{ "uniprot_canonical_ac": "P13762-1", "uniprot_ac": "P13762", "uniprot_id": "DRB4_HUMAN", "mass": { "chemical_mass": 29941.0, "monoisotopic_mass": 29941.0 }, "refseq": { "ac": "NP_068818", "name": "major histocompatibility complex, class II, DR beta 4 precursor", "summary": "HLA-DRB4 belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DRA) and a beta (DRB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells. The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. There are multiple pseudogenes of this gene. [provided by RefSeq, Feb 2020].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_068818" }, "gene_names": [ { "name": "HLA-DRB4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P13762", "id": "P13762" }, { "name": "DR4; DRB4; HLA-DR4B; HLA-DRB; HLA-DRB4*", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_068818", "id": "NP_068818" }, { "name": "HLA-DRB4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_068818", "id": "NP_068818" } ], "protein_names": [ { "name": "HLA class II histocompatibility antigen, DR beta 4 chain", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P13762" }, { "name": "HLA class II histocompatibility antigen, DR beta 4 chain; MHC class II antigen DRB4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_068818", "id": "NP_068818" }, { "name": "MHC class II antigen DRB4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13762" }, { "name": "major histocompatibility complex, class II, DR beta 4 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_068818", "id": "NP_068818" } ], "function": [ { "annotation": "Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route, where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules, and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments, exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides, autophagosomes constitutively fuse with MHC class II loading compartments. In addition to APCs, other cells of the gastrointestinal tract, such as epithelial cells, express MHC class II molecules and CD74 and act as APCs, which is an unusual trait of the GI tract. To produce a MHC class II molecule that presents an antigen, three MHC class II molecules (heterodimers of an alpha and a beta chain) associate with a CD74 trimer in the ER to form a heterononamer. Soon after the entry of this complex into the endosomal/lysosomal system where antigen processing occurs, CD74 undergoes a sequential degradation by various proteases, including CTSS and CTSL, leaving a small fragment termed CLIP (class-II-associated invariant chain peptide). The removal of CLIP is facilitated by HLA-DM via direct binding to the alpha-beta-CLIP complex so that CLIP is released. HLA-DM stabilizes MHC class II molecules until primary high affinity antigenic peptides are bound. The MHC II molecule bound to a peptide is then transported to the cell membrane surface. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Primary dendritic cells (DCs) also to express HLA-DO. Lysosomal microenvironment has been implicated in the regulation of antigen loading into MHC II molecules, increased acidification produces increased proteolysis and efficient peptide loading.", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762#function" } ] }, { "annotation": "Contribution of HLA class II genes, DRB4*01:01, DRB1*07:01, and DQB1*03:03:2 to clinical features of Vitiligo disease in Iranian population.", "evidence": [ { "database": "RefSeq", "id": "NP_068818", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_068818" }, { "database": "PubMed", "id": "34686989", "url": "https://glygen.org/publication/PubMed/34686989" } ] }, { "annotation": "HLA-DR53 (DRB4 *01) associates with nickel sensitization.", "evidence": [ { "database": "RefSeq", "id": "NP_068818", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_068818" }, { "database": "PubMed", "id": "32693207", "url": "https://glygen.org/publication/PubMed/32693207" } ] }, { "annotation": "HLA-DRB4 belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DRA) and a beta (DRB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells. The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. There are multiple pseudogenes of this gene. [provided by RefSeq, Feb 2020].", "evidence": [ { "database": "RefSeq", "id": "NP_068818", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_068818" } ] }, { "annotation": "HLA-DRB4*01:14 is a null allele, and renamed HLA-DRB4*01:14N.", "evidence": [ { "database": "RefSeq", "id": "NP_068818", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_068818" }, { "database": "PubMed", "id": "31576671", "url": "https://glygen.org/publication/PubMed/31576671" } ] }, { "annotation": "Strong association of nontumor anti-LGI1 encephalitis with HLA-DRB4.", "evidence": [ { "database": "RefSeq", "id": "NP_068818", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_068818" }, { "database": "PubMed", "id": "28026046", "url": "https://glygen.org/publication/PubMed/28026046" } ] }, { "annotation": "We developed an human cardiac alpha-myosin -induced myocarditis model in human HLA-DR4 transgenic mice that lack all mouse MHCII genes.", "evidence": [ { "database": "RefSeq", "id": "NP_068818", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_068818" }, { "database": "PubMed", "id": "28431892", "url": "https://glygen.org/publication/PubMed/28431892" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 254, "end_pos": 254, "sequence_org": "K", "sequence_mut": "R", "comment": "Almost no change in down-regulation of MHC class II. No ubiquitination and complete loss of down-regulation of MHC class II; when associated with 'R-244' of HLA-DRA.", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" }, { "database": "PubMed", "id": "19117940", "url": "https://glygen.org/publication/PubMed/19117940" } ] }, { "start_pos": 264, "end_pos": 264, "sequence_org": "L", "sequence_mut": "A", "comment": "Almost no change in down-regulation of MHC class II; when associated with A-265.", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" }, { "database": "PubMed", "id": "19117940", "url": "https://glygen.org/publication/PubMed/19117940" } ] }, { "start_pos": 265, "end_pos": 265, "sequence_org": "L", "sequence_mut": "A", "comment": "Almost no change in down-regulation of MHC class II; when associated with A-264.", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" }, { "database": "PubMed", "id": "19117940", "url": "https://glygen.org/publication/PubMed/19117940" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "common_name": "Human" } ], "gene": [ { "name": "HLA-DRB4", "url": "https://www.uniprot.org/uniprot/P13762", "locus": { "chromosome": "HSCHR6_MHC_MANN_CTG1", "start_pos": 3840439, "end_pos": 3855387, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000227826", "url": "https://www.ensembl.org/id/ENSG00000227826" } ] } } ], "crossref": [ { "id": "cd21000", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd21000", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL3988561", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3988561", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "HLA-DRB4", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=HLA-DRB4", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "3126", "url": "https://www.ncbi.nlm.nih.gov/gene/3126", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "4952", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4952", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P13762", "url": "https://www.ebi.ac.uk/intact/interactors/id:P13762*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000353", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000353", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003006", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003006", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003597", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003597", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011162", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011162", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014745", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014745", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:3126", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3126", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NX_P13762", "url": "https://www.nextprot.org/entry/NX_P13762", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "PTHR19944", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19944", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19944:SF84", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19944:SF84", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00969", "url": "http://pfam.xfam.org/family/PF00969", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF07654", "url": "http://pfam.xfam.org/family/PF07654", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P13762", "url": "https://pharos.nih.gov/targets/P13762", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P13762", "url": "http://purl.obolibrary.org/obo/PR_P13762", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-202430", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202430", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_068818", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_068818", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0G2JJQ8", "url": "https://www.uniprot.org/uniprot/A0A0G2JJQ8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JJQ8-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JJQ8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13762-1", "url": "https://www.uniprot.org/uniprot/P13762-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "X5D2U9", "url": "https://www.uniprot.org/uniprot/X5D2U9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "X5D2U9-1", "url": "https://www.uniprot.org/uniprot/X5D2U9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS", "length": 266, "header": "sp|P13762-1|DRB4_HUMAN Isoform 1 of HLA class II histocompatibility antigen, DR beta 4 chain OS=Homo sapiens OX=9606 GN=HLA-DRB4 PE=1 SV=2 CANONICAL=P13762-1" }, "isoforms": [ { "isoform_ac": "A0A0G2JJQ8-1", "url": "", "sequence": { "sequence": "MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNSQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS", "length": 266, "header": "tr|A0A0G2JJQ8-1|DRB4_HUMAN Computationally mapped isoform of HLA class II histocompatibility antigen, DR beta 4 chain OS=Homo sapiens OX=9606 GN=HLA-DRB4 PE=1 SV=1 CANONICAL=P13762-1" }, "locus": { "chromosome": "HSCHR6_MHC_MANN_CTG1", "start_pos": 3855324, "end_pos": 3840750, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000411959.6", "url": "https://www.ensembl.org/id/ENST00000411959.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000410046.2", "url": "https://www.ensembl.org/id/ENSP00000410046.2" } ] } }, { "isoform_ac": "P13762-1", "url": "", "sequence": { "sequence": "MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS", "length": 266, "header": "sp|P13762-1|DRB4_HUMAN Isoform 1 of HLA class II histocompatibility antigen, DR beta 4 chain OS=Homo sapiens OX=9606 GN=HLA-DRB4 PE=1 SV=2 CANONICAL=P13762-1" }, "locus": { "chromosome": "HSCHR6_MHC_SSTO_CTG1", "start_pos": 3866033, "end_pos": 3851456, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000411565.2", "url": "https://www.ensembl.org/id/ENST00000411565.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000410857.2", "url": "https://www.ensembl.org/id/ENSP00000410857.2" } ] } }, { "isoform_ac": "X5D2U9-1", "url": "", "sequence": { "sequence": "MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS", "length": 266, "header": "tr|X5D2U9-1|DRB4_HUMAN Computationally mapped isoform of HLA class II histocompatibility antigen, DR beta 4 chain OS=Homo sapiens OX=9606 GN=HLA-DRB4 PE=1 SV=1 CANONICAL=P13762-1" }, "locus": { "chromosome": "HSCHR6_MHC_MCF_CTG1", "start_pos": 3891636, "end_pos": 3877059, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000457451", "url": "https://www.ensembl.org/id/ENST00000457451" }, { "database": "Ensembl Peptide", "id": "ENSP00000412031", "url": "https://www.ensembl.org/id/ENSP00000412031" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 48, "start_aa": "Asn", "end_pos": 48, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn48", "evidence": [ { "id": "P13762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13762#ptm_processing" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported" ], "publication": [ { "title": "Opposing motor activities of dynein and kinesin determine retention and transport of MHC class II-containing compartments.", "journal": "Journal of cell science", "date": "1999", "authors": "Wubbolts R, Fernandez-Borja M, Jordens I, Reits E, Dusseljee S, Echeverri C, Vallee RB, Neefjes J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "10036229", "url": "https://glygen.org/publication/PubMed/10036229" } ] }, { "title": "Identification of destabilizing residues in HLA class II-selected bacteriophage display libraries edited by HLA-DM.", "journal": "European journal of immunology", "date": "1999", "authors": "Raddrizzani L, Bono E, Vogt AB, Kropshofer H, Gallazzi F, Sturniolo T, Hammerling GJ, Sinigaglia F, Hammer J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "10064083", "url": "https://glygen.org/publication/PubMed/10064083" } ] }, { "title": "Inhibition of transforming growth factor-beta/SMAD signalling by the interferon-gamma/STAT pathway.", "journal": "Nature", "date": "1999", "authors": "Ulloa L, Doody J, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "10067896", "url": "https://glygen.org/publication/PubMed/10067896" } ] }, { "title": "Cathepsin S required for normal MHC class II peptide loading and germinal center development.", "journal": "Immunity", "date": "1999", "authors": "Shi GP, Villadangos JA, Dranoff G, Small C, Gu L, Haley KJ, Riese R, Ploegh HL, Chapman HA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "10072072", "url": "https://glygen.org/publication/PubMed/10072072" } ] }, { "title": "Direct transport of newly synthesized HLA-DR from the trans-Golgi network to major histocompatibility complex class II containing compartments (MIICS) demonstrated using a novel tyrosine-sulfated chimera.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Davidson HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "10480952", "url": "https://glygen.org/publication/PubMed/10480952" } ] }, { "title": "Cell surface expression and metabolism of major histocompatibility complex class II invariant chain (CD74) by diverse cell lines.", "journal": "Immunology", "date": "1999", "authors": "Ong GL, Goldenberg DM, Hansen HJ, Mattes MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "10540230", "url": "https://glygen.org/publication/PubMed/10540230" } ] }, { "title": "The leucine-based sorting motifs in the cytoplasmic domain of the invariant chain are recognized by the clathrin adaptors AP1 and AP2 and their medium chains.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Hofmann MW, Honing S, Rodionov D, Dobberstein B, von Figura K, Bakke O", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "10593899", "url": "https://glygen.org/publication/PubMed/10593899" } ] }, { "title": "Proteases involved in MHC class II antigen presentation.", "journal": "Immunological reviews", "date": "1999", "authors": "Villadangos JA, Bryant RA, Deussing J, Driessen C, Lennon-Dumenil AM, Riese RJ, Roth W, Saftig P, Shi GP, Chapman HA, Peters C, Ploegh HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "10631941", "url": "https://glygen.org/publication/PubMed/10631941" } ] }, { "title": "The impact of the non-classical MHC proteins HLA-DM and HLA-DO on loading of MHC class II molecules.", "journal": "Immunological reviews", "date": "1999", "authors": "Kropshofer H, Hammerling GJ, Vogt AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "10631952", "url": "https://glygen.org/publication/PubMed/10631952" } ] }, { "title": "Enzymatic reduction of disulfide bonds in lysosomes: characterization of a gamma-interferon-inducible lysosomal thiol reductase (GILT).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Arunachalam B, Phan UT, Geuze HJ, Cresswell P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "10639150", "url": "https://glygen.org/publication/PubMed/10639150" } ] }, { "title": "Functional association between SLAP-130 and SLP-76 in Jurkat T cells.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Boerth NJ, Judd BA, Koretzky GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "10671560", "url": "https://glygen.org/publication/PubMed/10671560" } ] }, { "title": "The PI3K-PDK1 connection: more than just a road to PKB.", "journal": "The Biochemical journal", "date": "2000", "authors": "Vanhaesebroeck B, Alessi DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "10698680", "url": "https://glygen.org/publication/PubMed/10698680" } ] }, { "title": "Structure, function, and biology of SHIP proteins.", "journal": "Genes & development", "date": "2000", "authors": "Rohrschneider LR, Fuller JF, Wolf I, Liu Y, Lucas DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "10716940", "url": "https://glygen.org/publication/PubMed/10716940" } ] }, { "title": "Fyn-binding protein (Fyb)/SLP-76-associated protein (SLAP), Ena/vasodilator-stimulated phosphoprotein (VASP) proteins and the Arp2/3 complex link T cell receptor (TCR) signaling to the actin cytoskeleton.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Krause M, Sechi AS, Konradt M, Monner D, Gertler FB, Wehland J", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "10747096", "url": "https://glygen.org/publication/PubMed/10747096" } ] }, { "title": "Role for cathepsin F in invariant chain processing and major histocompatibility complex class II peptide loading by macrophages.", "journal": "The Journal of experimental medicine", "date": "2000", "authors": "Shi GP, Bryant RA, Riese R, Verhelst S, Driessen C, Li Z, Bromme D, Ploegh HL, Chapman HA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "10748235", "url": "https://glygen.org/publication/PubMed/10748235" } ] }, { "title": "Phosphoprotein associated with glycosphingolipid-enriched microdomains (PAG), a novel ubiquitously expressed transmembrane adaptor protein, binds the protein tyrosine kinase csk and is involved in regulation of T cell activation.", "journal": "The Journal of experimental medicine", "date": "2000", "authors": "Brdicka T, Pavlistova D, Leo A, Bruyns E, Korinek V, Angelisova P, Scherer J, Shevchenko A, Hilgert I, Cerny J, Drbal K, Kuramitsu Y, Kornacker B, Horejsi V, Schraven B", "evidence": [ { "database": "Reactome", "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427" } ], "reference": [ { "type": "PubMed", "id": "10790433", "url": "https://glygen.org/publication/PubMed/10790433" } ] }, { "title": "Lysosomal cathepsin B plays an important role in antigen processing, while cathepsin D is involved in degradation of the invariant chain inovalbumin-immunized mice.", "journal": "Immunology", "date": "2000", "authors": "Zhang T, Maekawa Y, Hanba J, Dainichi T, Nashed BF, Hisaeda H, Sakai T, Asao T, Himeno K, Good RA, Katunuma N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "10809954", "url": "https://glygen.org/publication/PubMed/10809954" } ] }, { "title": "Association of Grb2, Gads, and phospholipase C-gamma 1 with phosphorylated LAT tyrosine residues. Effect of LAT tyrosine mutations on T cell angigen receptor-mediated signaling.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Zhang W, Trible RP, Zhu M, Liu SK, McGlade CJ, Samelson LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "10811803", "url": "https://glygen.org/publication/PubMed/10811803" } ] }, { "title": "Observation of an unexpected third receptor molecule in the crystal structure of human interferon-gamma receptor complex.", "journal": "Structure (London, England : 1993)", "date": "2000", "authors": "Thiel DJ, le Du MH, Walter RL, D'Arcy A, Chene C, Fountoulakis M, Garotta G, Winkler FK, Ealick SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "10986460", "url": "https://glygen.org/publication/PubMed/10986460" } ] }, { "title": "The mechanism of phospholipase C-gamma1 regulation.", "journal": "Experimental & molecular medicine", "date": "2000", "authors": "Kim MJ, Kim E, Ryu SH, Suh PG", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "11048639", "url": "https://glygen.org/publication/PubMed/11048639" } ] }, { "title": "Protein kinase C theta is expressed in mast cells and is functionally involved in Fcepsilon receptor I signaling.", "journal": "Journal of leukocyte biology", "date": "2001", "authors": "Liu Y, Graham C, Parravicini V, Brown MJ, Rivera J, Shaw S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "11358993", "url": "https://glygen.org/publication/PubMed/11358993" } ] }, { "title": "Identification of a phospholipase C-gamma1 (PLC-gamma1) SH3 domain-binding site in SLP-76 required for T-cell receptor-mediated activation of PLC-gamma1 and NFAT.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Yablonski D, Kadlecek T, Weiss A", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "11390650", "url": "https://glygen.org/publication/PubMed/11390650" } ] }, { "title": "Trans-Golgi network sorting.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2001", "authors": "Gu F, Crump CM, Thomas G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "11529500", "url": "https://glygen.org/publication/PubMed/11529500" } ] }, { "title": "The role of Gads in hematopoietic cell signalling.", "journal": "Oncogene", "date": "2001", "authors": "Liu SK, Berry DM, McGlade CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "11607830", "url": "https://glygen.org/publication/PubMed/11607830" } ] }, { "title": "Presentation of antigens by MHC class II molecules: getting the most out of them.", "journal": "Mol. Immunol.", "date": "2001", "authors": "Villadangos JA", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" }, { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "11684289", "url": "https://glygen.org/publication/PubMed/11684289" } ] }, { "title": "LAT, the linker for activation of T cells: a bridge between T cell-specific and general signaling pathways.", "journal": "Science's STKE : signal transduction knowledge environment", "date": "2000", "authors": "Wange RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "11752630", "url": "https://glygen.org/publication/PubMed/11752630" } ] }, { "title": "Trafficking of MHC class II molecules in the late secretory pathway.", "journal": "Current opinion in immunology", "date": "2002", "authors": "Hiltbold EM, Roche PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "11790530", "url": "https://glygen.org/publication/PubMed/11790530" } ] }, { "title": "Specific role for cathepsin S in the generation of antigenic peptides in vivo.", "journal": "European journal of immunology", "date": "2002", "authors": "Pluger EB, Boes M, Alfonso C, Schroter CJ, Kalbacher H, Ploegh HL, Driessen C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "11813165", "url": "https://glygen.org/publication/PubMed/11813165" } ] }, { "title": "Adapters in lymphocyte signaling.", "journal": "The Journal of clinical investigation", "date": "2002", "authors": "Leo A, Wienands J, Baier G, Horejsi V, Schraven B", "evidence": [ { "database": "Reactome", "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427" } ], "reference": [ { "type": "PubMed", "id": "11827988", "url": "https://glygen.org/publication/PubMed/11827988" } ] }, { "title": "Multiple roles of the invariant chain in MHC class II function.", "journal": "Biochimica et biophysica acta", "date": "2002", "authors": "Stumptner-Cuvelette P, Benaroch P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "11853874", "url": "https://glygen.org/publication/PubMed/11853874" } ] }, { "title": "Regulation of the immune response by SHIP.", "journal": "Seminars in immunology", "date": "2002", "authors": "March ME, Ravichandran K", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "11884229", "url": "https://glygen.org/publication/PubMed/11884229" } ] }, { "title": "Requirement of Ca2+ and CaMKII for Stat1 Ser-727 phosphorylation in response to IFN-gamma.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Nair JS, DaFonseca CJ, Tjernberg A, Sun W, Darnell JE Jr, Chait BT, Zhang JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "11972023", "url": "https://glygen.org/publication/PubMed/11972023" } ] }, { "title": "Specific amplification of the HLA-DRB4 gene from c-DNA. Complete coding sequence of the HLA alleles DRB4*0103101 and DRB4*01033.", "journal": "Tissue Antigens", "date": "2002", "authors": "De Pablo R, Sol\u00eds R, Balas A, Vilches C", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "reference": [ { "type": "PubMed", "id": "11972878", "url": "https://glygen.org/publication/PubMed/11972878" } ] }, { "title": "A road map for those who don't know JAK-STAT.", "journal": "Science (New York, N.Y.)", "date": "2002", "authors": "Aaronson DS, Horvath CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "12040185", "url": "https://glygen.org/publication/PubMed/12040185" } ] }, { "title": "Proteolysis and antigen presentation by MHC class II molecules.", "journal": "Advances in immunology", "date": "2002", "authors": "Bryant PW, Lennon-Dumenil AM, Fiebiger E, Lagaudriere-Gesbert C, Ploegh HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "12078484", "url": "https://glygen.org/publication/PubMed/12078484" } ] }, { "title": "Dendritic cell maturation triggers retrograde MHC class II transport from lysosomes to the plasma membrane.", "journal": "Nature", "date": "2002", "authors": "Chow A, Toomre D, Garrett W, Mellman I", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "12198549", "url": "https://glygen.org/publication/PubMed/12198549" } ] }, { "title": "Seeing the light: preassembly and ligand-induced changes of the interferon gamma receptor complex in cells.", "journal": "Molecular & cellular proteomics : MCP", "date": "2002", "authors": "Krause CD, Mei E, Xie J, Jia Y, Bopp MA, Hochstrasser RM, Pestka S", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "12438563", "url": "https://glygen.org/publication/PubMed/12438563" } ] }, { "title": "Y-box-binding protein YB-1 mediates transcriptional repression of human alpha 2(I) collagen gene expression by interferon-gamma.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Higashi K, Inagaki Y, Suzuki N, Mitsui S, Mauviel A, Kaneko H, Nakatsuka I", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "12446674", "url": "https://glygen.org/publication/PubMed/12446674" } ] }, { "title": "Protein kinase C-theta (PKC theta): a key enzyme in T cell life and death.", "journal": "Journal of biochemistry", "date": "2002", "authors": "Altman A, Villalba M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "12473184", "url": "https://glygen.org/publication/PubMed/12473184" } ] }, { "title": "Positive and negative regulation of T-cell activation through kinases and phosphatases.", "journal": "The Biochemical journal", "date": "2003", "authors": "Mustelin T, Tasken K", "evidence": [ { "database": "Reactome", "id": "R-HSA-202430", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202430" } ], "reference": [ { "type": "PubMed", "id": "12485116", "url": "https://glygen.org/publication/PubMed/12485116" } ] }, { "title": "The role of PI3K in immune cells.", "journal": "Nature immunology", "date": "2003", "authors": "Koyasu S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "12660731", "url": "https://glygen.org/publication/PubMed/12660731" } ] }, { "title": "Antigen processing and presentation in human muscle: cathepsin S is critical for MHC class II expression and upregulated in inflammatory myopathies.", "journal": "Journal of neuroimmunology", "date": "2003", "authors": "Wiendl H, Lautwein A, Mitsdorffer M, Krause S, Erfurth S, Wienhold W, Morgalla M, Weber E, Overkleeft HS, Lochmuller H, Melms A, Tolosa E, Driessen C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "12742663", "url": "https://glygen.org/publication/PubMed/12742663" } ] }, { "title": "Human cathepsin S, but not cathepsin L, degrades efficiently MHC class II-associated invariant chain in nonprofessional APCs.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Bania J, Gatti E, Lelouard H, David A, Cappello F, Weber E, Camosseto V, Pierre P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "12748383", "url": "https://glygen.org/publication/PubMed/12748383" } ] }, { "title": "Differential binding properties of B7-H1 and B7-DC to programmed death-1.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Youngnak P, Kozono Y, Kozono H, Iwai H, Otsuki N, Jin H, Omura K, Yagita H, Pardoll DM, Chen L, Azuma M", "evidence": [ { "database": "Reactome", "id": "R-HSA-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948" } ], "reference": [ { "type": "PubMed", "id": "12893276", "url": "https://glygen.org/publication/PubMed/12893276" } ] }, { "title": "The ins and outs of STAT1 nuclear transport.", "journal": "Science's STKE : signal transduction knowledge environment", "date": "2003", "authors": "McBride KM, Reich NC", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "12915721", "url": "https://glygen.org/publication/PubMed/12915721" } ] }, { "title": "The activation of Csk by CD4 interferes with TCR-mediated activatory signaling.", "journal": "European journal of immunology", "date": "2003", "authors": "Marinari B, Simeoni L, Schraven B, Piccolella E, Tuosto L", "evidence": [ { "database": "Reactome", "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427" } ], "reference": [ { "type": "PubMed", "id": "12938237", "url": "https://glygen.org/publication/PubMed/12938237" } ] }, { "title": "Cytotoxic T-lymphocyte antigen-4 and programmed death-1 function as negative regulators of lymphocyte activation.", "journal": "Immunologic research", "date": "2003", "authors": "Carter LL, Carreno BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948" } ], "reference": [ { "type": "PubMed", "id": "12947224", "url": "https://glygen.org/publication/PubMed/12947224" } ] }, { "title": "Stoichiometry of interaction between interferon gamma and its receptor.", "journal": "European journal of biochemistry", "date": "1992", "authors": "Fountoulakis M, Zulauf M, Lustig A, Garotta G", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "1396683", "url": "https://glygen.org/publication/PubMed/1396683" } ] }, { "title": "Hematopoietic adaptors in T-cell signaling: potential applications to transplantation.", "journal": "American journal of transplantation : official journal of the American Society of Transplantation and the American Society of Transplant Surgeons", "date": "2003", "authors": "Rudd CE, Wang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "14510693", "url": "https://glygen.org/publication/PubMed/14510693" } ] }, { "title": "Signal-induced ubiquitination of I kappaB Kinase-beta.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Carter RS, Pennington KN, Ungurait BJ, Arrate P, Ballard DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "14514672", "url": "https://glygen.org/publication/PubMed/14514672" } ] }, { "title": "Interferon-gamma suppresses transforming growth factor-beta-induced invasion of gastric carcinoma cells through cross-talk of Smad pathway in a three-dimensional culture model.", "journal": "Oncogene", "date": "2003", "authors": "Kuga H, Morisaki T, Nakamura K, Onishi H, Noshiro H, Uchiyama A, Tanaka M, Katano M", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "14586410", "url": "https://glygen.org/publication/PubMed/14586410" } ] }, { "title": "Interferon-gamma inhibits transforming growth factor-beta production in human airway epithelial cells by targeting Smads.", "journal": "American journal of respiratory cell and molecular biology", "date": "2004", "authors": "Wen FQ, Liu X, Kobayashi T, Abe S, Fang Q, Kohyama T, Ertl R, Terasaki Y, Manouilova L, Rennard SI", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "14722222", "url": "https://glygen.org/publication/PubMed/14722222" } ] }, { "title": "Targeting of membrane proteins to endosomes and lysosomes.", "journal": "Trends in cell biology", "date": "1994", "authors": "Sandoval IV, Bakke O", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "14731593", "url": "https://glygen.org/publication/PubMed/14731593" } ] }, { "title": "T cell receptor signaling: beyond complex complexes.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Huang Y, Wange RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427" } ], "reference": [ { "type": "PubMed", "id": "15084594", "url": "https://glygen.org/publication/PubMed/15084594" } ] }, { "title": "Transcriptional induction of IFN-gamma-responsive genes is modulated by DNA surrounding the interferon stimulation response element.", "journal": "Nucleic acids research", "date": "1992", "authors": "Strehlow I, Decker T", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "1508672", "url": "https://glygen.org/publication/PubMed/1508672" } ] }, { "title": "CARMA1, BCL-10 and MALT1 in lymphocyte development and activation.", "journal": "Nature reviews. Immunology", "date": "2004", "authors": "Thome M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "15122200", "url": "https://glygen.org/publication/PubMed/15122200" } ] }, { "title": "The TRAF6 ubiquitin ligase and TAK1 kinase mediate IKK activation by BCL10 and MALT1 in T lymphocytes.", "journal": "Molecular cell", "date": "2004", "authors": "Sun L, Deng L, Ea CK, Xia ZP, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "15125833", "url": "https://glygen.org/publication/PubMed/15125833" } ] }, { "title": "Autophosphorylation of JAK2 on tyrosines 221 and 570 regulates its activity.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Argetsinger LS, Kouadio JL, Steen H, Stensballe A, Jensen ON, Carter-Su C", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "15143187", "url": "https://glygen.org/publication/PubMed/15143187" } ] }, { "title": "The two NF-kappaB activation pathways and their role in innate and adaptive immunity.", "journal": "Trends in immunology", "date": "2004", "authors": "Bonizzi G, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "15145317", "url": "https://glygen.org/publication/PubMed/15145317" } ] }, { "title": "Protein kinase Cdelta regulates apoptosis via activation of STAT1.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "DeVries TA, Kalkofen RL, Matassa AA, Reyland ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "15322115", "url": "https://glygen.org/publication/PubMed/15322115" } ] }, { "title": "PD-1 inhibits T-cell receptor induced phosphorylation of the ZAP70/CD3zeta signalosome and downstream signaling to PKCtheta.", "journal": "FEBS letters", "date": "2004", "authors": "Sheppard KA, Fitz LJ, Lee JM, Benander C, George JA, Wooters J, Qiu Y, Jussif JM, Carter LL, Wood CR, Chaudhary D", "evidence": [ { "database": "Reactome", "id": "R-HSA-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948" } ], "reference": [ { "type": "PubMed", "id": "15358536", "url": "https://glygen.org/publication/PubMed/15358536" } ] }, { "title": "Signaling to NF-kappaB.", "journal": "Genes & development", "date": "2004", "authors": "Hayden MS, Ghosh S", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "15371334", "url": "https://glygen.org/publication/PubMed/15371334" } ] }, { "title": "Three-dimensional structures of a humanized anti-IFN-gamma Fab (HuZAF) in two crystal forms.", "journal": "Acta crystallographica. Section D, Biological crystallography", "date": "2004", "authors": "Bourne PC, Terzyan SS, Cloud G, Landolfi NF, Vasquez M, Edmundson AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "15388922", "url": "https://glygen.org/publication/PubMed/15388922" } ] }, { "title": "Structure and regulation of Src family kinases.", "journal": "Oncogene", "date": "2004", "authors": "Boggon TJ, Eck MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427" } ], "reference": [ { "type": "PubMed", "id": "15489910", "url": "https://glygen.org/publication/PubMed/15489910" } ] }, { "title": "Function of the Src-family kinases, Lck and Fyn, in T-cell development and activation.", "journal": "Oncogene", "date": "2004", "authors": "Palacios EH, Weiss A", "evidence": [ { "database": "Reactome", "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427" } ], "reference": [ { "type": "PubMed", "id": "15489916", "url": "https://glygen.org/publication/PubMed/15489916" } ] }, { "title": "Determination of the transphosphorylation sites of Jak2 kinase.", "journal": "Biochemical and biophysical research communications", "date": "2004", "authors": "Matsuda T, Feng J, Witthuhn BA, Sekine Y, Ihle JN", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "15530433", "url": "https://glygen.org/publication/PubMed/15530433" } ] }, { "title": "The roles of CARMA1, Bcl10, and MALT1 in antigen receptor signaling.", "journal": "Seminars in immunology", "date": "2004", "authors": "Lin X, Wang D", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "15541657", "url": "https://glygen.org/publication/PubMed/15541657" } ] }, { "title": "AP2 clathrin adaptor complex, but not AP1, controls the access of the major histocompatibility complex (MHC) class II to endosomes.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Dugast M, Toussaint H, Dousset C, Benaroch P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "15749704", "url": "https://glygen.org/publication/PubMed/15749704" } ] }, { "title": "Involvement of clathrin and AP-2 in the trafficking of MHC class II molecules to antigen-processing compartments.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "McCormick PJ, Martina JA, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "15911768", "url": "https://glygen.org/publication/PubMed/15911768" } ] }, { "title": "Ubiquitin signalling in the NF-kappaB pathway.", "journal": "Nature cell biology", "date": "2005", "authors": "Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "16056267", "url": "https://glygen.org/publication/PubMed/16056267" } ] }, { "title": "Asparaginyl endopeptidase: case history of a class II MHC compartment protease.", "journal": "Immunological reviews", "date": "2005", "authors": "Watts C, Matthews SP, Mazzeo D, Manoury B, Moss CX", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "16181339", "url": "https://glygen.org/publication/PubMed/16181339" } ] }, { "title": "Signaling through a mutant IFN-gamma receptor.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Costa-Pereira AP, Hermanns HM, Is'harc H, Williams TM, Watling D, Arulampalam V, Newman SJ, Heinrich PC, Kerr IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "16237089", "url": "https://glygen.org/publication/PubMed/16237089" } ] }, { "title": "Assembly of major histocompatibility complex class II subunits with invariant chain.", "journal": "FEBS letters", "date": "2005", "authors": "Neumann J, Koch N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "16242130", "url": "https://glygen.org/publication/PubMed/16242130" } ] }, { "title": "Phosphorylation of CARMA1: the link(er) to NF-kappaB activation.", "journal": "Immunity", "date": "2005", "authors": "Rueda D, Thome M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "16356853", "url": "https://glygen.org/publication/PubMed/16356853" } ] }, { "title": "Phosphorylation of the CARMA1 linker controls NF-kappaB activation.", "journal": "Immunity", "date": "2005", "authors": "Sommer K, Guo B, Pomerantz JL, Bandaranayake AD, Moreno-Garcia ME, Ovechkina YL, Rawlings DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "16356855", "url": "https://glygen.org/publication/PubMed/16356855" } ] }, { "title": "T-cell signalling and immune system disorders.", "journal": "Expert reviews in molecular medicine", "date": "2005", "authors": "Wilkinson B, Downey JS, Rudd CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427" } ], "reference": [ { "type": "PubMed", "id": "16364187", "url": "https://glygen.org/publication/PubMed/16364187" } ] }, { "title": "Identification of substrates of human protein-tyrosine phosphatase PTPN22.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Wu J, Katrekar A, Honigberg LA, Smith AM, Conn MT, Tang J, Jeffery D, Mortara K, Sampang J, Williams SR, Buggy J, Clark JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427" } ], "reference": [ { "type": "PubMed", "id": "16461343", "url": "https://glygen.org/publication/PubMed/16461343" } ] }, { "title": "Preassembly and ligand-induced restructuring of the chains of the IFN-gamma receptor complex: the roles of Jak kinases, Stat1 and the receptor chains.", "journal": "Cell research", "date": "2006", "authors": "Krause CD, Lavnikova N, Xie J, Mei E, Mirochnitchenko OV, Jia Y, Hochstrasser RM, Pestka S", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "16467876", "url": "https://glygen.org/publication/PubMed/16467876" } ] }, { "title": "Normal T-cell development and immune functions in TRIM-deficient mice.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Kolsch U, Arndt B, Reinhold D, Lindquist JA, Juling N, Kliche S, Pfeffer K, Bruyns E, Schraven B, Simeoni L", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "16612002", "url": "https://glygen.org/publication/PubMed/16612002" } ] }, { "title": "Invariant chain transmembrane domain trimerization: a step in MHC class II assembly.", "journal": "Biochemistry", "date": "2006", "authors": "Dixon AM, Stanley BJ, Matthews EE, Dawson JP, Engelman DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "16618111", "url": "https://glygen.org/publication/PubMed/16618111" } ] }, { "title": "The formation of TGN-to-plasma-membrane transport carriers.", "journal": "Annual review of cell and developmental biology", "date": "2006", "authors": "Bard F, Malhotra V", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "16824007", "url": "https://glygen.org/publication/PubMed/16824007" } ] }, { "title": "Selective function of PKC-theta in T cells.", "journal": "Cellular & molecular immunology", "date": "2006", "authors": "Manicassamy S, Gupta S, Sun Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "16978534", "url": "https://glygen.org/publication/PubMed/16978534" } ] }, { "title": "Regulation and function of IKK and IKK-related kinases.", "journal": "Science's STKE : signal transduction knowledge environment", "date": "2006", "authors": "Hacker H, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17047224", "url": "https://glygen.org/publication/PubMed/17047224" } ] }, { "title": "Introduction to NF-kappaB: players, pathways, perspectives.", "journal": "Oncogene", "date": "2006", "authors": "Gilmore TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17072321", "url": "https://glygen.org/publication/PubMed/17072321" } ] }, { "title": "IFN-gamma abrogates profibrogenic TGF-beta signaling in liver by targeting expression of inhibitory and receptor Smads.", "journal": "Journal of hepatology", "date": "2007", "authors": "Weng H, Mertens PR, Gressner AM, Dooley S", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "17125875", "url": "https://glygen.org/publication/PubMed/17125875" } ] }, { "title": "Site-specific Lys-63-linked tumor necrosis factor receptor-associated factor 6 auto-ubiquitination is a critical determinant of I kappa B kinase activation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Lamothe B, Besse A, Campos AD, Webster WK, Wu H, Darnay BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17135271", "url": "https://glygen.org/publication/PubMed/17135271" } ] }, { "title": "Functional requirements for the lysosomal thiol reductase GILT in MHC class II-restricted antigen processing.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006", "authors": "Hastings KT, Lackman RL, Cresswell P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "17142755", "url": "https://glygen.org/publication/PubMed/17142755" } ] }, { "title": "Autophagy in MHC class II presentation: sampling from within.", "journal": "Immunity", "date": "2007", "authors": "Men\u00e9ndez-Benito Victoria, Neefjes Jacques", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "reference": [ { "type": "PubMed", "id": "17241953", "url": "https://glygen.org/publication/PubMed/17241953" } ] }, { "title": "Activation of endosomal dynein motors by stepwise assembly of Rab7-RILP-p150Glued, ORP1L, and the receptor betalll spectrin.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Johansson M, Rocha N, Zwart W, Jordens I, Janssen L, Kuijl C, Olkkonen VM, Neefjes J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "17283181", "url": "https://glygen.org/publication/PubMed/17283181" } ] }, { "title": "Phosphorylation and ubiquitination of the IkappaB kinase complex by two distinct signaling pathways.", "journal": "The EMBO journal", "date": "2007", "authors": "Shambharkar PB, Blonska M, Pappu BP, Li H, You Y, Sakurai H, Darnay BG, Hara H, Penninger J, Lin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17363905", "url": "https://glygen.org/publication/PubMed/17363905" } ] }, { "title": "Post-translational modifications regulate distinct functions of CARMA1 and BCL10.", "journal": "Trends in immunology", "date": "2007", "authors": "Thome M, Weil R", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17468049", "url": "https://glygen.org/publication/PubMed/17468049" } ] }, { "title": "Ubiquitin-mediated activation of TAK1 and IKK.", "journal": "Oncogene", "date": "2007", "authors": "Adhikari A, Xu M, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17496917", "url": "https://glygen.org/publication/PubMed/17496917" } ] }, { "title": "Mechanism of diacylglycerol-induced membrane targeting and activation of protein kinase Ctheta.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Melowic HR, Stahelin RV, Blatner NR, Tian W, Hayashi K, Altman A, Cho W", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17548359", "url": "https://glygen.org/publication/PubMed/17548359" } ] }, { "title": "Keeping the (kinase) party going: SLP-76 and ITK dance to the beat.", "journal": "Science's STKE : signal transduction knowledge environment", "date": "2007", "authors": "Qi Q, August A", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "17652306", "url": "https://glygen.org/publication/PubMed/17652306" } ] }, { "title": "Identification of TRAF6-dependent NEMO polyubiquitination sites through analysis of a new NEMO mutation causing incontinentia pigmenti.", "journal": "Human molecular genetics", "date": "2007", "authors": "Sebban-Benin H, Pescatore A, Fusco F, Pascuale V, Gautheron J, Yamaoka S, Moncla A, Ursini MV, Courtois G", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "17728323", "url": "https://glygen.org/publication/PubMed/17728323" } ] }, { "title": "MHC class II molecules on the move for successful antigen presentation.", "journal": "EMBO J.", "date": "2008", "authors": "Rocha N, Neefjes J", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" }, { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "18046453", "url": "https://glygen.org/publication/PubMed/18046453" } ] }, { "title": "PD-1 and its ligands in tolerance and immunity.", "journal": "Annual review of immunology", "date": "2008", "authors": "Keir ME, Butte MJ, Freeman GJ, Sharpe AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948" } ], "reference": [ { "type": "PubMed", "id": "18173375", "url": "https://glygen.org/publication/PubMed/18173375" } ] }, { "title": "Lysosomal cysteine and aspartic proteases are heterogeneously expressed and act redundantly to initiate human invariant chain degradation.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2008", "authors": "Costantino CM, Hang HC, Kent SC, Hafler DA, Ploegh HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "18292509", "url": "https://glygen.org/publication/PubMed/18292509" } ] }, { "title": "MHC class II stabilization at the surface of human dendritic cells is the result of maturation-dependent MARCH I down-regulation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "De Gassart A, Camosseto V, Thibodeau J, Ceppi M, Catalan N, Pierre P, Gatti E", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "reference": [ { "type": "PubMed", "id": "18305173", "url": "https://glygen.org/publication/PubMed/18305173" } ] }, { "title": "Induction of guanylate binding protein 5 by gamma interferon increases susceptibility to Salmonella enterica serovar Typhimurium-induced pyroptosis in RAW 264.7 cells.", "journal": "Infection and immunity", "date": "2008", "authors": "Rupper AC, Cardelli JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "18362138", "url": "https://glygen.org/publication/PubMed/18362138" } ] }, { "title": "Tyrosine phosphorylation regulates the partitioning of STAT1 between different dimer conformations.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Wenta N, Strauss H, Meyer S, Vinkemeier U", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "18591661", "url": "https://glygen.org/publication/PubMed/18591661" } ] }, { "title": "Control of peripheral T-cell tolerance and autoimmunity via the CTLA-4 and PD-1 pathways.", "journal": "Immunological reviews", "date": "2008", "authors": "Fife BT, Bluestone JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948" } ], "reference": [ { "type": "PubMed", "id": "18759926", "url": "https://glygen.org/publication/PubMed/18759926" } ] }, { "title": "MHC class II transport at a glance.", "journal": "J. Cell Sci.", "date": "2009", "authors": "Berger Adam C, Roche Paul A", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "reference": [ { "type": "PubMed", "id": "19092054", "url": "https://glygen.org/publication/PubMed/19092054" } ] }, { "title": "The HLA-DRalpha chain is modified by polyubiquitination.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Lapaque N, Jahnke M, Trowsdale J, Kelly AP", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "reference": [ { "type": "PubMed", "id": "19117940", "url": "https://glygen.org/publication/PubMed/19117940" } ] }, { "title": "CD74 in antigen presentation, inflammation, and cancers of the gastrointestinal tract.", "journal": "World J. Gastroenterol.", "date": "2009", "authors": "Beswick Ellen J, Reyes Victor E", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "reference": [ { "type": "PubMed", "id": "19533806", "url": "https://glygen.org/publication/PubMed/19533806" } ] }, { "title": "Formation of a nine-subunit complex by HLA class II glycoproteins and the invariant chain.", "journal": "Nature", "date": "1991", "authors": "Roche PA, Marks MS, Cresswell P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "1956401", "url": "https://glygen.org/publication/PubMed/1956401" } ] }, { "title": "Cholesterol sensor ORP1L contacts the ER protein VAP to control Rab7-RILP-p150 Glued and late endosome positioning.", "journal": "The Journal of cell biology", "date": "2009", "authors": "Rocha N, Kuijl C, van der Kant R, Janssen L, Houben D, Janssen H, Zwart W, Neefjes J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "19564404", "url": "https://glygen.org/publication/PubMed/19564404" } ] }, { "title": "Neutralization of IFNgamma defeats haemophagocytosis in LCMV-infected perforin- and Rab27a-deficient mice.", "journal": "EMBO molecular medicine", "date": "2009", "authors": "Pachlopnik Schmid J, Ho CH, Chretien F, Lefebvre JM, Pivert G, Kosco-Vilbois M, Ferlin W, Geissmann F, Fischer A, de Saint Basile G", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "20049711", "url": "https://glygen.org/publication/PubMed/20049711" } ] }, { "title": "Preclinical characterization of the selective JAK1/2 inhibitor INCB018424: therapeutic implications for the treatment of myeloproliferative neoplasms.", "journal": "Blood", "date": "2010", "authors": "Quintas-Cardama A, Vaddi K, Liu P, Manshouri T, Li J, Scherle PA, Caulder E, Wen X, Li Y, Waeltz P, Rupar M, Burn T, Lo Y, Kelley J, Covington M, Shepard S, Rodgers JD, Haley P, Kantarjian H, Fridman JS, Verstovsek S", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "20130243", "url": "https://glygen.org/publication/PubMed/20130243" } ] }, { "title": "Tyrosines 868, 966, and 972 in the kinase domain of JAK2 are autophosphorylated and required for maximal JAK2 kinase activity.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2010", "authors": "Argetsinger LS, Stuckey JA, Robertson SA, Koleva RI, Cline JM, Marto JA, Myers MG Jr, Carter-Su C", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "20304997", "url": "https://glygen.org/publication/PubMed/20304997" } ] }, { "title": "CD45-Csk phosphatase-kinase titration uncouples basal and inducible T cell receptor signaling during thymic development.", "journal": "Immunity", "date": "2010", "authors": "Zikherman J, Jenne C, Watson S, Doan K, Raschke W, Goodnow CC, Weiss A", "evidence": [ { "database": "Reactome", "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427" } ], "reference": [ { "type": "PubMed", "id": "20346773", "url": "https://glygen.org/publication/PubMed/20346773" } ] }, { "title": "Selective inhibition of JAK1 and JAK2 is efficacious in rodent models of arthritis: preclinical characterization of INCB028050.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2010", "authors": "Fridman JS, Scherle PA, Collins R, Burn TC, Li Y, Li J, Covington MB, Thomas B, Collier P, Favata MF, Wen X, Shi J, McGee R, Haley PJ, Shepard S, Rodgers JD, Yeleswaram S, Hollis G, Newton RC, Metcalf B, Friedman SM, Vaddi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "20363976", "url": "https://glygen.org/publication/PubMed/20363976" } ] }, { "title": "Invariant chain increases the half-life of MHC II by delaying endosomal maturation.", "journal": "Immunology and cell biology", "date": "2011", "authors": "Landsverk OJ, Barois N, Gregers TF, Bakke O", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "21116285", "url": "https://glygen.org/publication/PubMed/21116285" } ] }, { "title": "Clinical development of mAbs to block the PD1 pathway as an immunotherapy for cancer.", "journal": "Current opinion in investigational drugs (London, England : 2000)", "date": "2010", "authors": "Kline J, Gajewski TF", "evidence": [ { "database": "Reactome", "id": "R-HSA-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948" } ], "reference": [ { "type": "PubMed", "id": "21154117", "url": "https://glygen.org/publication/PubMed/21154117" } ] }, { "title": "MHC class II-associated invariant chain contains a sorting signal for endosomal compartments.", "journal": "Cell", "date": "1990", "authors": "Bakke O, Dobberstein B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "2121367", "url": "https://glygen.org/publication/PubMed/2121367" } ] }, { "title": "MHC class II engagement by its ligand LAG-3 (CD223) contributes to melanoma resistance to apoptosis.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2011", "authors": "Hemon P, Jean-Louis F, Ramgolam K, Brignone C, Viguier M, Bachelez H, Triebel F, Charron D, Aoudjit F, Al-Daccak R, Michel L", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "21441454", "url": "https://glygen.org/publication/PubMed/21441454" } ] }, { "title": "Regulation of Src family kinases involved in T cell receptor signaling by protein-tyrosine phosphatase CD148.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Stepanek O, Kalina T, Draber P, Skopcova T, Svojgr K, Angelisova P, Horejsi V, Weiss A, Brdicka T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427" } ], "reference": [ { "type": "PubMed", "id": "21543337", "url": "https://glygen.org/publication/PubMed/21543337" } ] }, { "title": "Invariant chain association with HLA-DR molecules inhibits immunogenic peptide binding.", "journal": "Nature", "date": "1990", "authors": "Roche PA, Cresswell P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "2190094", "url": "https://glygen.org/publication/PubMed/2190094" } ] }, { "title": "LYP inhibits T-cell activation when dissociated from CSK.", "journal": "Nature chemical biology", "date": "2012", "authors": "Vang T, Liu WH, Delacroix L, Wu S, Vasile S, Dahl R, Yang L, Musumeci L, Francis D, Landskron J, Tasken K, Tremblay ML, Lie BA, Page R, Mustelin T, Rahmouni S, Rickert RC, Tautz L", "evidence": [ { "database": "Reactome", "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427" } ], "reference": [ { "type": "PubMed", "id": "22426112", "url": "https://glygen.org/publication/PubMed/22426112" } ] }, { "title": "Discovery of potent and selective pyrazolopyrimidine janus kinase 2 inhibitors.", "journal": "Journal of medicinal chemistry", "date": "2012", "authors": "Hanan EJ, van Abbema A, Barrett K, Blair WS, Blaney J, Chang C, Eigenbrot C, Flynn S, Gibbons P, Hurley CA, Kenny JR, Kulagowski J, Lee L, Magnuson SR, Morris C, Murray J, Pastor RM, Rawson T, Siu M, Ultsch M, Zhou A, Sampath D, Lyssikatos JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "23061660", "url": "https://glygen.org/publication/PubMed/23061660" } ] }, { "title": "Beyond the standard of care: a review of novel immunotherapy trials for the treatment of lung cancer.", "journal": "Cancer control : journal of the Moffitt Cancer Center", "date": "2013", "authors": "Hall RD, Gray JE, Chiappori AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948" } ], "reference": [ { "type": "PubMed", "id": "23302904", "url": "https://glygen.org/publication/PubMed/23302904" } ] }, { "title": "The large ectodomains of CD45 and CD148 regulate their segregation from and inhibition of ligated T-cell receptor.", "journal": "Blood", "date": "2013", "authors": "Cordoba SP, Choudhuri K, Zhang H, Bridge M, Basat AB, Dustin ML, van der Merwe PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427" } ], "reference": [ { "type": "PubMed", "id": "23580664", "url": "https://glygen.org/publication/PubMed/23580664" } ] }, { "title": "Invariant chain trimers are sequestered in the rough endoplasmic reticulum in the absence of association with HLA class II antigens.", "journal": "The Journal of cell biology", "date": "1990", "authors": "Marks MS, Blum JS, Cresswell P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "2391366", "url": "https://glygen.org/publication/PubMed/2391366" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "Discovery and development of Janus kinase (JAK) inhibitors for inflammatory diseases.", "journal": "Journal of medicinal chemistry", "date": "2014", "authors": "Clark JD, Flanagan ME, Telliez JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "24417533", "url": "https://glygen.org/publication/PubMed/24417533" } ] }, { "title": "Expression of CD45 alters phosphorylation of the lck-encoded tyrosine protein kinase in murine lymphoma T-cell lines.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Ostergaard HL, Shackelford DA, Hurley TR, Johnson P, Hyman R, Sefton BM, Trowbridge IS", "evidence": [ { "database": "Reactome", "id": "R-HSA-202427", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427" } ], "reference": [ { "type": "PubMed", "id": "2530588", "url": "https://glygen.org/publication/PubMed/2530588" } ] }, { "title": "Anti-LGI1 encephalitis is strongly associated with HLA-DR7 and HLA-DRB4.", "journal": "Annals of neurology", "date": "2017", "authors": "van Sonderen A, Roelen DL, Stoop JA, Verdijk RM, Haasnoot GW, Thijs RD, Wirtz PW, Schreurs MW, Claas FH, Sillevis Smitt PA, Titulaer MJ", "evidence": [ { "database": "RefSeq", "id": "NP_068818", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_068818" } ], "reference": [ { "type": "PubMed", "id": "28026046", "url": "https://glygen.org/publication/PubMed/28026046" } ] }, { "title": "An unexpected N-terminal loop in PD-1 dominates binding by nivolumab.", "journal": "Nature communications", "date": "2017", "authors": "Tan S, Zhang H, Chai Y, Song H, Tong Z, Wang Q, Qi J, Wong G, Zhu X, Liu WJ, Gao S, Wang Z, Shi Y, Yang F, Gao GF, Yan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948" } ], "reference": [ { "type": "PubMed", "id": "28165004", "url": "https://glygen.org/publication/PubMed/28165004" } ] }, { "title": "Characterization of the Anti-PD-1 Antibody REGN2810 and Its Antitumor Activity in Human PD-1 Knock-In Mice.", "journal": "Molecular cancer therapeutics", "date": "2017", "authors": "Burova E, Hermann A, Waite J, Potocky T, Lai V, Hong S, Liu M, Allbritton O, Woodruff A, Wu Q, D'Orvilliers A, Garnova E, Rafique A, Poueymirou W, Martin J, Huang T, Skokos D, Kantrowitz J, Popke J, Mohrs M, MacDonald D, Ioffe E, Olson W, Lowy I, Murphy A, Thurston G", "evidence": [ { "database": "Reactome", "id": "R-HSA-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948" } ], "reference": [ { "type": "PubMed", "id": "28265006", "url": "https://glygen.org/publication/PubMed/28265006" } ] }, { "title": "A humanized HLA-DR4 mouse model for autoimmune myocarditis.", "journal": "Journal of molecular and cellular cardiology", "date": "2017", "authors": "Selli ME, Thomas AC, Wraith DC, Newby AC", "evidence": [ { "database": "RefSeq", "id": "NP_068818", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_068818" } ], "reference": [ { "type": "PubMed", "id": "28431892", "url": "https://glygen.org/publication/PubMed/28431892" } ] }, { "title": "PD-1 Blockade with Cemiplimab in Advanced Cutaneous Squamous-Cell Carcinoma.", "journal": "The New England journal of medicine", "date": "2018", "authors": "Migden MR, Rischin D, Schmults CD, Guminski A, Hauschild A, Lewis KD, Chung CH, Hernandez-Aya L, Lim AM, Chang ALS, Rabinowits G, Thai AA, Dunn LA, Hughes BGM, Khushalani NI, Modi B, Schadendorf D, Gao B, Seebach F, Li S, Li J, Mathias M, Booth J, Mohan K, Stankevich E, Babiker HM, Brana I, Gil-Martin M, Homsi J, Johnson ML, Moreno V, Niu J, Owonikoko TK, Papadopoulos KP, Yancopoulos GD, Lowy I, Fury MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948" } ], "reference": [ { "type": "PubMed", "id": "29863979", "url": "https://glygen.org/publication/PubMed/29863979" } ] }, { "title": "Class II genes of the human major histocompatibility complex. Organization and evolutionary relationship of the DR beta genes.", "journal": "J. Biol. Chem.", "date": "1987", "authors": "Andersson G, Larhammar D, Widmark E, Servenius B, Peterson P A, Rask L", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "reference": [ { "type": "PubMed", "id": "3036826", "url": "https://glygen.org/publication/PubMed/3036826" } ] }, { "title": "PD-1/ PD-L1 blockade as a novel treatment for colorectal cancer.", "journal": "Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie", "date": "2019", "authors": "Yaghoubi N, Soltani A, Ghazvini K, Hassanian SM, Hashemy SI", "evidence": [ { "database": "Reactome", "id": "R-HSA-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948" } ], "reference": [ { "type": "PubMed", "id": "30522017", "url": "https://glygen.org/publication/PubMed/30522017" } ] }, { "title": "Sequence and evolution of HLA-DR7- and -DRw53-associated beta-chain genes.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1987", "authors": "Young JA, Wilkinson D, Bodmer WF, Trowsdale J", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "reference": [ { "type": "PubMed", "id": "3110774", "url": "https://glygen.org/publication/PubMed/3110774" } ] }, { "title": "Camrelizumab: First Global Approval.", "journal": "Drugs", "date": "2019", "authors": "Markham A, Keam SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-389948", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948" } ], "reference": [ { "type": "PubMed", "id": "31313098", "url": "https://glygen.org/publication/PubMed/31313098" } ] }, { "title": "HLA-DRB4*01:14 is a null allele, and renamed HLA-DRB4*01:14N.", "journal": "HLA", "date": "2020", "authors": "Fuerst D, Tsamadou C, Gowdavally S, Schrezenmeier H, Mytilineos J", "evidence": [ { "database": "RefSeq", "id": "NP_068818", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_068818" } ], "reference": [ { "type": "PubMed", "id": "31576671", "url": "https://glygen.org/publication/PubMed/31576671" } ] }, { "title": "HLA-DR53 (DRB4 *01) associates with nickel sensitization.", "journal": "Annals of allergy, asthma & immunology : official publication of the American College of Allergy, Asthma, & Immunology", "date": "2020", "authors": "Zhang Y, Anderson KM, Freed BM, Dai S, Pacheco KA", "evidence": [ { "database": "RefSeq", "id": "NP_068818", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_068818" } ], "reference": [ { "type": "PubMed", "id": "32693207", "url": "https://glygen.org/publication/PubMed/32693207" } ] }, { "title": "Splicing factor YBX1 mediates persistence of JAK2-mutated neoplasms.", "journal": "Nature", "date": "2020-12", "authors": "Jayavelu Ashok Kumar, Schn\u00f6der Tina M, Perner Florian, Herzog Carolin, Meiler Arno, Krishnamoorthy Gurumoorthy, Huber Nicolas, Mohr Juliane, Edelmann-Stephan B\u00e4rbel, Austin Rebecca, Brandt Sabine, Palandri Francesca, Schr\u00f6der Nicolas, Isermann Berend, Edlich Frank, Sinha Amit U, Ungelenk Martin, H\u00fcbner Christian A, Zeiser Robert, Rahmig Susann, Waskow Claudia, Coldham Iain, Ernst Thomas, Hochhaus Andreas, Jilg Stefanie, Jost Philipp J, Mullally Ann, Bullinger Lars, Mertens Peter R, Lane Steven W, Mann Matthias, Heidel Florian H", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "33239784", "url": "https://glygen.org/publication/PubMed/33239784" } ] }, { "title": "Evolutionary and genetic implications of sequence variation in two nonallelic HLA-DR beta-chain cDNA sequences.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1987", "authors": "Curtsinger J M, Hilden J M, Cairns J S, Bach F H", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "reference": [ { "type": "PubMed", "id": "3467350", "url": "https://glygen.org/publication/PubMed/3467350" } ] }, { "title": "Contribution of HLA class II genes, DRB4*01:01, DRB1*07:01, and DQB1*03:03:2 to clinical features of Vitiligo disease in Iranian population.", "journal": "Molecular biology reports", "date": "2022", "authors": "Ghaffarnia R, Saffarian Z, Shahbazi M, Zamani M", "evidence": [ { "database": "RefSeq", "id": "NP_068818", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_068818" } ], "reference": [ { "type": "PubMed", "id": "34686989", "url": "https://glygen.org/publication/PubMed/34686989" } ] }, { "title": "Stimulation-dependent I kappa B alpha phosphorylation marks the NF-kappa B inhibitor for degradation via the ubiquitin-proteasome pathway.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Alkalay I, Yaron A, Hatzubai A, Orian A, Ciechanover A, Ben-Neriah Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "7479848", "url": "https://glygen.org/publication/PubMed/7479848" } ] }, { "title": "Self-release of CLIP in peptide loading of HLA-DR molecules.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Kropshofer H, Vogt AB, Stern LJ, Hammerling GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "7481823", "url": "https://glygen.org/publication/PubMed/7481823" } ] }, { "title": "Interferon activation of the transcription factor Stat91 involves dimerization through SH2-phosphotyrosyl peptide interactions.", "journal": "Cell", "date": "1994", "authors": "Shuai K, Horvath CM, Huang LH, Qureshi SA, Cowburn D, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7510216", "url": "https://glygen.org/publication/PubMed/7510216" } ] }, { "title": "Interferon-gamma induces tyrosine phosphorylation of interferon-gamma receptor and regulated association of protein tyrosine kinases, Jak1 and Jak2, with its receptor.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Igarashi K, Garotta G, Ozmen L, Ziemiecki A, Wilks AF, Harpur AG, Larner AC, Finbloom DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7514165", "url": "https://glygen.org/publication/PubMed/7514165" } ] }, { "title": "Cytokine-induced expression of vascular cell adhesion molecule-1 (VCAM-1) by astrocytes and astrocytoma cell lines.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1995", "authors": "Rosenman SJ, Shrikant P, Dubb L, Benveniste EN, Ransohoff RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7530745", "url": "https://glygen.org/publication/PubMed/7530745" } ] }, { "title": "Wiskott-Aldrich syndrome protein physically associates with Nck through Src homology 3 domains.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Rivero-Lezcano OM, Marcilla A, Sameshima JH, Robbins KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "7565724", "url": "https://glygen.org/publication/PubMed/7565724" } ] }, { "title": "Structure-activity relationship of the leucine-based sorting motifs in the cytosolic tail of the major histocompatibility complex-associated invariant chain.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Motta A, Bremnes B, Morelli MA, Frank RW, Saviano G, Bakke O", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "7592972", "url": "https://glygen.org/publication/PubMed/7592972" } ] }, { "title": "The Jak kinases differentially associate with the alpha and beta (accessory factor) chains of the interferon gamma receptor to form a functional receptor unit capable of activating STAT transcription factors.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Sakatsume M, Igarashi K, Winestock KD, Garotta G, Larner AC, Finbloom DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7615558", "url": "https://glygen.org/publication/PubMed/7615558" } ] }, { "title": "Crystal structure of a complex between interferon-gamma and its soluble high-affinity receptor.", "journal": "Nature", "date": "1995", "authors": "Walter MR, Windsor WT, Nagabhushan TL, Lundell DJ, Lunn CA, Zauodny PJ, Narula SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7617032", "url": "https://glygen.org/publication/PubMed/7617032" } ] }, { "title": "A role for acidic residues in di-leucine motif-based targeting to the endocytic pathway.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Pond L, Kuhn LA, Teyton L, Schutze MP, Tainer JA, Jackson MR, Peterson PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "7650016", "url": "https://glygen.org/publication/PubMed/7650016" } ] }, { "title": "Phosphorylation and activation of the DNA binding activity of purified Stat1 by the Janus protein-tyrosine kinases and the epidermal growth factor receptor.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Quelle FW, Thierfelder W, Witthuhn BA, Tang B, Cohen S, Ihle JN", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7657660", "url": "https://glygen.org/publication/PubMed/7657660" } ] }, { "title": "Structural features of the invariant chain fragment CLIP controlling rapid release from HLA-DR molecules and inhibition of peptide binding.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Kropshofer H, Vogt AB, Hammerling GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "7667286", "url": "https://glygen.org/publication/PubMed/7667286" } ] }, { "title": "Interaction between the components of the interferon gamma receptor complex.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Kotenko SV, Izotova LS, Pollack BP, Mariano TM, Donnelly RJ, Muthukumaran G, Cook JR, Garotta G, Silvennoinen O, Ihle JN, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7673114", "url": "https://glygen.org/publication/PubMed/7673114" } ] }, { "title": "A single phosphotyrosine residue of Stat91 required for gene activation by interferon-gamma.", "journal": "Science (New York, N.Y.)", "date": "1993", "authors": "Shuai K, Stark GR, Kerr IM, Darnell JE Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7690989", "url": "https://glygen.org/publication/PubMed/7690989" } ] }, { "title": "Stat recruitment by tyrosine-phosphorylated cytokine receptors: an ordered reversible affinity-driven process.", "journal": "Immunity", "date": "1995", "authors": "Greenlund AC, Morales MO, Viviano BL, Yan H, Krolewski J, Schreiber RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "7796299", "url": "https://glygen.org/publication/PubMed/7796299" } ] }, { "title": "Selective release of some invariant chain-derived peptides from HLA-DR1 molecules at endosomal pH.", "journal": "The Journal of experimental medicine", "date": "1994", "authors": "Urban RG, Chicz RM, Strominger JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "8046351", "url": "https://glygen.org/publication/PubMed/8046351" } ] }, { "title": "Endosomal aspartic proteinases are required for invariant-chain processing.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Maric MA, Taylor MD, Blum JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "8134367", "url": "https://glygen.org/publication/PubMed/8134367" } ] }, { "title": "Crystal structure of the human class II MHC protein HLA-DR1 complexed with an influenza virus peptide.", "journal": "Nature", "date": "1994", "authors": "Stern LJ, Brown JH, Jardetzky TS, Gorga JC, Urban RG, Strominger JL, Wiley DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "8145819", "url": "https://glygen.org/publication/PubMed/8145819" } ] }, { "title": "Class II histocompatibility molecules associate with calnexin during assembly in the endoplasmic reticulum.", "journal": "International immunology", "date": "1994", "authors": "Schreiber KL, Bell MP, Huntoon CJ, Rajagopalan S, Brenner MB, McKean DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "8148318", "url": "https://glygen.org/publication/PubMed/8148318" } ] }, { "title": "Ligand-induced IFN gamma receptor tyrosine phosphorylation couples the receptor to its signal transduction system (p91).", "journal": "The EMBO journal", "date": "1994", "authors": "Greenlund AC, Farrar MA, Viviano BL, Schreiber RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "8156998", "url": "https://glygen.org/publication/PubMed/8156998" } ] }, { "title": "IFN-gamma up-regulates platelet-activating factor receptor gene expression in human monocytes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1994", "authors": "Ouellet S, Muller E, Rola-Pleszczynski M", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "8176225", "url": "https://glygen.org/publication/PubMed/8176225" } ] }, { "title": "A role for calnexin (IP90) in the assembly of class II MHC molecules.", "journal": "The EMBO journal", "date": "1994", "authors": "Anderson KS, Cresswell P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "8313912", "url": "https://glygen.org/publication/PubMed/8313912" } ] }, { "title": "Cell surface HLA-DR-invariant chain complexes are targeted to endosomes by rapid internalization.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Roche PA, Teletski CL, Stang E, Bakke O, Long EO", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "8397411", "url": "https://glygen.org/publication/PubMed/8397411" } ] }, { "title": "The segment of invariant chain that is critical for association with major histocompatibility complex class II molecules contains the sequence of a peptide eluted from class II polypeptides.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Freisewinkel IM, Schenck K, Koch N", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "8415765", "url": "https://glygen.org/publication/PubMed/8415765" } ] }, { "title": "Interferon gamma-induced transcription of the high-affinity Fc receptor for IgG requires assembly of a complex that includes the 91-kDa subunit of transcription factor ISGF3.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Pearse RN, Feinman R, Shuai K, Darnell JE Jr, Ravetch JV", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "8483949", "url": "https://glygen.org/publication/PubMed/8483949" } ] }, { "title": "The Syk/ZAP-70 protein tyrosine kinase connection to antigen receptor signalling processes.", "journal": "Seminars in immunology", "date": "1995", "authors": "van Oers NS, Weiss A", "evidence": [ { "database": "Reactome", "id": "R-HSA-202430", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202430" } ], "reference": [ { "type": "PubMed", "id": "8520027", "url": "https://glygen.org/publication/PubMed/8520027" } ] }, { "title": "Transcriptional regulation of the human intercellular adhesion molecule-1 gene: a short overview.", "journal": "Immunobiology", "date": "1995", "authors": "Stratowa C, Audette M", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "8530158", "url": "https://glygen.org/publication/PubMed/8530158" } ] }, { "title": "Critical role for lysines 21 and 22 in signal-induced, ubiquitin-mediated proteolysis of I kappa B-alpha.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Baldi L, Brown K, Franzoso G, Siebenlist U", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "8550590", "url": "https://glygen.org/publication/PubMed/8550590" } ] }, { "title": "Identification of an interferon-gamma receptor alpha chain sequence required for JAK-1 binding.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Kaplan DH, Greenlund AC, Tanner JW, Shaw AS, Schreiber RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "8550631", "url": "https://glygen.org/publication/PubMed/8550631" } ] }, { "title": "Invariant chain structure and MHC class II function.", "journal": "Cell", "date": "1996", "authors": "Cresswell P", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "reference": [ { "type": "PubMed", "id": "8598037", "url": "https://glygen.org/publication/PubMed/8598037" } ] }, { "title": "Site-specific phosphorylation of IkappaBalpha by a novel ubiquitination-dependent protein kinase activity.", "journal": "Cell", "date": "1996", "authors": "Chen ZJ, Parent L, Maniatis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "8601309", "url": "https://glygen.org/publication/PubMed/8601309" } ] }, { "title": "Kinase-negative mutants of JAK1 can sustain interferon-gamma-inducible gene expression but not an antiviral state.", "journal": "The EMBO journal", "date": "1996", "authors": "Briscoe J, Rogers NC, Witthuhn BA, Watling D, Harpur AG, Wilks AF, Stark GR, Ihle JN, Kerr IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "8631301", "url": "https://glygen.org/publication/PubMed/8631301" } ] }, { "title": "B lymphocytes secrete antigen-presenting vesicles.", "journal": "The Journal of experimental medicine", "date": "1996", "authors": "Raposo G, Nijman HW, Stoorvogel W, Liejendekker R, Harding CV, Melief CJ, Geuze HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "8642258", "url": "https://glygen.org/publication/PubMed/8642258" } ] }, { "title": "Potential sites for processing of the human invariant chain by cathepsins D and E.", "journal": "Biochemical and biophysical research communications", "date": "1996", "authors": "Kageyama T, Yonezawa S, Ichinose M, Miki K, Moriyama A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "8687433", "url": "https://glygen.org/publication/PubMed/8687433" } ] }, { "title": "The adaptor protein Nck links receptor tyrosine kinases with the serine-threonine kinase Pak1.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Galisteo ML, Chernoff J, Su YC, Skolnik EY, Schlessinger J", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "8798379", "url": "https://glygen.org/publication/PubMed/8798379" } ] }, { "title": "Interaction of the Nck adapter protein with p21-activated kinase (PAK1).", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Bokoch GM, Wang Y, Bohl BP, Sells MA, Quilliam LA, Knaus UG", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "8824201", "url": "https://glygen.org/publication/PubMed/8824201" } ] }, { "title": "Enhanced dissociation of HLA-DR-bound peptides in the presence of HLA-DM.", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Weber DA, Evavold BD, Jensen PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "8849454", "url": "https://glygen.org/publication/PubMed/8849454" } ] }, { "title": "Direct vesicular transport of MHC class II molecules from lysosomal structures to the cell surface.", "journal": "The Journal of cell biology", "date": "1996", "authors": "Wubbolts R, Fernandez-Borja M, Oomen L, Verwoerd D, Janssen H, Calafat J, Tulp A, Dusseljee S, Neefjes J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "8909537", "url": "https://glygen.org/publication/PubMed/8909537" } ] }, { "title": "Expression of major histocompatibility complex class II molecules in HeLa cells promotes the recruitment of AP-1 Golgi-specific assembly proteins on Golgi membranes.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Salamero J, Le Borgne R, Saudrais C, Goud B, Hoflack B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "8939989", "url": "https://glygen.org/publication/PubMed/8939989" } ] }, { "title": "Editing of the HLA-DR-peptide repertoire by HLA-DM.", "journal": "The EMBO journal", "date": "1996", "authors": "Kropshofer H, Vogt AB, Moldenhauer G, Hammer J, Blum JS, Hammerling GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "8947036", "url": "https://glygen.org/publication/PubMed/8947036" } ] }, { "title": "HLA-DM acts as a molecular chaperone and rescues empty HLA-DR molecules at lysosomal pH.", "journal": "Immunity", "date": "1997", "authors": "Kropshofer H, Arndt SO, Moldenhauer G, Hammerling GJ, Vogt AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "9075930", "url": "https://glygen.org/publication/PubMed/9075930" } ] }, { "title": "Activation of Jak2 catalytic activity requires phosphorylation of Y1007 in the kinase activation loop.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Feng J, Witthuhn BA, Matsuda T, Kohlhuber F, Kerr IM, Ihle JN", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "9111318", "url": "https://glygen.org/publication/PubMed/9111318" } ] }, { "title": "Molecular cloning of SLAP-130, an SLP-76-associated substrate of the T cell antigen receptor-stimulated protein tyrosine kinases.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Musci MA, Hendricks-Taylor LR, Motto DG, Paskind M, Kamens J, Turck CW, Koretzky GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "9115214", "url": "https://glygen.org/publication/PubMed/9115214" } ] }, { "title": "Cellular responses to interferon-gamma.", "journal": "Annual review of immunology", "date": "1997", "authors": "Boehm U, Klamp T, Groot M, Howard JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-877300", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300" } ], "reference": [ { "type": "PubMed", "id": "9143706", "url": "https://glygen.org/publication/PubMed/9143706" } ] }, { "title": "Decreased endosomal delivery of major histocompatibility complex class II-invariant chain complexes in dynamin-deficient cells.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Wang K, Peterson PA, Karlsson L", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "9202021", "url": "https://glygen.org/publication/PubMed/9202021" } ] }, { "title": "Identification of a new DRB4 allele (DRB4*0105) by sequence-based typing.", "journal": "Tissue Antigens", "date": "1997", "authors": "Voorter C E, Emonds M P, van den Berg-Loonen E M", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "reference": [ { "type": "PubMed", "id": "9234493", "url": "https://glygen.org/publication/PubMed/9234493" } ] }, { "title": "A cytokine-responsive IkappaB kinase that activates the transcription factor NF-kappaB.", "journal": "Nature", "date": "1997", "authors": "DiDonato JA, Hayakawa M, Rothwarf DM, Zandi E, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "9252186", "url": "https://glygen.org/publication/PubMed/9252186" } ] }, { "title": "Negative regulation by HLA-DO of MHC class II-restricted antigen processing.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Denzin LK, Sant'Angelo DB, Hammond C, Surman MJ, Cresswell P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "9311912", "url": "https://glygen.org/publication/PubMed/9311912" } ] }, { "title": "Interaction of MHC class II molecules with the invariant chain: role of the invariant chain (81-90) region.", "journal": "The EMBO journal", "date": "1997", "authors": "Stumptner P, Benaroch P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "9312039", "url": "https://glygen.org/publication/PubMed/9312039" } ] }, { "title": "The carboxy-terminus of I kappaB alpha determines susceptibility to degradation by the catalytic core of the proteasome.", "journal": "Oncogene", "date": "1997", "authors": "Kroll M, Conconi M, Desterro MJ, Marin A, Thomas D, Friguet B, Hay RT, Virelizier JL, Arenzana-Seisdedos F, Rodriguez MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "9362451", "url": "https://glygen.org/publication/PubMed/9362451" } ] }, { "title": "Medium chains of adaptor complexes AP-1 and AP-2 recognize leucine-based sorting signals from the invariant chain.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Rodionov DG, Bakke O", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "9497313", "url": "https://glygen.org/publication/PubMed/9497313" } ] }, { "title": "Cathepsins B and D are dispensable for major histocompatibility complex class II-mediated antigen presentation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Deussing J, Roth W, Saftig P, Peters C, Ploegh HL, Villadangos JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "9539769", "url": "https://glygen.org/publication/PubMed/9539769" } ] }, { "title": "Cathepsin L: critical role in Ii degradation and CD4 T cell selection in the thymus.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Nakagawa T, Roth W, Wong P, Nelson A, Farr A, Deussing J, Villadangos JA, Ploegh H, Peters C, Rudensky AY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "9545226", "url": "https://glygen.org/publication/PubMed/9545226" } ] }, { "title": "A role for HLA-DO as a co-chaperone of HLA-DM in peptide loading of MHC class II molecules.", "journal": "The EMBO journal", "date": "1998", "authors": "Kropshofer H, Vogt AB, Thery C, Armandola EA, Li BC, Moldenhauer G, Amigorena S, Hammerling GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2132295", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295" } ], "reference": [ { "type": "PubMed", "id": "9606180", "url": "https://glygen.org/publication/PubMed/9606180" } ] }, { "title": "T cell receptor (TCR) interacting molecule (TRIM), a novel disulfide-linked dimer associated with the TCR-CD3-zeta complex, recruits intracellular signaling proteins to the plasma membrane.", "journal": "The Journal of experimental medicine", "date": "1998", "authors": "Bruyns E, Marie-Cardine A, Kirchgessner H, Sagolla K, Shevchenko A, Mann M, Autschbach F, Bensussan A, Meuer S, Schraven B", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "9687533", "url": "https://glygen.org/publication/PubMed/9687533" } ] }, { "title": "Regulation of PAK activation and the T cell cytoskeleton by the linker protein SLP-76.", "journal": "Immunity", "date": "1998", "authors": "Bubeck Wardenburg J, Pappu R, Bu JY, Mayer B, Chernoff J, Straus D, Chan AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-202433", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433" } ], "reference": [ { "type": "PubMed", "id": "9846482", "url": "https://glygen.org/publication/PubMed/9846482" } ] }, { "title": "The Syk family of protein tyrosine kinases in T-cell activation and development.", "journal": "Immunological reviews", "date": "1998", "authors": "Chu DH, Morita CT, Weiss A", "evidence": [ { "database": "Reactome", "id": "R-HSA-202430", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202430" } ], "reference": [ { "type": "PubMed", "id": "9850860", "url": "https://glygen.org/publication/PubMed/9850860" } ] }, { "title": "Signal-induced ubiquitination of IkappaBalpha by the F-box protein Slimb/beta-TrCP.", "journal": "Genes & development", "date": "1999", "authors": "Spencer E, Jiang J, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202424", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424" } ], "reference": [ { "type": "PubMed", "id": "9990853", "url": "https://glygen.org/publication/PubMed/9990853" } ] } ], "pathway": [ { "id": "hsa:3126", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3126", "resource": "KEGG Pathway" }, { "id": "R-HSA-202424", "name": "Downstream TCR signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424", "resource": "Reactome", "description": "Downstream TCR signaling" }, { "id": "R-HSA-202427", "name": "Phosphorylation of CD3 and TCR zeta chains", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202427", "resource": "Reactome", "description": "Phosphorylation of CD3 and TCR zeta chains" }, { "id": "R-HSA-202430", "name": "Translocation of ZAP-70 to Immunological synapse", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202430", "resource": "Reactome", "description": "Translocation of ZAP-70 to Immunological synapse" }, { "id": "R-HSA-202433", "name": "Generation of second messenger molecules", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202433", "resource": "Reactome", "description": "Generation of second messenger molecules" }, { "id": "R-HSA-2132295", "name": "MHC class II antigen presentation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2132295", "resource": "Reactome", "description": "MHC class II antigen presentation" }, { "id": "R-HSA-389948", "name": "PD-1 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389948", "resource": "Reactome", "description": "PD-1 signaling" }, { "id": "R-HSA-877300", "name": "Interferon gamma signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-877300", "resource": "Reactome", "description": "Interferon gamma signaling" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A023IKK2-1", "protein_name": "MHC class II beta chain", "gene_name": "RT1-Db2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MVCLWLPRDPCVAAVVLSLLMLSPPVALVRDPRPRFLEQLKAECHYVKGREHVWSVTRFIYNQEEFARFDSVFGKFLAVTELGRPIAEYLNTQKDMLDNYRASVDRCRNNYDLVDIFMSNLKAKPKVTVYPSKTQPLEYHNLLVCSVSDFYPGTIEIRWFRNGEEEKTGVVSTDLISNGDWTYQTLVMLETVPQGGEVYTCQVEHPSLTSPVRVEWRARSTSAQNKMLSGAMGMALGLFILAVGLFIYLRNLRAGSVSHGAGEGAESSTSRLTGSRSECHTGPALSV", "length": 287 }, "evidence": [ { "id": "45916737", "url": "http://www.informatics.jax.org/homology/45916737", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P01911-1", "protein_name": "HLA class II histocompatibility antigen, DRB1 beta chain", "gene_name": "HLA-DRB1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS", "length": 266 }, "evidence": [ { "id": "45916737", "url": "http://www.informatics.jax.org/homology/45916737", "database": "MGI" }, { "id": "45916738", "url": "http://www.informatics.jax.org/homology/45916738", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P04230-1", "protein_name": "H-2 class II histocompatibility antigen, E-B beta chain", "gene_name": "H2-Eb1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MVWLPRVPCVAAVILLLTVLSPPMALVRDSRPWFLEYCKSECHFYNGTQRVRLLERYFYNLEENLRFDSDVGEFHAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEISDKFLVRRRVEPTVTVYPTKTQPLEHHNLLVCSVSDFYPGNIEVRWFRNGKEEKTGIVSTGLVRNGDWTFQTLVMLETVPQSGEVYTCQVEHPSLTDPVTVEWKAQSTSAQNKMLSGVGGFVLGLLFLGAGLFIYFRNQKGQSGLQPTGLLS", "length": 264 }, "evidence": [ { "id": "45916738", "url": "http://www.informatics.jax.org/homology/45916738", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P18211-1", "protein_name": "Rano class II histocompatibility antigen, D-1 beta chain", "gene_name": "RT1-Db1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MVWLARDSCVAAVILLLTVLSPPVALVRDPTPRFLEQVKGECHFYNGTQRVRFLARYIYNREEYTRFDSDVGEFRAVTELGRPSAEYYNKQKEYMEQLRATVDTACKHDYEISESFLVPRTVEPKVTVYPSKTQPLEHHNLLVCSVSDFYPGSVEVRWFRNGEEEKDGLVSTGLIRNGDWTFQLLVMLETVPQGGEVYTCQVEHPSLPSPVRVEWKAQSTSAQNKKMSGVGGIVLGLLFLGAGLFVYFRNQKGQSGLQPTGLLN", "length": 264 }, "evidence": [ { "id": "45916738", "url": "http://www.informatics.jax.org/homology/45916738", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P79483-1", "protein_name": "HLA class II histocompatibility antigen, DR beta 3 chain", "gene_name": "HLA-DRB3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS", "length": 266 }, "evidence": [ { "id": "45916737", "url": "http://www.informatics.jax.org/homology/45916737", "database": "MGI" }, { "id": "45916738", "url": "http://www.informatics.jax.org/homology/45916738", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q30154-1", "protein_name": "HLA class II histocompatibility antigen, DR beta 5 chain", "gene_name": "HLA-DRB5", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MVCLKLPGGSYMAKLTVTLMVLSSPLALAGDTRPRFLQQDKYECHFFNGTERVRFLHRDIYNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPARTQTLQHHNLLVCSVNGFYPGSIEVRWFRNSQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYFKNQKGHSGLHPTGLVS", "length": 266 }, "evidence": [ { "id": "45916737", "url": "http://www.informatics.jax.org/homology/45916737", "database": "MGI" }, { "id": "45916738", "url": "http://www.informatics.jax.org/homology/45916738", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q3UUV9-1", "protein_name": "Histocompatibility 2, class II antigen E beta2", "gene_name": "H2-Eb2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MVSLWLPRGLCVAAVILSLMMLTPPVILVRDPRPRFLEQLKAECHYFNGKERVWSVTRFIYNQEEFARFNSDFGKFLAVTELGRPIVEYLNTQKDMLDNYRASVDRCRNNYDLVDIFMLNLKAEPKVTVYPAKTQPLEHHNLLVCSVIDFYPGSIEVRWFRNGEEEKTGVVSTGLIQNRDWTYQTLVMLEMVPRGGEVYTCQVEHPSLTSPVTVEWRARSTSAQNKLLSGVMGMALGLFILAVGLFFYLRNLRAGSVSHGAGEGAESFTSRLTGSGSECHMGPGLSI", "length": 287 }, "evidence": [ { "id": "45916737", "url": "http://www.informatics.jax.org/homology/45916737", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 12, "go_terms": [ { "name": "lysosomal membrane", "id": "GO:0005765", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005765", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "pmid": "" }, { "name": "MHC class II protein complex", "id": "GO:0042613", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042613", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "pmid": "" }, { "name": "endosome membrane", "id": "GO:0010008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010008", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "pmid": "" }, { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "pmid": "" }, { "name": "trans-Golgi network membrane", "id": "GO:0032588", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032588", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "pmid": "" }, { "name": "transport vesicle membrane", "id": "GO:0030658", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030658", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "pmid": "" }, { "name": "endocytic vesicle membrane", "id": "GO:0030666", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030666", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "pmid": "" }, { "name": "clathrin-coated endocytic vesicle membrane", "id": "GO:0030669", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030669", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "pmid": "" }, { "name": "late endosome membrane", "id": "GO:0031902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031902", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "pmid": "" }, { "name": "ER to Golgi transport vesicle membrane", "id": "GO:0012507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0012507", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "pmid": "" }, { "name": "lumenal side of endoplasmic reticulum membrane", "id": "GO:0098553", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098553", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "adaptive immune response", "id": "GO:0002250", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002250", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "pmid": "" }, { "name": "antigen processing and presentation of peptide or polysaccharide antigen via MHC class II", "id": "GO:0002504", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002504", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "pmid": "" }, { "name": "antigen processing and presentation of exogenous peptide antigen via MHC class II", "id": "GO:0019886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019886", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "pmid": "" }, { "name": "peptide antigen assembly with MHC class II protein complex", "id": "GO:0002503", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002503", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "pmid": "" }, { "name": "positive regulation of T cell activation", "id": "GO:0050870", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050870", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "pmid": "" }, { "name": "positive regulation of immune response", "id": "GO:0050778", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050778", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "MHC class II protein complex binding", "id": "GO:0023026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0023026", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "pmid": "" }, { "name": "peptide antigen binding", "id": "GO:0042605", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042605", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 48, "end_pos": 50, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Ubiquitinated by MARCH1 and MARCH8 at Lys-254 leading to sorting into the endosome system and down-regulation of MHC class II. When associated with ubiquitination of the alpha subunit of HLA-DR: HLA-DRA 'Lys-244', the down-regulation of MHC class II may be highly effective.", "evidence": [ { "database": "UniProtKB", "id": "P13762", "url": "https://www.uniprot.org/uniprot/P13762" }, { "database": "PubMed", "id": "18305173", "url": "https://glygen.org/publication/PubMed/18305173" }, { "database": "PubMed", "id": "19117940", "url": "https://glygen.org/publication/PubMed/19117940" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 48 ], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 48, "end_pos": 50 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 198 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }