{ "uniprot_canonical_ac": "P13833-1", "uniprot_ac": "P13833", "uniprot_id": "MLR_DICDI", "mass": { "chemical_mass": 18323.0, "monoisotopic_mass": 18323.0 }, "refseq": { "ac": "XP_643313", "name": "Regulatory myosin light chain", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_643313" }, "gene_names": [ { "name": "mlcR", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P13833", "id": "P13833" }, { "name": "DDB_G0276077", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P13833", "id": "P13833" }, { "name": "mlcA", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P13833", "id": "P13833" }, { "name": "mlcR", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_643313", "id": "XP_643313" } ], "protein_names": [ { "name": "Myosin regulatory light chain", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P13833" }, { "name": "RMLC", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13833" }, { "name": "Regulatory myosin light chain", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_643313", "id": "XP_643313" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "P13833", "url": "https://www.uniprot.org/uniprot/P13833" } ], "common_name": "Cellular slime molds" } ], "gene": [ { "name": "mlcR", "url": "https://www.uniprot.org/uniprot/P13833", "locus": {} } ], "crossref": [ { "id": "cd00051", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00051", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "DDB_G0276077", "url": "http://dictybase.org/gene/DDB_G0276077", "database": "dictyBase", "categories": [ "Organism-specific" ] }, { "id": "8620359", "url": "https://www.ncbi.nlm.nih.gov/gene/8620359", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR002048", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002048", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011992", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011992", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0276077", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0276077", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "MKEMLMT", "url": "https://omabrowser.org/oma/group/MKEMLMT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR23049", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23049", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23049:SF34", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23049:SF34", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13499", "url": "http://pfam.xfam.org/family/PF13499", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P13833", "url": "http://purl.obolibrary.org/obo/PR_P13833", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-DDI-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-5627123", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_643313", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_643313", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P13833", "url": "https://www.uniprot.org/uniprot/P13833", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13833-1", "url": "https://www.uniprot.org/uniprot/P13833-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MASTKRRLNREESSVVLGEEQVAELKEAFELFDKDRTGFIKKDALKTTCKQFGVFVMEDQLDAMFAEADTTKSGAIGFPEFMSMMSRRMKQTSNEQILMNAFKTFDPEGNGYILTKDLSKALTTLGDKLTEAELQELLSISENEQKQVKYDLFVNTLFSKK", "length": 161, "header": "sp|P13833-1|MLR_DICDI Isoform 1 of Myosin regulatory light chain OS=Dictyostelium discoideum OX=44689 GN=mlcR PE=2 SV=1 CANONICAL=P13833-1" }, "isoforms": [ { "isoform_ac": "P13833-1", "url": "", "sequence": { "sequence": "MASTKRRLNREESSVVLGEEQVAELKEAFELFDKDRTGFIKKDALKTTCKQFGVFVMEDQLDAMFAEADTTKSGAIGFPEFMSMMSRRMKQTSNEQILMNAFKTFDPEGNGYILTKDLSKALTTLGDKLTEAELQELLSISENEQKQVKYDLFVNTLFSKK", "length": 161, "header": "sp|P13833-1|MLR_DICDI Isoform 1 of Myosin regulatory light chain OS=Dictyostelium discoideum OX=44689 GN=mlcR PE=2 SV=1 CANONICAL=P13833-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 13, "end_pos": 13, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13833", "url": "https://www.uniprot.org/uniprot/P13833" } ], "site_lbl": "Ser13" }, { "start_pos": 14, "end_pos": 14, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13833", "url": "https://www.uniprot.org/uniprot/P13833" } ], "site_lbl": "Ser14" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Sequence and analysis of chromosome 2 of Dictyostelium discoideum.", "journal": "Nature", "date": "2002", "authors": "Gl\u00f6ckner Gernot, Eichinger Ludwig, Szafranski Karol, Pachebat Justin A, Bankier Alan T, Dear Paul H, Lehmann R\u00fcdiger, Baumgart Cornelia, Parra Gen\u00eds, Abril Josep F, Guig\u00f3 Roderic, Kumpf Kai, Tunggal Budi, Cox Edward, Quail Michael A, Platzer Matthias, Rosenthal Andr\u00e9, Noegel Angelika A,", "evidence": [ { "database": "UniProtKB", "id": "P13833", "url": "https://www.uniprot.org/uniprot/P13833" } ], "reference": [ { "type": "PubMed", "id": "12097910", "url": "https://glygen.org/publication/PubMed/12097910" } ] }, { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Eichinger L, Pachebat J A, Gl\u00f6ckner G, Rajandream M-A, Sucgang R, Berriman M, Song J, Olsen R, Szafranski K, Xu Q, Tunggal B, Kummerfeld S, Madera M, Konfortov B A, Rivero F, Bankier A T, Lehmann R, Hamlin N, Davies R, Gaudet P, Fey P, Pilcher K, Chen G, Saunders D, Sodergren E, Davis P, Kerhornou A, Nie X, Hall N, Anjard C, Hemphill L, Bason N, Farbrother P, Desany B, Just E, Morio T, Rost R, Churcher C, Cooper J, Haydock S, van Driessche N, Cronin A, Goodhead I, Muzny D, Mourier T, Pain A, Lu M, Harper D, Lindsay R, Hauser H, James K, Quiles M, Madan Babu M, Saito T, Buchrieser C, Wardroper A, Felder M, Thangavelu M, Johnson D, Knights A, Loulseged H, Mungall K, Oliver K, Price C, Quail M A, Urushihara H, Hernandez J, Rabbinowitsch E, Steffen D, Sanders M, Ma J, Kohara Y, Sharp S, Simmonds M, Spiegler S, Tivey A, Sugano S, White B, Walker D, Woodward J, Winckler T, Tanaka Y, Shaulsky G, Schleicher M, Weinstock G, Rosenthal A, Cox E C, Chisholm R L, Gibbs R, Loomis W F, Platzer M, Kay R R, Williams J, Dear P H, Noegel A A, Barrell B, Kuspa A", "evidence": [ { "database": "UniProtKB", "id": "P13833", "url": "https://www.uniprot.org/uniprot/P13833" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] }, { "title": "Dictyostelium discoideum myosin: isolation and characterization of cDNAs encoding the regulatory light chain.", "journal": "Mol. Cell. Biol.", "date": "1989", "authors": "Tafuri S R, Rushforth A M, Kuczmarski E R, Chisholm R L", "evidence": [ { "database": "UniProtKB", "id": "P13833", "url": "https://www.uniprot.org/uniprot/P13833" } ], "reference": [ { "type": "PubMed", "id": "2550795", "url": "https://glygen.org/publication/PubMed/2550795" } ] } ], "pathway": [ { "id": "ddi:DDB_G0276077", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0276077", "resource": "KEGG Pathway" }, { "id": "R-DDI-5627123", "name": "RHO GTPases activate PAKs", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-5627123", "resource": "Reactome", "description": "RHO GTPases activate PAKs" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "myosin filament assembly", "id": "GO:0031034", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031034", "evidence": [ { "database": "UniProtKB", "id": "P13833", "url": "https://www.uniprot.org/uniprot/P13833" } ], "pmid": "" }, { "name": "mitotic cytokinesis", "id": "GO:0000281", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000281", "evidence": [ { "database": "UniProtKB", "id": "P13833", "url": "https://www.uniprot.org/uniprot/P13833" } ], "pmid": "" }, { "name": "myosin II filament organization", "id": "GO:0031038", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031038", "evidence": [ { "database": "UniProtKB", "id": "P13833", "url": "https://www.uniprot.org/uniprot/P13833" } ], "pmid": "" }, { "name": "sorocarp development", "id": "GO:0030587", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030587", "evidence": [ { "database": "UniProtKB", "id": "P13833", "url": "https://www.uniprot.org/uniprot/P13833" } ], "pmid": "" }, { "name": "response to differentiation-inducing factor 1", "id": "GO:1903013", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903013", "evidence": [ { "database": "UniProtKB", "id": "P13833", "url": "https://www.uniprot.org/uniprot/P13833" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P13833", "url": "https://www.uniprot.org/uniprot/P13833" } ], "pmid": "" }, { "name": "actomyosin", "id": "GO:0042641", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042641", "evidence": [ { "database": "UniProtKB", "id": "P13833", "url": "https://www.uniprot.org/uniprot/P13833" } ], "pmid": "" }, { "name": "myosin II complex", "id": "GO:0016460", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016460", "evidence": [ { "database": "UniProtKB", "id": "P13833", "url": "https://www.uniprot.org/uniprot/P13833" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "P13833", "url": "https://www.uniprot.org/uniprot/P13833" } ], "pmid": "" }, { "name": "myosin heavy chain binding", "id": "GO:0032036", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032036", "evidence": [ { "database": "UniProtKB", "id": "P13833", "url": "https://www.uniprot.org/uniprot/P13833" } ], "pmid": "" }, { "name": "cytoskeletal motor activator activity", "id": "GO:0140660", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140660", "evidence": [ { "database": "UniProtKB", "id": "P13833", "url": "https://www.uniprot.org/uniprot/P13833" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 13, 14 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }