{ "uniprot_canonical_ac": "P13773-1", "uniprot_ac": "P13773", "uniprot_id": "CAR1_DICDI", "mass": { "chemical_mass": 44312.0, "monoisotopic_mass": 44312.0 }, "refseq": { "ac": "XP_644603", "name": "G-protein-coupled receptor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_644603" }, "gene_names": [ { "name": "carA-1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P13773", "id": "P13773" }, { "name": "carA-2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P13773", "id": "P13773" }, { "name": "DDB_G0273397", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P13773", "id": "P13773" }, { "name": "DDB_G0273533", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P13773", "id": "P13773" }, { "name": "car1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P13773", "id": "P13773" }, { "name": "carA-1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_644603", "id": "XP_644603" } ], "protein_names": [ { "name": "Cyclic AMP receptor 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P13773" }, { "name": "G-protein-coupled receptor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_644603", "id": "XP_644603" }, { "name": "cAMP receptor 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_644603", "id": "XP_644603" }, { "name": "cAMP receptor 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13773" } ], "function": [ { "annotation": "Receptor for cAMP. Coordinates the aggregation of individual cells into a multicellular organism and regulates the expression of a large number of developmentally regulated genes. The activity of this receptor is mediated by G proteins.", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773#function" }, { "database": "PubMed", "id": "9578623", "url": "https://glygen.org/publication/PubMed/9578623" }, { "database": "PubMed", "id": "3047871", "url": "https://glygen.org/publication/PubMed/3047871" }, { "database": "PubMed", "id": "9341180", "url": "https://glygen.org/publication/PubMed/9341180" }, { "database": "PubMed", "id": "7925004", "url": "https://glygen.org/publication/PubMed/7925004" }, { "database": "PubMed", "id": "11319871", "url": "https://glygen.org/publication/PubMed/11319871" }, { "database": "PubMed", "id": "1849108", "url": "https://glygen.org/publication/PubMed/1849108" }, { "database": "PubMed", "id": "11559759", "url": "https://glygen.org/publication/PubMed/11559759" }, { "database": "PubMed", "id": "1692327", "url": "https://glygen.org/publication/PubMed/1692327" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 100, "end_pos": 100, "sequence_org": "L", "sequence_mut": "H", "comment": "In DN3; constitutive phosphorylation and greatly increased affinity for cAMP.", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "15574880", "url": "https://glygen.org/publication/PubMed/15574880" } ] }, { "start_pos": 102, "end_pos": 102, "sequence_org": "I", "sequence_mut": "T", "comment": "In DN2; constitutive phosphorylation and greatly increased affinity for cAMP; when associated with D-225.", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "15574880", "url": "https://glygen.org/publication/PubMed/15574880" } ] }, { "start_pos": 104, "end_pos": 104, "sequence_org": "I", "sequence_mut": "N", "comment": "In DN4; constitutive phosphorylation and greatly increased affinity for cAMP. In DN1; Constitutive phosphorylation and greatly increased affinity for cAMP; when associated with A-136.", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "17630977", "url": "https://glygen.org/publication/PubMed/17630977" }, { "database": "PubMed", "id": "15574880", "url": "https://glygen.org/publication/PubMed/15574880" } ] }, { "start_pos": 104, "end_pos": 104, "sequence_org": "I", "sequence_mut": "X", "comment": "Most substitutions increase affinity for cAMP and the most polar substitutions block development.", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "15574880", "url": "https://glygen.org/publication/PubMed/15574880" }, { "database": "PubMed", "id": "17630977", "url": "https://glygen.org/publication/PubMed/17630977" } ] }, { "start_pos": 136, "end_pos": 136, "sequence_org": "V", "sequence_mut": "A", "comment": "In DN1; constitutive phosphorylation and greatly increased affinity for cAMP; when associated with N-104.", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "15574880", "url": "https://glygen.org/publication/PubMed/15574880" } ] }, { "start_pos": 148, "end_pos": 148, "sequence_org": "N", "sequence_mut": "G", "comment": "Reduces the affinity for cAMP by 100 to 1000-fold when associated with D-154; N-155; Y-156 and D-157.", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "9578623", "url": "https://glygen.org/publication/PubMed/9578623" } ] }, { "start_pos": 154, "end_pos": 154, "sequence_org": "V", "sequence_mut": "D", "comment": "Reduces the affinity for cAMP by 100 to 1000-fold when associated with G-148; N-155; Y-156 and D-157.", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "9578623", "url": "https://glygen.org/publication/PubMed/9578623" } ] }, { "start_pos": 155, "end_pos": 155, "sequence_org": "S", "sequence_mut": "N", "comment": "Reduces the affinity for cAMP by 100 to 1000-fold when associated with G-148; D-154; Y-156 and D-157.", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "9578623", "url": "https://glygen.org/publication/PubMed/9578623" } ] }, { "start_pos": 156, "end_pos": 156, "sequence_org": "F", "sequence_mut": "Y", "comment": "Reduces the affinity for cAMP by 100 to 1000-fold when associated with G-148; D-154; N-155 and D-157.", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "9578623", "url": "https://glygen.org/publication/PubMed/9578623" } ] }, { "start_pos": 157, "end_pos": 157, "sequence_org": "T", "sequence_mut": "D", "comment": "Reduces the affinity for cAMP by 100 to 1000-fold when associated with G-148; D-154; N-155 and Y-156.", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "9578623", "url": "https://glygen.org/publication/PubMed/9578623" } ] }, { "start_pos": 225, "end_pos": 225, "sequence_org": "N", "sequence_mut": "D", "comment": "In DN2; constitutive phosphorylation and greatly increased affinity for cAMP; when associated with T-102.", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "15574880", "url": "https://glygen.org/publication/PubMed/15574880" } ] }, { "start_pos": 288, "end_pos": 392, "sequence_org": "KLEKNKNNNNPSPYSSSRGTSGKTMGGHPTGDDVQCSSDMEQCSLERHPNMVNNQQNLNNNYGLQQNYNDEGSSSSSLSSSDEEKQTVEMQNIQISTSTNGQGNN", "sequence_mut": "", "comment": "No effect on cAMP-dependent gene expression, chemotaxis, aggregation and differentiation.", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "9341180", "url": "https://glygen.org/publication/PubMed/9341180" } ] }, { "start_pos": 299, "end_pos": 299, "sequence_org": "S", "sequence_mut": "A", "comment": "Greatly reduces ligand induced phosphorylation; when associated with G-302; A-303; G-304 and A-308.", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "8120068", "url": "https://glygen.org/publication/PubMed/8120068" }, { "database": "PubMed", "id": "7721769", "url": "https://glygen.org/publication/PubMed/7721769" } ] }, { "start_pos": 302, "end_pos": 302, "sequence_org": "S", "sequence_mut": "G", "comment": "Greatly reduces ligand induced phosphorylation; when associated with A-299; A-303; G-304 and A-308.", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "7721769", "url": "https://glygen.org/publication/PubMed/7721769" }, { "database": "PubMed", "id": "8120068", "url": "https://glygen.org/publication/PubMed/8120068" } ] }, { "start_pos": 303, "end_pos": 303, "sequence_org": "S", "sequence_mut": "A", "comment": "Greatly reduces ligand induced phosphorylation; when associated with A-299; G-302; G-304 and A-308.", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "7721769", "url": "https://glygen.org/publication/PubMed/7721769" }, { "database": "PubMed", "id": "8120068", "url": "https://glygen.org/publication/PubMed/8120068" } ] }, { "start_pos": 304, "end_pos": 304, "sequence_org": "S", "sequence_mut": "G", "comment": "Greatly reduces ligand induced phosphorylation; when associated with A-299; G-302; A-303 and A-308.", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "7721769", "url": "https://glygen.org/publication/PubMed/7721769" }, { "database": "PubMed", "id": "8120068", "url": "https://glygen.org/publication/PubMed/8120068" } ] }, { "start_pos": 308, "end_pos": 308, "sequence_org": "S", "sequence_mut": "A", "comment": "Greatly reduces ligand induced phosphorylation; when associated with A-299; G-302; A-303 and G-304.", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "8120068", "url": "https://glygen.org/publication/PubMed/8120068" } ] }, { "start_pos": 324, "end_pos": 324, "sequence_org": "S", "sequence_mut": "G", "comment": "Slightly reduces ligand induced and basal phosphorylation; when associated with A-325 and A-331.", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "8120068", "url": "https://glygen.org/publication/PubMed/8120068" } ] }, { "start_pos": 325, "end_pos": 325, "sequence_org": "S", "sequence_mut": "A", "comment": "Slightly reduces ligand induced and basal phosphorylation; when associated with G-324 and A-331.", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "8120068", "url": "https://glygen.org/publication/PubMed/8120068" } ] }, { "start_pos": 331, "end_pos": 331, "sequence_org": "S", "sequence_mut": "A", "comment": "Slightly reduces ligand induced and basal phosphorylation; when associated with G-324 and A-325.", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "8120068", "url": "https://glygen.org/publication/PubMed/8120068" } ] }, { "start_pos": 360, "end_pos": 368, "sequence_org": "SSSSSLSSS", "sequence_mut": "", "comment": "Greatly reduces basal phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "8120068", "url": "https://glygen.org/publication/PubMed/8120068" } ] }, { "start_pos": 383, "end_pos": 383, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "8120068", "url": "https://glygen.org/publication/PubMed/8120068" } ] }, { "start_pos": 385, "end_pos": 385, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "8120068", "url": "https://glygen.org/publication/PubMed/8120068" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "common_name": "Cellular slime molds" } ], "gene": [ { "name": "carA-2", "url": "https://www.uniprot.org/uniprot/P13773", "locus": {} } ], "crossref": [ { "id": "cd14940", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd14940", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "DDB_G0273397", "url": "http://dictybase.org/gene/DDB_G0273397", "database": "dictyBase", "categories": [ "Organism-specific" ] }, { "id": "DDB_G0273533", "url": "http://dictybase.org/gene/DDB_G0273533", "database": "dictyBase", "categories": [ "Organism-specific" ] }, { "id": "8618967", "url": "https://www.ncbi.nlm.nih.gov/gene/8618967", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "8619010", "url": "https://www.ncbi.nlm.nih.gov/gene/8619010", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000848", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000848", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017981", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017981", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR022343", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022343", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0273397", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0273397", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "ddi:DDB_G0273533", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0273533", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "IACFCAT", "url": "https://omabrowser.org/oma/group/IACFCAT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR23112", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23112", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23112:SF23", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23112:SF23", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF05462", "url": "http://pfam.xfam.org/family/PF05462", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P13773", "url": "http://purl.obolibrary.org/obo/PR_P13773", "database": "PRO", "categories": [ "Protein" ] }, { "id": "XP_644603", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_644603", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13773-1", "url": "https://www.uniprot.org/uniprot/P13773-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGLLDGNPANETSLVLLLFADFSSMLGCMAVLIGFWRLKLLRNHVTKVIACFCATSFCKDFPSTILTLTNTAVNGGFPCYLYAIVITYGSFACWLWTLCLAISIYMLIVKREPEPERFEKYYYLLCWGLPLISTIVMLAKNTVQFVGNWCWIGVSFTGYRFGLFYGPFLFIWAISAVLVGLTSRYTYVVIHNGVSDNKEKHLTYQFKLINYIIVFLVCWVFAVVNRIVNGLNMFPPALNILHTYLSVSHGFWASVTFIYNNPLMWRYFGAKILTVFTFFGYFTDVQKKLEKNKNNNNPSPYSSSRGTSGKTMGGHPTGDDVQCSSDMEQCSLERHPNMVNNQQNLNNNYGLQQNYNDEGSSSSSLSSSDEEKQTVEMQNIQISTSTNGQGNN", "length": 392, "header": "sp|P13773-1|CAR1_DICDI Isoform 1 of Cyclic AMP receptor 1 OS=Dictyostelium discoideum OX=44689 GN=carA-2 PE=1 SV=1 CANONICAL=P13773-1" }, "isoforms": [ { "isoform_ac": "P13773-1", "url": "", "sequence": { "sequence": "MGLLDGNPANETSLVLLLFADFSSMLGCMAVLIGFWRLKLLRNHVTKVIACFCATSFCKDFPSTILTLTNTAVNGGFPCYLYAIVITYGSFACWLWTLCLAISIYMLIVKREPEPERFEKYYYLLCWGLPLISTIVMLAKNTVQFVGNWCWIGVSFTGYRFGLFYGPFLFIWAISAVLVGLTSRYTYVVIHNGVSDNKEKHLTYQFKLINYIIVFLVCWVFAVVNRIVNGLNMFPPALNILHTYLSVSHGFWASVTFIYNNPLMWRYFGAKILTVFTFFGYFTDVQKKLEKNKNNNNPSPYSSSRGTSGKTMGGHPTGDDVQCSSDMEQCSLERHPNMVNNQQNLNNNYGLQQNYNDEGSSSSSLSSSDEEKQTVEMQNIQISTSTNGQGNN", "length": 392, "header": "sp|P13773-1|CAR1_DICDI Isoform 1 of Cyclic AMP receptor 1 OS=Dictyostelium discoideum OX=44689 GN=carA-2 PE=1 SV=1 CANONICAL=P13773-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 10, "start_aa": "Asn", "end_pos": 10, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn10", "evidence": [ { "id": "P13773", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13773#ptm_processing" } ] } ], "phosphorylation": [ { "start_pos": 299, "end_pos": 299, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "site_lbl": "Ser299" }, { "start_pos": 302, "end_pos": 302, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "7721769", "url": "https://glygen.org/publication/PubMed/7721769" } ], "site_lbl": "Ser302" }, { "start_pos": 303, "end_pos": 303, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "7721769", "url": "https://glygen.org/publication/PubMed/7721769" } ], "site_lbl": "Ser303" }, { "start_pos": 304, "end_pos": 304, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "7721769", "url": "https://glygen.org/publication/PubMed/7721769" } ], "site_lbl": "Ser304" }, { "start_pos": 308, "end_pos": 308, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "site_lbl": "Ser308" }, { "start_pos": 360, "end_pos": 360, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "site_lbl": "Ser360" }, { "start_pos": 361, "end_pos": 361, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "site_lbl": "Ser361" }, { "start_pos": 362, "end_pos": 362, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "site_lbl": "Ser362" }, { "start_pos": 363, "end_pos": 363, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "site_lbl": "Ser363" }, { "start_pos": 364, "end_pos": 364, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "site_lbl": "Ser364" }, { "start_pos": 366, "end_pos": 366, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "site_lbl": "Ser366" }, { "start_pos": 367, "end_pos": 367, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "site_lbl": "Ser367" }, { "start_pos": 368, "end_pos": 368, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "site_lbl": "Ser368" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "The phosphorylated C-terminus of cAR1 plays a role in cell-type-specific gene expression and STATa tyrosine phosphorylation.", "journal": "Developmental biology", "date": "2001-05-01", "authors": "Briscoe C, Moniakis J, Kim J Y, Brown J M, Hereld D, Devreotes P N, Firtel R A", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "reference": [ { "type": "PubMed", "id": "11319871", "url": "https://glygen.org/publication/PubMed/11319871" } ] }, { "title": "Spatial expression patterns of genes involved in cyclic AMP responses in Dictyostelium discoideum development.", "journal": "Dev. Growth Differ.", "date": "2001", "authors": "Tsujioka M, Yokoyama M, Nishio K, Kuwayama H, Morio T, Katoh M, Urushihara H, Saito T, Ochiai H, Tanaka Y, Takeuchi I, Maeda M", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "reference": [ { "type": "PubMed", "id": "11422293", "url": "https://glygen.org/publication/PubMed/11422293" } ] }, { "title": "cAMP receptor affinity controls wave dynamics, geometry and morphogenesis in Dictyostelium.", "journal": "Journal of cell science", "date": "2001-07", "authors": "Dormann D, Kim J Y, Devreotes P N, Weijer C J", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "reference": [ { "type": "PubMed", "id": "11559759", "url": "https://glygen.org/publication/PubMed/11559759" } ] }, { "title": "A transcriptional profile of multicellular development in Dictyostelium discoideum.", "journal": "Development", "date": "2002", "authors": "Van Driessche Nancy, Shaw Chad, Katoh Mariko, Morio Takahiro, Sucgang Richard, Ibarra Miroslava, Kuwayama Hidekazu, Saito Tamao, Urushihara Hideko, Maeda Mineko, Takeuchi Ikuo, Ochiai Hiroshi, Eaton William, Tollett Jeffrey, Halter John, Kuspa Adam, Tanaka Yoshimasa, Shaulsky Gad", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "reference": [ { "type": "PubMed", "id": "11923193", "url": "https://glygen.org/publication/PubMed/11923193" } ] }, { "title": "Sequence and analysis of chromosome 2 of Dictyostelium discoideum.", "journal": "Nature", "date": "2002", "authors": "Gl\u00f6ckner Gernot, Eichinger Ludwig, Szafranski Karol, Pachebat Justin A, Bankier Alan T, Dear Paul H, Lehmann R\u00fcdiger, Baumgart Cornelia, Parra Gen\u00eds, Abril Josep F, Guig\u00f3 Roderic, Kumpf Kai, Tunggal Budi, Cox Edward, Quail Michael A, Platzer Matthias, Rosenthal Andr\u00e9, Noegel Angelika A,", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "reference": [ { "type": "PubMed", "id": "12097910", "url": "https://glygen.org/publication/PubMed/12097910" } ] }, { "title": "Changing patterns of gene expression in Dictyostelium prestalk cell subtypes recognized by in situ hybridization with genes from microarray analyses.", "journal": "Eukaryot. Cell", "date": "2003", "authors": "Maeda Mineko, Sakamoto Haruyo, Iranfar Negin, Fuller Danny, Maruo Toshinari, Ogihara Satoshi, Morio Takahiro, Urushihara Hideko, Tanaka Yoshimasa, Loomis William F", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "reference": [ { "type": "PubMed", "id": "12796308", "url": "https://glygen.org/publication/PubMed/12796308" } ] }, { "title": "Genome-wide expression analyses of gene regulation during early development of Dictyostelium discoideum.", "journal": "Eukaryot. Cell", "date": "2003", "authors": "Iranfar Negin, Fuller Danny, Loomis William F", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "reference": [ { "type": "PubMed", "id": "12912885", "url": "https://glygen.org/publication/PubMed/12912885" } ] }, { "title": "Control of cell type proportioning in Dictyostelium discoideum by differentiation-inducing factor as determined by in situ hybridization.", "journal": "Eukaryot. Cell", "date": "2004", "authors": "Maruo Toshinari, Sakamoto Haruyo, Iranfar Negin, Fuller Danny, Morio Takahiro, Urushihara Hideko, Tanaka Yoshimasa, Maeda Mineko, Loomis William F", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "reference": [ { "type": "PubMed", "id": "15470253", "url": "https://glygen.org/publication/PubMed/15470253" } ] }, { "title": "Constitutively active G protein-coupled receptor mutants block dictyostelium development.", "journal": "Molecular biology of the cell", "date": "2005-02", "authors": "Zhang Minghang, Goswami Mousumi, Hereld Dale", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "reference": [ { "type": "PubMed", "id": "15574880", "url": "https://glygen.org/publication/PubMed/15574880" } ] }, { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Eichinger L, Pachebat J A, Gl\u00f6ckner G, Rajandream M-A, Sucgang R, Berriman M, Song J, Olsen R, Szafranski K, Xu Q, Tunggal B, Kummerfeld S, Madera M, Konfortov B A, Rivero F, Bankier A T, Lehmann R, Hamlin N, Davies R, Gaudet P, Fey P, Pilcher K, Chen G, Saunders D, Sodergren E, Davis P, Kerhornou A, Nie X, Hall N, Anjard C, Hemphill L, Bason N, Farbrother P, Desany B, Just E, Morio T, Rost R, Churcher C, Cooper J, Haydock S, van Driessche N, Cronin A, Goodhead I, Muzny D, Mourier T, Pain A, Lu M, Harper D, Lindsay R, Hauser H, James K, Quiles M, Madan Babu M, Saito T, Buchrieser C, Wardroper A, Felder M, Thangavelu M, Johnson D, Knights A, Loulseged H, Mungall K, Oliver K, Price C, Quail M A, Urushihara H, Hernandez J, Rabbinowitsch E, Steffen D, Sanders M, Ma J, Kohara Y, Sharp S, Simmonds M, Spiegler S, Tivey A, Sugano S, White B, Walker D, Woodward J, Winckler T, Tanaka Y, Shaulsky G, Schleicher M, Weinstock G, Rosenthal A, Cox E C, Chisholm R L, Gibbs R, Loomis W F, Platzer M, Kay R R, Williams J, Dear P H, Noegel A A, Barrell B, Kuspa A", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] }, { "title": "Surface cAMP receptors mediate multiple responses during development in Dictyostelium: evidenced by antisense mutagenesis.", "journal": "The Journal of cell biology", "date": "1990-05", "authors": "Sun T J, Van Haastert P J, Devreotes P N", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "reference": [ { "type": "PubMed", "id": "1692327", "url": "https://glygen.org/publication/PubMed/1692327" } ] }, { "title": "Regulation of G protein-coupled cAMP receptor activation by a hydrophobic residue in transmembrane helix 3.", "journal": "Molecular microbiology", "date": "2007-07", "authors": "Zhang Minghang, Goswami Mousumi, Sawai Satoshi, Cox Edward C, Hereld Dale", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "reference": [ { "type": "PubMed", "id": "17630977", "url": "https://glygen.org/publication/PubMed/17630977" } ] }, { "title": "Gene targeting of the aggregation stage cAMP receptor cAR1 in Dictyostelium.", "journal": "Genes & development", "date": "1991-04", "authors": "Sun T J, Devreotes P N", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "reference": [ { "type": "PubMed", "id": "1849108", "url": "https://glygen.org/publication/PubMed/1849108" } ] }, { "title": "Expression of a cAMP receptor gene of Dictyostelium and evidence for a multigene family.", "journal": "Genes Dev.", "date": "1991", "authors": "Saxe C L, Johnson R L, Devreotes P N, Kimmel A R", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "reference": [ { "type": "PubMed", "id": "1989903", "url": "https://glygen.org/publication/PubMed/1989903" } ] }, { "title": "A chemoattractant receptor controls development in Dictyostelium discoideum.", "journal": "Science (New York, N.Y.)", "date": "1988-09-16", "authors": "Klein P S, Sun T J, Saxe C L, Kimmel A R, Johnson R L, Devreotes P N", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "reference": [ { "type": "PubMed", "id": "3047871", "url": "https://glygen.org/publication/PubMed/3047871" } ] }, { "title": "Agonist-induced loss of ligand binding is correlated with phosphorylation of cAR1, a G protein-coupled chemoattractant receptor from Dictyostelium.", "journal": "The Journal of biological chemistry", "date": "1995-04-14", "authors": "Caterina M J, Devreotes P N, Borleis J, Hereld D", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "reference": [ { "type": "PubMed", "id": "7721769", "url": "https://glygen.org/publication/PubMed/7721769" } ] }, { "title": "Occupancy of the Dictyostelium cAMP receptor, cAR1, induces a reduction in affinity which depends upon COOH-terminal serine residues.", "journal": "J. Biol. Chem.", "date": "1995", "authors": "Caterina M J, Hereld D, Devreotes P N", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "reference": [ { "type": "PubMed", "id": "7876207", "url": "https://glygen.org/publication/PubMed/7876207" } ] }, { "title": "Extracellular cAMP can restore development in Dictyostelium cells lacking one, but not two subtypes of early cAMP receptors (cARs). Evidence for involvement of cAR1 in aggregative gene expression.", "journal": "Development (Cambridge, England)", "date": "1994-07", "authors": "Soede R D, Insall R H, Devreotes P N, Schaap P", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "reference": [ { "type": "PubMed", "id": "7925004", "url": "https://glygen.org/publication/PubMed/7925004" } ] }, { "title": "Localization of ligand-induced phosphorylation sites to serine clusters in the C-terminal domain of the Dictyostelium cAMP receptor, cAR1.", "journal": "The Journal of biological chemistry", "date": "1994-03-04", "authors": "Hereld D, Vaughan R, Kim J Y, Borleis J, Devreotes P", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "reference": [ { "type": "PubMed", "id": "8120068", "url": "https://glygen.org/publication/PubMed/8120068" } ] }, { "title": "Precise expression of the cAMP receptor gene, CAR1, during transition from growth to differentiation in Dictyostelium discoideum.", "journal": "FEBS Lett.", "date": "1994", "authors": "Abe F, Maeda Y", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "reference": [ { "type": "PubMed", "id": "8150078", "url": "https://glygen.org/publication/PubMed/8150078" } ] }, { "title": "Two transmembrane signaling mechanisms control expression of the cAMP receptor gene CAR1 during Dictyostelium development.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1993", "authors": "Louis J M, Saxe C L, Kimmel A R", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "reference": [ { "type": "PubMed", "id": "8392183", "url": "https://glygen.org/publication/PubMed/8392183" } ] }, { "title": "Dynamic distribution of chemoattractant receptors in living cells during chemotaxis and persistent stimulation.", "journal": "J. Cell Biol.", "date": "1997", "authors": "Xiao Z, Zhang N, Murphy D B, Devreotes P N", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "reference": [ { "type": "PubMed", "id": "9334341", "url": "https://glygen.org/publication/PubMed/9334341" } ] }, { "title": "Phosphorylation of chemoattractant receptors is not essential for chemotaxis or termination of G-protein-mediated responses.", "journal": "The Journal of biological chemistry", "date": "1997-10-24", "authors": "Kim J Y, Soede R D, Schaap P, Valkema R, Borleis J A, Van Haastert P J, Devreotes P N, Hereld D", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "reference": [ { "type": "PubMed", "id": "9341180", "url": "https://glygen.org/publication/PubMed/9341180" } ] }, { "title": "Switching of chemoattractant receptors programs development and morphogenesis in Dictyostelium: receptor subtypes activate common responses at different agonist concentrations.", "journal": "Developmental biology", "date": "1998-05-01", "authors": "Kim J Y, Borleis J A, Devreotes P N", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "reference": [ { "type": "PubMed", "id": "9578623", "url": "https://glygen.org/publication/PubMed/9578623" } ] }, { "title": "Desensitization of G-protein-coupled receptors. agonist-induced phosphorylation of the chemoattractant receptor cAR1 lowers its intrinsic affinity for cAMP.", "journal": "The Journal of biological chemistry", "date": "1999-01-15", "authors": "Xiao Z, Yao Y, Long Y, Devreotes P", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "reference": [ { "type": "PubMed", "id": "9880518", "url": "https://glygen.org/publication/PubMed/9880518" } ] } ], "pathway": [ { "id": "ddi:DDB_G0273397", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0273397", "resource": "KEGG Pathway" }, { "id": "ddi:DDB_G0273533", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0273533", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 15, "go_terms": [ { "name": "response to curcumin", "id": "GO:1904643", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904643", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" }, { "name": "chemotaxis", "id": "GO:0006935", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006935", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" }, { "name": "adenylate cyclase-activating G protein-coupled receptor signaling pathway", "id": "GO:0007189", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007189", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" }, { "name": "ERK1 and ERK2 cascade", "id": "GO:0070371", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070371", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" }, { "name": "desensitization of G protein-coupled receptor signaling pathway", "id": "GO:0002029", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002029", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" }, { "name": "cGMP-mediated signaling", "id": "GO:0019934", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019934", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" }, { "name": "response to UV-C", "id": "GO:0010225", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010225", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" }, { "name": "regulation of G protein-coupled receptor signaling pathway", "id": "GO:0008277", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008277", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" }, { "name": "regulation of phagocytosis", "id": "GO:0050764", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050764", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" }, { "name": "receptor signaling pathway via STAT", "id": "GO:0097696", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097696", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" }, { "name": "response to catechin", "id": "GO:1902168", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902168", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" }, { "name": "adaptation of signaling pathway", "id": "GO:0023058", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0023058", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" }, { "name": "aggregation involved in sorocarp development", "id": "GO:0031152", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031152", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" }, { "name": "adenylate cyclase-activating G protein-coupled cAMP receptor signaling pathway", "id": "GO:0140582", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140582", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" }, { "name": "response to differentiation-inducing factor 1", "id": "GO:1903013", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903013", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 7, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" }, { "name": "protein kinase regulator activity", "id": "GO:0019887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019887", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" }, { "name": "GTPase regulator activity", "id": "GO:0030695", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030695", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" }, { "name": "cAMP binding", "id": "GO:0030552", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030552", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" }, { "name": "G protein-coupled chemoattractant receptor activity", "id": "GO:0001637", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001637", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" }, { "name": "cAMP receptor activity", "id": "GO:0001646", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001646", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" }, { "name": "adenylate cyclase regulator activity", "id": "GO:0010854", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010854", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "early endosome", "id": "GO:0005769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005769", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" }, { "name": "cell leading edge", "id": "GO:0031252", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031252", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 10, "end_pos": 12, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "C-terminal Ser or Thr residues may be phosphorylated.", "evidence": [ { "database": "UniProtKB", "id": "P13773", "url": "https://www.uniprot.org/uniprot/P13773" }, { "database": "PubMed", "id": "7721769", "url": "https://glygen.org/publication/PubMed/7721769" }, { "database": "PubMed", "id": "9880518", "url": "https://glygen.org/publication/PubMed/9880518" }, { "database": "PubMed", "id": "8120068", "url": "https://glygen.org/publication/PubMed/8120068" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [ 10 ], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 299, 302, 303, 304, 308, 360, 361, 362, 363, 364, 366, 367, 368 ], "sequon_annotation_sites": [ { "start_pos": 10, "end_pos": 12 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 13 }, { "field": "total_sites", "count": 13 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 25 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }