epitopes of the complement-inhibitory glycoprotein, CD59.", "journal": "The Journal of experimental medicine", "date": "1997", "authors": "Bodian DL, Davis SJ, Morgan BP, Rushmere NK", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "reference": [ { "type": "PubMed", "id": "9053451", "url": "https://glygen.org/publication/PubMed/9053451" } ] }, { "title": "The glycosylation of the complement regulatory protein, human erythrocyte CD59.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Rudd P M, Morgan B P, Wormald M R, Harvey D J, van den Berg C W, Davis S J, Ferguson M A, Dwek R A", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "reference": [ { "type": "PubMed", "id": "9054419", "url": "https://glygen.org/publication/PubMed/9054419" } ] }, { "title": "Protein interactions regulating vesicle transport between the endoplasmic reticulum and Golgi apparatus in mammalian cells.", "journal": "Cell", "date": "1997", "authors": "Hay JC, Chao DS, Kuo CS, Scheller RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "9094723", "url": "https://glygen.org/publication/PubMed/9094723" } ] }, { "title": "Direct and GTP-dependent interaction of ADP ribosylation factor 1 with coatomer subunit beta.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Zhao L, Helms JB, Brugger B, Harter C, Martoglio B, Graf R, Brunner J, Wieland FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "9114004", "url": "https://glygen.org/publication/PubMed/9114004" } ] }, { "title": "The vesicle docking protein p115 binds GM130, a cis-Golgi matrix protein, in a mitotically regulated manner.", "journal": "Cell", "date": "1997", "authors": "Nakamura N, Lowe M, Levine TP, Rabouille C, Warren G", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "9150144", "url": "https://glygen.org/publication/PubMed/9150144" } ] }, { "title": "Assembly and disassembly of a ternary complex of synaptobrevin, syntaxin, and SNAP-25 in the membrane of synaptic vesicles.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Otto H, Hanson PI, Jahn R", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "9177194", "url": "https://glygen.org/publication/PubMed/9177194" } ] }, { "title": "Mapping the regions of the complement inhibitor CD59 responsible for its species selective activity.", "journal": "Biochemistry", "date": "1997", "authors": "Yu J, Dong S, Rushmere N K, Morgan B P, Abagyan R, Tomlinson S", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "reference": [ { "type": "PubMed", "id": "9235986", "url": "https://glygen.org/publication/PubMed/9235986" } ] }, { "title": "Bidirectional transport by distinct populations of COPI-coated vesicles.", "journal": "Cell", "date": "1997", "authors": "Orci L, Stamnes M, Ravazzola M, Amherdt M, Perrelet A, Sollner TH, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "9244307", "url": "https://glygen.org/publication/PubMed/9244307" } ] }, { "title": "ER-to-Golgi transport visualized in living cells.", "journal": "Nature", "date": "1997", "authors": "Presley JF, Cole NB, Schroer TA, Hirschberg K, Zaal KJ, Lippincott-Schwartz J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "9288971", "url": "https://glygen.org/publication/PubMed/9288971" } ] }, { "title": "An isoform of the Golgi t-SNARE, syntaxin 5, with an endoplasmic reticulum retrieval signal.", "journal": "Molecular biology of the cell", "date": "1997", "authors": "Hui N, Nakamura N, Sonnichsen B, Shima DT, Nilsson T, Warren G", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "9307973", "url": "https://glygen.org/publication/PubMed/9307973" } ] }, { "title": "Visualization of ER-to-Golgi transport in living cells reveals a sequential mode of action for COPII and COPI.", "journal": "Cell", "date": "1997", "authors": "Scales SJ, Pepperkok R, Kreis TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "9323141", "url": "https://glygen.org/publication/PubMed/9323141" } ] }, { "title": "Na,K-ATPase transport from endoplasmic reticulum to Golgi requires the Golgi spectrin-ankyrin G119 skeleton in Madin Darby canine kidney cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Devarajan P, Stabach PR, De Matteis MA, Morrow JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "9380700", "url": "https://glygen.org/publication/PubMed/9380700" } ] }, { "title": "The mammalian protein (rbet1) homologous to yeast Bet1p is primarily associated with the pre-Golgi intermediate compartment and is involved in vesicular transport from the endoplasmic reticulum to the Golgi apparatus.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Zhang T, Wong SH, Tang BL, Xu Y, Peter F, Subramaniam VN, Hong W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "9382863", "url": "https://glygen.org/publication/PubMed/9382863" } ] }, { "title": "The recycling of ERGIC-53 in the early secretory pathway. ERGIC-53 carries a cytosolic endoplasmic reticulum-exit determinant interacting with COPII.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Kappeler F, Klopfenstein DR, Foguet M, Paccaud JP, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "9395526", "url": "https://glygen.org/publication/PubMed/9395526" } ] }, { "title": "The KDEL receptor, ERD2, regulates intracellular traffic by recruiting a GTPase-activating protein for ARF1.", "journal": "The EMBO journal", "date": "1997", "authors": "Aoe T, Cukierman E, Lee A, Cassel D, Peters PJ, Hsu VW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "9405360", "url": "https://glygen.org/publication/PubMed/9405360" } ] }, { "title": "gp25L/emp24/p24 protein family members of the cis-Golgi network bind both COP I and II coatomer.", "journal": "The Journal of cell biology", "date": "1998", "authors": "Dominguez M, Dejgaard K, Fullekrug J, Dahan S, Fazel A, Paccaud JP, Thomas DY, Bergeron JJ, Nilsson T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "9472029", "url": "https://glygen.org/publication/PubMed/9472029" } ] }, { "title": "A role for giantin in docking COPI vesicles to Golgi membranes.", "journal": "The Journal of cell biology", "date": "1998", "authors": "Sonnichsen B, Lowe M, Levine T, Jamsa E, Dirac-Svejstrup B, Warren G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "9490716", "url": "https://glygen.org/publication/PubMed/9490716" } ] }, { "title": "Localization, dynamics, and protein interactions reveal distinct roles for ER and Golgi SNAREs.", "journal": "The Journal of cell biology", "date": "1998", "authors": "Hay JC, Klumperman J, Oorschot V, Steegmaier M, Kuo CS, Scheller RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "9647643", "url": "https://glygen.org/publication/PubMed/9647643" } ] }, { "title": "ADP ribosylation factor regulates spectrin binding to the Golgi complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Godi A, Santone I, Pertile P, Devarajan P, Stabach PR, Morrow JS, Di Tullio G, Polishchuk R, Petrucci TC, Luini A, De Matteis MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "9671725", "url": "https://glygen.org/publication/PubMed/9671725" } ] }, { "title": "A single binding site for dilysine retrieval motifs and p23 within the gamma subunit of coatomer.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Harter C, Wieland FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "9751720", "url": "https://glygen.org/publication/PubMed/9751720" } ] }, { "title": "Alternative pathway of complement: recruitment of precursor properdin by the labile C3/C5 convertase and the potentiation of the pathway.", "journal": "The Journal of experimental medicine", "date": "1976", "authors": "Medicus RG, Gotze O, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "978134", "url": "https://glygen.org/publication/PubMed/978134" } ] }, { "title": "Receptor-induced polymerization of coatomer.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Reinhard C, Harter C, Bremser M, Brugger B, Sohn K, Helms JB, Wieland F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "9990005", "url": "https://glygen.org/publication/PubMed/9990005" } ] } ], "pathway": [ { "id": "hsa:966", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:966", "resource": "KEGG Pathway" }, { "id": "R-HSA-204005", "name": "COPII-mediated vesicle transport", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005", "resource": "Reactome", "description": "COPII-mediated vesicle transport" }, { "id": "R-HSA-5694530", "name": "Cargo concentration in the ER", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530", "resource": "Reactome", "description": "Cargo concentration in the ER" }, { "id": "R-HSA-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-HSA-6807878", "name": "COPI-mediated anterograde transport", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878", "resource": "Reactome", "description": "COPI-mediated anterograde transport" }, { "id": "R-HSA-977606", "name": "Regulation of Complement cascade", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606", "resource": "Reactome", "description": "Regulation of Complement cascade" } ], "orthologs": [ { "uniprot_canonical_ac": "O55186-1", "protein_name": "CD59A glycoprotein", "gene_name": "Cd59a", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRAQRGLILLLLLLAVFCSTAVSLTCYHCFQPVVSSCNMNSTCSPDQDSCLYAVAGMQVYQRCWKQSDCHGEIIMDQLEETKLKFRCCQFNLCNKSDGSLGKTPLLGTSVLVAILNLCFLSHL", "length": 123 }, "evidence": [ { "id": "45931010", "url": "http://www.informatics.jax.org/homology/45931010", "database": "MGI" }, { "id": "P13987", "url": "https://omabrowser.org/oma/group/P13987/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "O62680-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MGSKGGFILLWLLSILAVLCHLGHSLQCYNCINPAGSCTTAMNCSHNQDACIFVEAVPPKTYYQCWRFDECNFDFISRNLAEKKLKYNCCRKDLCNKSDATISSGKTALLVILLLVATWHFCL", "length": 123 }, "evidence": [ { "id": "P13987", "url": "https://omabrowser.org/oma/group/P13987/", "database": "OMA" } ], "common_name": "Pig" }, { "uniprot_canonical_ac": "P27274-1", "protein_name": "CD59 glycoprotein", "gene_name": "Cd59", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MRARRGFILLLLLAVLCSTGVSLRCYNCLDPVSSCKTNSTCSPNLDACLVAVSGKQVYQQCWRFSDCNAKFILSRLEIANVQYRCCQADLCNKSFEDKPNNGAISLLGKTALLVTSVLAAILKPCF", "length": 126 }, "evidence": [ { "id": "45932382", "url": "http://www.informatics.jax.org/homology/45932382", "database": "MGI" }, { "id": "45931010", "url": "http://www.informatics.jax.org/homology/45931010", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P58019-1", "protein_name": "CD59B glycoprotein", "gene_name": "Cd59b", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRAQRGLILLLLLLAVFCSTAVSLKCYNCLDPVSSCKINTTCSPNLDSCLYAVAGRQVYQQCWKLSDCNSNYIMSRLDVAGIQSKCCQWDLCNKNLDGLEEPNNAETSSLRKTALLGTSVLVAILKFCF", "length": 129 }, "evidence": [ { "id": "45932382", "url": "http://www.informatics.jax.org/homology/45932382", "database": "MGI" }, { "id": "P13987", "url": "https://omabrowser.org/oma/group/P13987/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 16, "go_terms": [ { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "pmid": "" }, { "name": "focal adhesion", "id": "GO:0005925", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005925", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "pmid": "" }, { "name": "specific granule membrane", "id": "GO:0035579", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035579", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "pmid": "" }, { "name": "tertiary granule membrane", "id": "GO:0070821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070821", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "pmid": "" }, { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "pmid": "" }, { "name": "ER to Golgi transport vesicle membrane", "id": "GO:0012507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0012507", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "pmid": "" }, { "name": "transport vesicle", "id": "GO:0030133", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030133", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "pmid": "" }, { "name": "vesicle", "id": "GO:0031982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031982", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "pmid": "" }, { "name": "endoplasmic reticulum-Golgi intermediate compartment membrane", "id": "GO:0033116", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033116", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "pmid": "" }, { "name": "side of membrane", "id": "GO:0098552", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098552", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "cell surface receptor signaling pathway", "id": "GO:0007166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007166", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "pmid": "" }, { "name": "blood coagulation", "id": "GO:0007596", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007596", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "pmid": "" }, { "name": "regulation of complement activation", "id": "GO:0030449", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030449", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "pmid": "" }, { "name": "negative regulation of activation of membrane attack complex", "id": "GO:0001971", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001971", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "pmid": "" }, { "name": "regulation of complement-dependent cytotoxicity", "id": "GO:1903659", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903659", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "complement binding", "id": "GO:0001848", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001848", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "CD59 glycoprotein N-glycosylated 1 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G00176HZ. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G00176HZ. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055365", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055365" } ] }, { "name": "CD59 glycoprotein N-glycosylated 2 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G07483YN. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G07483YN. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055366", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055366" } ] }, { "name": "CD59 glycoprotein N-glycosylated 3 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G08520NM. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G08520NM. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055367", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055367" } ] }, { "name": "CD59 glycoprotein N-glycosylated 4 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G14882EB. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G14882EB. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055368", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055368" } ] }, { "name": "CD59 glycoprotein N-glycosylated 5 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G16828VN. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G16828VN. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055369", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055369" } ] }, { "name": "CD59 glycoprotein N-glycosylated 6 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G22768VO. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G22768VO. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055370", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055370" } ] }, { "name": "CD59 glycoprotein N-glycosylated 7 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G27919IH. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G27919IH. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055371", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055371" } ] }, { "name": "CD59 glycoprotein N-glycosylated 8 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G36134VO. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G36134VO. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055372", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055372" } ] }, { "name": "CD59 glycoprotein N-glycosylated 9 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G36191CD. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G36191CD. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055373", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055373" } ] }, { "name": "CD59 glycoprotein N-glycosylated 10 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G39213VZ. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G39213VZ. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055374", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055374" } ] }, { "name": "CD59 glycoprotein N-glycosylated 11 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G40124HY. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G40124HY. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055375", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055375" } ] }, { "name": "CD59 glycoprotein N-glycosylated 12 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G41405QQ. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G41405QQ. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055376", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055376" } ] }, { "name": "CD59 glycoprotein N-glycosylated 13 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G44413JJ. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G44413JJ. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055377", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055377" } ] }, { "name": "CD59 glycoprotein N-glycosylated 14 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G55220VL. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G55220VL. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055378", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055378" } ] }, { "name": "CD59 glycoprotein N-glycosylated 15 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G58667NI. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G58667NI. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055379", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055379" } ] }, { "name": "CD59 glycoprotein N-glycosylated 16 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G61207RZ. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G61207RZ. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055380", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055380" } ] }, { "name": "CD59 glycoprotein N-glycosylated 17 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G61505ZR. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G61505ZR. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055381", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055381" } ] }, { "name": "CD59 glycoprotein N-glycosylated 18 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G63640QH. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G63640QH. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055382", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055382" } ] }, { "name": "CD59 glycoprotein N-glycosylated 19 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G63889NK. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G63889NK. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055383", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055383" } ] }, { "name": "CD59 glycoprotein N-glycosylated 20 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G71919QK. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G71919QK. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055384", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055384" } ] }, { "name": "CD59 glycoprotein N-glycosylated 21 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G77149EE. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G77149EE. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055385", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055385" } ] }, { "name": "CD59 glycoprotein N-glycosylated 22 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G78059CC. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G78059CC. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055386", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055386" } ] }, { "name": "CD59 glycoprotein N-glycosylated 23 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G80858MF. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G80858MF. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055387", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055387" } ] }, { "name": "CD59 glycoprotein N-glycosylated 24 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G80966KZ. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G80966KZ. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055388", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055388" } ] }, { "name": "CD59 glycoprotein N-glycosylated 25 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G82348BZ. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G82348BZ. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055389", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055389" } ] }, { "name": "CD59 glycoprotein N-glycosylated 26 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G85737WG. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G85737WG. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055390", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055390" } ] }, { "name": "CD59 glycoprotein N-glycosylated 27 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan composition is represented by GlyTouCan:G86182NS. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G86182NS. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000055391", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055391" } ] }, { "name": "CD59 glycoprotein N-glycosylated 28 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G86357DX. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G86357DX. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055392", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055392" } ] }, { "name": "CD59 glycoprotein N-glycosylated 29 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G87618BG. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G87618BG. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055393", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055393" } ] }, { "name": "CD59 glycoprotein N-glycosylated 30 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000055394", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055394" } ] }, { "name": "CD59 glycoprotein N-glycosylated 31 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G90717TP. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G90717TP. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055395", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055395" } ] }, { "name": "CD59 glycoprotein N-glycosylated 32 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G93141AZ. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G93141AZ. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055396", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055396" } ] }, { "name": "CD59 glycoprotein N-glycosylated 33 (human)", "definition": "A CD59 glycoprotein (human) that has been N-glycosylated at the residue equivalent to Asn-43 of the amino acid sequence represented by UniProtKB:P13987-1, in which the glycan structure is represented by GlyTouCan:G93993PD. Example: UniProtKB:P13987-1, Asn-43, MOD:00160~GNO:G93993PD. [PRO:DNx, PMID:10207177, PMID:7514386]", "evidence": [ { "id": "PR:000055397", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055397" } ] } ], "site_annotation": [ { "start_pos": 43, "end_pos": 45, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "N- and O-glycosylated. The N-glycosylation mainly consists of a family of biantennary complex-type structures with and without lactosamine extensions and outer arm fucose residues. Also significant amounts of triantennary complexes (22%). Variable sialylation also present in the Asn-43 oligosaccharide. The predominant O-glycans are mono-sialylated forms of the disaccharide, Gal-beta-1,3GalNAc, and their sites of attachment are probably on Thr-76 and Thr-77. The GPI-anchor of soluble urinary CD59 has no inositol-associated phospholipid, but is composed of seven different GPI-anchor variants of one or more monosaccharide units. Major variants contain sialic acid, mannose and glucosamine. Sialic acid linked to an N-acetylhexosamine-galactose arm is present in two variants.", "evidence": [ { "database": "UniProtKB", "id": "P13987", "url": "https://www.uniprot.org/uniprot/P13987" }, { "database": "PubMed", "id": "18780401", "url": "https://glygen.org/publication/PubMed/18780401" }, { "database": "PubMed", "id": "8670172", "url": "https://glygen.org/publication/PubMed/8670172" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 43 ], "o_linked_sites": [ 40, 67, 76, 77, 105, 106 ], "snv_sites": [ 34, 40, 43, 74 ], "glycation_sites": [ 66 ], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 43, "end_pos": 45 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 163 }, { "field": "total_sites", "count": 7 }, { "field": "n_linked_glycans", "count": 139 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 9 }, { "field": "o_linked_glycan_sites", "count": 8 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 160 }, { "field": "total_sites", "count": 7 }, { "field": "n_linked_glycans", "count": 139 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 9 }, { "field": "o_linked_glycan_sites", "count": 6 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 247 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }