{ "uniprot_canonical_ac": "P13723-1", "uniprot_ac": "P13723", "uniprot_id": "HEXA1_DICDI", "mass": { "chemical_mass": 59788.0, "monoisotopic_mass": 59788.0 }, "refseq": { "ac": "XP_637398", "name": "glycoside hydrolase family 20 protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_637398" }, "gene_names": [ { "name": "hexa1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P13723", "id": "P13723" }, { "name": "DDB_G0287033", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P13723", "id": "P13723" }, { "name": "nagA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_637398", "id": "XP_637398" }, { "name": "nagA", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P13723", "id": "P13723" } ], "protein_names": [ { "name": "Beta-hexosaminidase subunit A1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P13723" }, { "name": "3.2.1.52", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13723" }, { "name": "Beta-N-acetylhexosaminidase subunit A1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13723" }, { "name": "N-acetyl-beta-glucosaminidase subunit A1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13723" }, { "name": "glycoside hydrolase family 20 protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_637398", "id": "XP_637398" } ], "function": [ { "annotation": "Responsible for the degradation of GM2 gangliosides, and a variety of other molecules containing terminal N-acetyl hexosamines. This enzyme plays a role during the slug stage of development in the maintenance of pseudoplasmodia of normal size.", "evidence": [ { "database": "UniProtKB", "id": "P13723", "url": "https://www.uniprot.org/uniprot/P13723#function" }, { "database": "PubMed", "id": "2972716", "url": "https://glygen.org/publication/PubMed/2972716" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "P13723", "url": "https://www.uniprot.org/uniprot/P13723" } ], "common_name": "Cellular slime molds" } ], "gene": [ { "name": "hexa1", "url": "https://www.uniprot.org/uniprot/P13723", "locus": {} } ], "crossref": [ { "id": "GH20", "url": "http://www.cazy.org/GH20.html", "database": "CAZy", "categories": [ "Protein Classification" ] }, { "id": "cd06562", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd06562", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "DDB_G0287033", "url": "http://dictybase.org/gene/DDB_G0287033", "database": "dictyBase", "categories": [ "Organism-specific" ] }, { "id": "8625929", "url": "https://www.ncbi.nlm.nih.gov/gene/8625929", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR015883", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015883", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017853", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017853", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR025705", "url": "https://www.ebi.ac.uk/interpro/entry/IPR025705", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029018", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029018", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029019", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029019", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0287033", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0287033", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "KMWPRAA", "url": "https://omabrowser.org/oma/group/KMWPRAA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR22600", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22600", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR22600:SF54", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22600:SF54", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00728", "url": "http://pfam.xfam.org/family/PF00728", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF14845", "url": "http://pfam.xfam.org/family/PF14845", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P13723", "url": "http://purl.obolibrary.org/obo/PR_P13723", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-DDI-2022857", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2022857", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-2024101", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2024101", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-2160916", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2160916", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-9840310", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_637398", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_637398", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P13723", "url": "https://www.uniprot.org/uniprot/P13723", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13723-1", "url": "https://www.uniprot.org/uniprot/P13723-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MIKKIILFFAVLIAIVIGQQPLNVVPYPQQVSIGTCVIPVAPGSILIESNIESATFSVSMDRYTNLFFPFSNESEPSSNESFLLSVTIYSDDETLQLGIDESYSLSIEQGSYQLKATNIYGAMRGLETFKQLIVYNELENSYSIVCVSISDSPRYPWRGFMVDSARHYIPKNMILHMIDSLGFSKFNTLHWHMVDAVAFPVESTTYPDLTKGAFSPSATFSHDDIQEVVAYAKTYGIRVIPEFDIPGHAAAWGIGYPELVATCPDYAANVNNIPLDISNPATFTFIQNLFTEIAPLFIDNYFHTGGDELVTGCWLEDPAIANWMTKMGFSTTDAFQYFENNLDVTMKSINRTKITWNDPIDYGVQLNPETLVQVWSSGSDLQGIVNSGYKALVSFAWYLDKQNPDNNIHYEWQDTWQDFYAADPTNNISTNAENIIGGEATMWAEQINQVNWDVRVWPRAIGIAERLWSAQSVNSVSLALPRIGHFTCDLSRRGIQSGPLFPDYCPMQDDLVFTMKPNTKLSKSEIKLILNK", "length": 532, "header": "sp|P13723-1|HEXA1_DICDI Isoform 1 of Beta-hexosaminidase subunit A1 OS=Dictyostelium discoideum OX=44689 GN=hexa1 PE=1 SV=1 CANONICAL=P13723-1" }, "isoforms": [ { "isoform_ac": "P13723-1", "url": "", "sequence": { "sequence": "MIKKIILFFAVLIAIVIGQQPLNVVPYPQQVSIGTCVIPVAPGSILIESNIESATFSVSMDRYTNLFFPFSNESEPSSNESFLLSVTIYSDDETLQLGIDESYSLSIEQGSYQLKATNIYGAMRGLETFKQLIVYNELENSYSIVCVSISDSPRYPWRGFMVDSARHYIPKNMILHMIDSLGFSKFNTLHWHMVDAVAFPVESTTYPDLTKGAFSPSATFSHDDIQEVVAYAKTYGIRVIPEFDIPGHAAAWGIGYPELVATCPDYAANVNNIPLDISNPATFTFIQNLFTEIAPLFIDNYFHTGGDELVTGCWLEDPAIANWMTKMGFSTTDAFQYFENNLDVTMKSINRTKITWNDPIDYGVQLNPETLVQVWSSGSDLQGIVNSGYKALVSFAWYLDKQNPDNNIHYEWQDTWQDFYAADPTNNISTNAENIIGGEATMWAEQINQVNWDVRVWPRAIGIAERLWSAQSVNSVSLALPRIGHFTCDLSRRGIQSGPLFPDYCPMQDDLVFTMKPNTKLSKSEIKLILNK", "length": 532, "header": "sp|P13723-1|HEXA1_DICDI Isoform 1 of Beta-hexosaminidase subunit A1 OS=Dictyostelium discoideum OX=44689 GN=hexa1 PE=1 SV=1 CANONICAL=P13723-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 350, "start_aa": "Asn", "end_pos": 350, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn350", "evidence": [ { "id": "P13723", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13723#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 427, "start_aa": "Asn", "end_pos": 427, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn427", "evidence": [ { "id": "P13723", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13723#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "P13723", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13723#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 79, "start_aa": "Asn", "end_pos": 79, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn79", "evidence": [ { "id": "P13723", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13723#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycohydrolase-activity", "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Eichinger L, Pachebat J A, Gl\u00f6ckner G, Rajandream M-A, Sucgang R, Berriman M, Song J, Olsen R, Szafranski K, Xu Q, Tunggal B, Kummerfeld S, Madera M, Konfortov B A, Rivero F, Bankier A T, Lehmann R, Hamlin N, Davies R, Gaudet P, Fey P, Pilcher K, Chen G, Saunders D, Sodergren E, Davis P, Kerhornou A, Nie X, Hall N, Anjard C, Hemphill L, Bason N, Farbrother P, Desany B, Just E, Morio T, Rost R, Churcher C, Cooper J, Haydock S, van Driessche N, Cronin A, Goodhead I, Muzny D, Mourier T, Pain A, Lu M, Harper D, Lindsay R, Hauser H, James K, Quiles M, Madan Babu M, Saito T, Buchrieser C, Wardroper A, Felder M, Thangavelu M, Johnson D, Knights A, Loulseged H, Mungall K, Oliver K, Price C, Quail M A, Urushihara H, Hernandez J, Rabbinowitsch E, Steffen D, Sanders M, Ma J, Kohara Y, Sharp S, Simmonds M, Spiegler S, Tivey A, Sugano S, White B, Walker D, Woodward J, Winckler T, Tanaka Y, Shaulsky G, Schleicher M, Weinstock G, Rosenthal A, Cox E C, Chisholm R L, Gibbs R, Loomis W F, Platzer M, Kay R R, Williams J, Dear P H, Noegel A A, Barrell B, Kuspa A", "evidence": [ { "database": "UniProtKB", "id": "P13723", "url": "https://www.uniprot.org/uniprot/P13723" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] }, { "title": "Molecular cloning of the cDNA which encodes beta-N-acetylhexosaminidase A from Dictyostelium discoideum. Complete amino acid sequence and homology with the human enzyme.", "journal": "The Journal of biological chemistry", "date": "1988-11-15", "authors": "Graham T R, Zassenhaus H P, Kaplan A", "evidence": [ { "database": "UniProtKB", "id": "P13723", "url": "https://www.uniprot.org/uniprot/P13723" } ], "reference": [ { "type": "PubMed", "id": "2972716", "url": "https://glygen.org/publication/PubMed/2972716" } ] }, { "title": "Genetic analysis of the gene for N-acetylglucosaminidase in Dictyostelium discoideum.", "journal": "Genetics", "date": "1978", "authors": "Loomis W F", "evidence": [ { "database": "UniProtKB", "id": "P13723", "url": "https://www.uniprot.org/uniprot/P13723" } ], "reference": [ { "type": "PubMed", "id": "640375", "url": "https://glygen.org/publication/PubMed/640375" } ] } ], "pathway": [ { "id": "ddi:DDB_G0287033", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0287033", "resource": "KEGG Pathway" }, { "id": "R-DDI-2022857", "name": "Keratan sulfate degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2022857", "resource": "Reactome", "description": "Keratan sulfate degradation" }, { "id": "R-DDI-2024101", "name": "CS/DS degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2024101", "resource": "Reactome", "description": "CS/DS degradation" }, { "id": "R-DDI-2160916", "name": "Hyaluronan uptake and degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2160916", "resource": "Reactome", "description": "Hyaluronan uptake and degradation" }, { "id": "R-DDI-9840310", "name": "Glycosphingolipid catabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-9840310", "resource": "Reactome", "description": "Glycosphingolipid catabolism" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P13723", "url": "https://www.uniprot.org/uniprot/P13723" } ], "pmid": "" }, { "name": "lysosome", "id": "GO:0005764", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005764", "evidence": [ { "database": "UniProtKB", "id": "P13723", "url": "https://www.uniprot.org/uniprot/P13723" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "carbohydrate metabolic process", "id": "GO:0005975", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005975", "evidence": [ { "database": "UniProtKB", "id": "P13723", "url": "https://www.uniprot.org/uniprot/P13723" } ], "pmid": "" }, { "name": "glycosaminoglycan metabolic process", "id": "GO:0030203", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030203", "evidence": [ { "database": "UniProtKB", "id": "P13723", "url": "https://www.uniprot.org/uniprot/P13723" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "N-acetyl-beta-D-galactosaminidase activity", "id": "GO:0102148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0102148", "evidence": [ { "database": "UniProtKB", "id": "P13723", "url": "https://www.uniprot.org/uniprot/P13723" } ], "pmid": "" }, { "name": "beta-N-acetylhexosaminidase activity", "id": "GO:0004563", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004563", "evidence": [ { "database": "UniProtKB", "id": "P13723", "url": "https://www.uniprot.org/uniprot/P13723" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 350, "end_pos": 352, "annotation": "n_glycosylation_sequon" }, { "start_pos": 427, "end_pos": 429, "annotation": "n_glycosylation_sequon" }, { "start_pos": 72, "end_pos": 74, "annotation": "n_glycosylation_sequon" }, { "start_pos": 79, "end_pos": 81, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "N-glycosylated.", "evidence": [ { "database": "UniProtKB", "id": "P13723", "url": "https://www.uniprot.org/uniprot/P13723" }, { "database": "PubMed", "id": "2972716", "url": "https://glygen.org/publication/PubMed/2972716" } ] } ], "interactions": [], "reactions": [ { "id": "R-DDI-1605632", "name": "bHEXA,bHEXB hydrolyze PSAP(195-273):Gb4Cer:PE", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "lysosomal lumen", "input_participant_list": [], "output_participant_list": [ "R-ALL-1605658" ], "enzyme_list": [ "Q54MU9-1", "Q54K55-1", "Q54K56-1", "Q54SC9-1", "P13723-1" ], "evidence": [ { "id": "R-DDI-1605632", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-1605632" } ] }, { "id": "R-DDI-1638053", "name": "HEXA cleaves the terminal GalNAc from keratan sulfate", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "lysosomal lumen", "input_participant_list": [ "R-ALL-2105012" ], "output_participant_list": [ "R-ALL-2105010" ], "enzyme_list": [ "Q54MU9-1", "Q54K55-1", "Q54K56-1", "Q54SC9-1", "P13723-1" ], "evidence": [ { "id": "R-DDI-1638053", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-1638053" } ] }, { "id": "R-DDI-2105001", "name": "HEXA cleaves the terminal GalNAc from DS", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "lysosomal lumen", "input_participant_list": [ "R-ALL-2065269" ], "output_participant_list": [ "R-ALL-2105025" ], "enzyme_list": [ "Q54MU9-1", "Q54K55-1", "Q54K56-1", "Q54SC9-1", "P13723-1" ], "evidence": [ { "id": "R-DDI-2105001", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2105001" } ] }, { "id": "R-DDI-2162225", "name": "HEXA cleaves the terminal GalNAc from small HA fragments", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "lysosomal lumen", "input_participant_list": [ "R-ALL-2162223" ], "output_participant_list": [ "R-ALL-1678743", "R-ALL-2162224" ], "enzyme_list": [ "Q54MU9-1", "Q54K55-1", "Q54K56-1", "Q54SC9-1", "P13723-1" ], "evidence": [ { "id": "R-DDI-2162225", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2162225" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-1605658", "participant_name": "GalNAc [lysosomal lumen]", "crossref": [ { "id": "28037", "database": "ChEBI", "url": "" }, { "id": "G27025MB", "database": "GlyTouCan", "url": "" }, { "id": "C01132", "database": "COMPOUND", "url": "" }, { "id": "000003861733", "database": "ZINC", "url": "" }, { "id": "000002562219", "database": "ZINC", "url": "" }, { "id": "C01132", "database": "COMPOUND", "url": "" }, { "id": "000002562219", "database": "ZINC", "url": "" }, { "id": "000003861733", "database": "ZINC", "url": "" }, { "id": "28037", "database": "ChEBI", "url": "" }, { "id": "G27025MB", "database": "GlyTouCan", "url": "" }, { "id": "28037", "database": "ChEBI", "url": "" }, { "id": "G27025MB", "database": "GlyTouCan", "url": "" }, { "id": "C01132", "database": "COMPOUND", "url": "" }, { "id": "000003861733", "database": "ZINC", "url": "" }, { "id": "000002562219", "database": "ZINC", "url": "" }, { "id": "000003861733", "database": "ZINC", "url": "" }, { "id": "28037", "database": "ChEBI", "url": "" }, { "id": "G27025MB", "database": "GlyTouCan", "url": "" }, { "id": "000002562219", "database": "ZINC", "url": "" }, { "id": "C01132", "database": "COMPOUND", "url": "" }, { "id": "28037", "database": "ChEBI", "url": "" }, { "id": "G27025MB", "database": "GlyTouCan", "url": "" }, { "id": "C01132", "database": "COMPOUND", "url": "" }, { "id": "000003861733", "database": "ZINC", "url": "" }, { "id": "000002562219", "database": "ZINC", "url": "" }, { "id": "28037", "database": "ChEBI", "url": "" }, { "id": "G27025MB", "database": "GlyTouCan", "url": "" }, { "id": "C01132", "database": "COMPOUND", "url": "" }, { "id": "000003861733", "database": "ZINC", "url": "" }, { "id": "000002562219", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-1678743", "participant_name": "GlcNAc [lysosomal lumen]", "crossref": [ { "id": "17411", "database": "ChEBI", "url": "" }, { "id": "HMDB0062641", "database": "HMDB Metabolite", "url": "" }, { "id": "C00140", "database": "COMPOUND", "url": "" }, { "id": "000002077807", "database": "ZINC", "url": "" }, { "id": "HMDB0062641", "database": "HMDB Metabolite", "url": "" }, { "id": "000002077807", "database": "ZINC", "url": "" }, { "id": "17411", "database": "ChEBI", "url": "" }, { "id": "C00140", "database": "COMPOUND", "url": "" }, { "id": "17411", "database": "ChEBI", "url": "" }, { "id": "HMDB0062641", "database": "HMDB Metabolite", "url": "" }, { "id": "C00140", "database": "COMPOUND", "url": "" }, { "id": "000002077807", "database": "ZINC", "url": "" }, { "id": "HMDB0062641", "database": "HMDB Metabolite", "url": "" }, { "id": "000002077807", "database": "ZINC", "url": "" }, { "id": "C00140", "database": "COMPOUND", "url": "" }, { "id": "17411", "database": "ChEBI", "url": "" }, { "id": "17411", "database": "ChEBI", "url": "" }, { "id": "HMDB0062641", "database": "HMDB Metabolite", "url": "" }, { "id": "C00140", "database": "COMPOUND", "url": "" }, { "id": "000002077807", "database": "ZINC", "url": "" }, { "id": "17411", "database": "ChEBI", "url": "" }, { "id": "HMDB0062641", "database": "HMDB Metabolite", "url": "" }, { "id": "C00140", "database": "COMPOUND", "url": "" }, { "id": "000002077807", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-2065269", "participant_name": "ChEBI:63516 chain [lysosomal lumen]", "crossref": [ { "id": "63516", "database": "ChEBI", "url": "" }, { "id": "63516", "database": "ChEBI", "url": "" }, { "id": "63516", "database": "ChEBI", "url": "" }, { "id": "63516", "database": "ChEBI", "url": "" }, { "id": "63516", "database": "ChEBI", "url": "" }, { "id": "63516", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-2105010", "participant_name": "Gal-GlcNAc(S)-Gal [lysosomal lumen]", "crossref": [ { "id": "G08421", "database": "KEGG Glycan", "url": "" }, { "id": "63853", "database": "ChEBI", "url": "" }, { "id": "000087528707", "database": "ZINC", "url": "" }, { "id": "000087528704", "database": "ZINC", "url": "" }, { "id": "000087528707", "database": "ZINC", "url": "" }, { "id": "G08421", "database": "KEGG Glycan", "url": "" }, { "id": "63853", "database": "ChEBI", "url": "" }, { "id": "000087528704", "database": "ZINC", "url": "" }, { "id": "G08421", "database": "KEGG Glycan", "url": "" }, { "id": "63853", "database": "ChEBI", "url": "" }, { "id": "000087528707", "database": "ZINC", "url": "" }, { "id": "000087528704", "database": "ZINC", "url": "" }, { "id": "63853", "database": "ChEBI", "url": "" }, { "id": "000087528704", "database": "ZINC", "url": "" }, { "id": "000087528707", "database": "ZINC", "url": "" }, { "id": "G08421", "database": "KEGG Glycan", "url": "" }, { "id": "G08421", "database": "KEGG Glycan", "url": "" }, { "id": "63853", "database": "ChEBI", "url": "" }, { "id": "000087528707", "database": "ZINC", "url": "" }, { "id": "000087528704", "database": "ZINC", "url": "" }, { "id": "G08421", "database": "KEGG Glycan", "url": "" }, { "id": "63853", "database": "ChEBI", "url": "" }, { "id": "000087528707", "database": "ZINC", "url": "" }, { "id": "000087528704", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-2105012", "participant_name": "GlcNAc-Gal-GlcNAc(S)-Gal [lysosomal lumen]", "crossref": [ { "id": "G13033", "database": "KEGG Glycan", "url": "" }, { "id": "63852", "database": "ChEBI", "url": "" }, { "id": "000096085300", "database": "ZINC", "url": "" }, { "id": "000096085299", "database": "ZINC", "url": "" }, { "id": "G13033", "database": "KEGG Glycan", "url": "" }, { "id": "63852", "database": "ChEBI", "url": "" }, { "id": "000096085300", "database": "ZINC", "url": "" }, { "id": "000096085299", "database": "ZINC", "url": "" }, { "id": "63852", "database": "ChEBI", "url": "" }, { "id": "000096085299", "database": "ZINC", "url": "" }, { "id": "G13033", "database": "KEGG Glycan", "url": "" }, { "id": "000096085300", "database": "ZINC", "url": "" }, { "id": "G13033", "database": "KEGG Glycan", "url": "" }, { "id": "63852", "database": "ChEBI", "url": "" }, { "id": "000096085300", "database": "ZINC", "url": "" }, { "id": "000096085299", "database": "ZINC", "url": "" }, { "id": "G13033", "database": "KEGG Glycan", "url": "" }, { "id": "63852", "database": "ChEBI", "url": "" }, { "id": "000096085300", "database": "ZINC", "url": "" }, { "id": "000096085299", "database": "ZINC", "url": "" }, { "id": "G13033", "database": "KEGG Glycan", "url": "" }, { "id": "000096085300", "database": "ZINC", "url": "" }, { "id": "000096085299", "database": "ZINC", "url": "" }, { "id": "63852", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-2105025", "participant_name": "IdoA-GalNAc(4S)-GlcA-Gal-Gal-Xyl [lysosomal lumen]", "crossref": [ { "id": "63873", "database": "ChEBI", "url": "" }, { "id": "63873", "database": "ChEBI", "url": "" }, { "id": "63873", "database": "ChEBI", "url": "" }, { "id": "63873", "database": "ChEBI", "url": "" }, { "id": "63873", "database": "ChEBI", "url": "" }, { "id": "63873", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-2162223", "participant_name": "GlcNAc-GlcA-GlcNAc [lysosomal lumen]", "crossref": [ { "id": "63563", "database": "ChEBI", "url": "" }, { "id": "63563", "database": "ChEBI", "url": "" }, { "id": "63563", "database": "ChEBI", "url": "" }, { "id": "63563", "database": "ChEBI", "url": "" }, { "id": "63563", "database": "ChEBI", "url": "" }, { "id": "63563", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-2162224", "participant_name": "GlcA-1,3-GlcNAc [lysosomal lumen]", "crossref": [ { "id": "64024", "database": "ChEBI", "url": "" }, { "id": "G35674CY", "database": "GlyTouCan", "url": "" }, { "id": "000031371284", "database": "ZINC", "url": "" }, { "id": "000031371287", "database": "ZINC", "url": "" }, { "id": "64024", "database": "ChEBI", "url": "" }, { "id": "G35674CY", "database": "GlyTouCan", "url": "" }, { "id": "000031371284", "database": "ZINC", "url": "" }, { "id": "000031371287", "database": "ZINC", "url": "" }, { "id": "64024", "database": "ChEBI", "url": "" }, { "id": "G35674CY", "database": "GlyTouCan", "url": "" }, { "id": "000031371284", "database": "ZINC", "url": "" }, { "id": "000031371287", "database": "ZINC", "url": "" }, { "id": "64024", "database": "ChEBI", "url": "" }, { "id": "G35674CY", "database": "GlyTouCan", "url": "" }, { "id": "000031371284", "database": "ZINC", "url": "" }, { "id": "000031371287", "database": "ZINC", "url": "" }, { "id": "64024", "database": "ChEBI", "url": "" }, { "id": "G35674CY", "database": "GlyTouCan", "url": "" }, { "id": "000031371284", "database": "ZINC", "url": "" }, { "id": "000031371287", "database": "ZINC", "url": "" }, { "id": "64024", "database": "ChEBI", "url": "" }, { "id": "G35674CY", "database": "GlyTouCan", "url": "" }, { "id": "000031371284", "database": "ZINC", "url": "" }, { "id": "000031371287", "database": "ZINC", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "P13723", "gene_name": "hexa1", "activity": [ { "ec_number": "3.2.1.52", "activity": "Hydrolysis of terminal non-reducing N-acetyl-D-hexosamine residues in N-acetyl-beta-D-hexosaminides.", "evidence": [ { "id": "P13723", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13723" } ] }, { "ec_number": "3.2.1.52", "activity": "", "evidence": [ { "id": "P13723", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13723" } ] } ] }, { "uniprot_ac": "Q54K55", "gene_name": "hexb1", "activity": [ { "ec_number": "3.2.1.52", "activity": "Hydrolysis of terminal non-reducing N-acetyl-D-hexosamine residues in N-acetyl-beta-D-hexosaminides.", "evidence": [ { "id": "Q54K55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54K55" } ] }, { "ec_number": "3.2.1.52", "activity": "", "evidence": [ { "id": "Q54K55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54K55" } ] } ] }, { "uniprot_ac": "Q54K56", "gene_name": "hexb2", "activity": [ { "ec_number": "3.2.1.52", "activity": "Hydrolysis of terminal non-reducing N-acetyl-D-hexosamine residues in N-acetyl-beta-D-hexosaminides.", "evidence": [ { "id": "Q54K56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54K56" } ] }, { "ec_number": "3.2.1.52", "activity": "", "evidence": [ { "id": "Q54K56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54K56" } ] } ] }, { "uniprot_ac": "Q54MU9", "gene_name": "nagE", "activity": [ { "ec_number": "3.2.1.52", "activity": "Hydrolysis of terminal non-reducing N-acetyl-D-hexosamine residues in N-acetyl-beta-D-hexosaminides.", "evidence": [ { "id": "Q54MU9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54MU9" } ] }, { "ec_number": "3.2.1.52", "activity": "", "evidence": [ { "id": "Q54MU9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54MU9" } ] } ] }, { "uniprot_ac": "Q54SC9", "gene_name": "hexa2", "activity": [ { "ec_number": "3.2.1.52", "activity": "Hydrolysis of terminal non-reducing N-acetyl-D-hexosamine residues in N-acetyl-beta-D-hexosaminides.", "evidence": [ { "id": "Q54SC9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54SC9" } ] }, { "ec_number": "3.2.1.52", "activity": "", "evidence": [ { "id": "Q54SC9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54SC9" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [ 72, 79, 350, 427 ], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 350, "end_pos": 352 }, { "start_pos": 427, "end_pos": 429 }, { "start_pos": 72, "end_pos": 74 }, { "start_pos": 79, "end_pos": 81 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }