{ "uniprot_canonical_ac": "P13640-1", "uniprot_ac": "P13640", "uniprot_id": "MT1G_HUMAN", "mass": { "chemical_mass": 6141.0, "monoisotopic_mass": 6141.0 }, "refseq": { "ac": "NP_001288196", "name": "metallothionein-1G isoform 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001288196" }, "gene_names": [ { "name": "MT1G", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P13640", "id": "P13640" }, { "name": "MT1; MT1K", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001288196", "id": "NP_001288196" }, { "name": "MT1G", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001288196", "id": "NP_001288196" }, { "name": "MT1K", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P13640", "id": "P13640" }, { "name": "MT1M", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P13640", "id": "P13640" } ], "protein_names": [ { "name": "Metallothionein-1G", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P13640" }, { "name": "MT-1G; MT-1K; MT-IG; metallothionein-1K; metallothionein-IG", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001288196", "id": "NP_001288196" }, { "name": "MT-1G", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13640" }, { "name": "MT-1K", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13640" }, { "name": "MT-IG", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13640" }, { "name": "Metallothionein-1K", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13640" }, { "name": "Metallothionein-IG", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13640" }, { "name": "metallothionein-1G isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001288196", "id": "NP_001288196" } ], "function": [ { "annotation": "In clear cell renal cell carcinoma (RCC) MT1E, MT1G and MT1M expression was higher than that noted in other histological tumor subtypes (all P<0.0500). In addition, some associations were observed between metabolic syndromerelated clinical parameters and promoter methylation or gene expression", "evidence": [ { "database": "RefSeq", "id": "NP_001288196", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001288196" }, { "database": "PubMed", "id": "31002354", "url": "https://glygen.org/publication/PubMed/31002354" } ] }, { "annotation": "Metallothionein-1G suppresses pancreatic cancer cell stemness by limiting activin A secretion via NF-kappaB inhibition. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001288196", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001288196" }, { "database": "PubMed", "id": "33537082", "url": "https://glygen.org/publication/PubMed/33537082" } ] }, { "annotation": "Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.", "evidence": [ { "database": "UniProtKB", "id": "H3BSF1", "url": "https://www.uniprot.org/uniprot/H3BSF1#function" }, { "database": "UniProtKB", "id": "ARBA00002597", "url": "https://www.uniprot.org/uniprot/ARBA00002597#function" }, { "database": "UniProtKB", "id": "P13640", "url": "https://www.uniprot.org/uniprot/P13640#function" } ] }, { "annotation": "Multivariate analysis indicated that RUNX3 and CDH1 promoter methylation were independent prognostic factors for overall survival (P = 0.03 and 0.04; respectively), while DAPK1, RUNX3 and MT1G PM were independent prognostic factors for disease free survival.", "evidence": [ { "database": "RefSeq", "id": "NP_001288196", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001288196" }, { "database": "PubMed", "id": "31093876", "url": "https://glygen.org/publication/PubMed/31093876" } ] }, { "annotation": "The MT1G Gene in LUHMES Neurons Is a Sensitive Biomarker of Neurotoxicity.", "evidence": [ { "database": "RefSeq", "id": "NP_001288196", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001288196" }, { "database": "PubMed", "id": "32870474", "url": "https://glygen.org/publication/PubMed/32870474" } ] }, { "annotation": "Upregulation of Metallothionein-1G Accelerates G1/S Transition in the Growth Phase of Acute Promyelocytic Leukemia NB4 Cells.", "evidence": [ { "database": "RefSeq", "id": "NP_001288196", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001288196" }, { "database": "PubMed", "id": "33653779", "url": "https://glygen.org/publication/PubMed/33653779" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "99.72", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000125144", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125144" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "88.57", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000125144", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125144" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "99.21", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000125144", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125144" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "96.53", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000125144", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125144" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "80.57", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000125144", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125144" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "99.43", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000125144", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125144" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "96.69", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000125144", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125144" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "74.82", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000125144", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125144" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "99.42", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000125144", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125144" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "94.43", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000125144", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125144" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "99.67", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000125144", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125144" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "97.25", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000125144", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125144" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "83.64", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000125144", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125144" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P13640", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13640" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P13640", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13640" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P13640", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13640" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P13640", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13640" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P13640", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13640" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P13640", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13640" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P13640", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13640" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P13640", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13640" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P13640", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13640" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P13640", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13640" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P13640", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13640" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P13640", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13640" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13640", "url": "https://www.uniprot.org/uniprot/P13640" } ], "common_name": "Human" } ], "gene": [ { "name": "MT1G", "url": "https://www.uniprot.org/uniprot/P13640", "locus": { "chromosome": "16", "start_pos": 56666730, "end_pos": 56668065, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000125144", "url": "https://www.ensembl.org/id/ENSG00000125144" } ] } } ], "crossref": [ { "id": "ENSG00000125144", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000125144", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "MT1G", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=MT1G", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "4495", "url": "https://www.ncbi.nlm.nih.gov/gene/4495", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "7399", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=7399", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P13640", "url": "https://www.ebi.ac.uk/intact/interactors/id:P13640*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000006", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000006", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017854", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017854", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018064", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018064", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023587", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023587", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:4495", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4495", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "156353", "url": "http://www.omim.org/entry/156353", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P13640", "url": "https://www.nextprot.org/entry/NX_P13640", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "PSTKCSC", "url": "https://omabrowser.org/oma/group/PSTKCSC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR23299", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23299", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23299:SF22", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23299:SF22", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23299:SF53", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23299:SF53", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00131", "url": "http://pfam.xfam.org/family/PF00131", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P13640", "url": "https://pharos.nih.gov/targets/P13640", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P13640", "url": "http://purl.obolibrary.org/obo/PR_P13640", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001288196", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001288196", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "H3BSF1", "url": "https://www.uniprot.org/uniprot/H3BSF1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BSF1-1", "url": "https://www.uniprot.org/uniprot/H3BSF1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13640", "url": "https://www.uniprot.org/uniprot/P13640", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13640-1", "url": "https://www.uniprot.org/uniprot/P13640-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13640-2", "url": "https://www.uniprot.org/uniprot/P13640-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDPNCSCAAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCCA", "length": 62, "header": "sp|P13640-1|MT1G_HUMAN Isoform 1 of Metallothionein-1G OS=Homo sapiens OX=9606 GN=MT1G PE=1 SV=2 CANONICAL=P13640-1" }, "isoforms": [ { "isoform_ac": "H3BSF1-1", "url": "", "sequence": { "sequence": "MDPNCSCAAGCCSCCPVGCAKCAQGCICKGASEKCSCCA", "length": 39, "header": "tr|H3BSF1-1|H3BSF1_HUMAN Computationally mapped isoform of Metallothionein OS=Homo sapiens OX=9606 GN=MT1G PE=3 SV=1 CANONICAL=P13640-1" }, "locus": { "chromosome": "16", "start_pos": 56667993, "end_pos": 56666882, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000569500.5", "url": "https://www.ensembl.org/id/ENST00000569500.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000456675.1", "url": "https://www.ensembl.org/id/ENSP00000456675.1" } ] } }, { "isoform_ac": "P13640-1", "url": "", "sequence": { "sequence": "MDPNCSCAAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCCA", "length": 62, "header": "sp|P13640-1|MT1G_HUMAN Isoform 1 of Metallothionein-1G OS=Homo sapiens OX=9606 GN=MT1G PE=1 SV=2 CANONICAL=P13640-1" }, "locus": { "chromosome": "16", "start_pos": 56667993, "end_pos": 56666882, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000379811.4", "url": "https://www.ensembl.org/id/ENST00000379811.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000369139.4", "url": "https://www.ensembl.org/id/ENSP00000369139.4" } ] } }, { "isoform_ac": "P13640-2", "url": "", "sequence": { "sequence": "MDPNCSCAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCCA", "length": 61, "header": "sp|P13640-2|MT1G_HUMAN Isoform 2 of Metallothionein-1G OS=Homo sapiens OX=9606 GN=MT1G PE=1 SV=2 CANONICAL=P13640-1" }, "locus": { "chromosome": "16", "start_pos": 56667993, "end_pos": 56666882, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000444837.6", "url": "https://www.ensembl.org/id/ENST00000444837.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000391397.2", "url": "https://www.ensembl.org/id/ENSP00000391397.2" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 59, "end_pos": 59, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13640", "url": "https://www.uniprot.org/uniprot/P13640" } ], "site_lbl": "Ser59" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Why reversing the sequence of the alpha domain of human metallothionein-2 does not change its metal-binding and folding characteristics.", "journal": "European journal of biochemistry", "date": "1999", "authors": "Pan PK, Zheng ZF, Lyu PC, Huang PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "10542048", "url": "https://glygen.org/publication/PubMed/10542048" } ] }, { "title": "Zinc transfer potentials of the alpha - and beta-clusters of metallothionein are affected by domain interactions in the whole molecule.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Jiang LJ, Vasak M, Vallee BL, Maret W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "10716985", "url": "https://glygen.org/publication/PubMed/10716985" } ] }, { "title": "Circular dichroism, kinetic and mass spectrometric studies of copper(I) and mercury(II) binding to metallothionein.", "journal": "Journal of inorganic biochemistry", "date": "2000", "authors": "Stillman MJ, Thomas D, Trevithick C, Guo X, Siu M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "10830841", "url": "https://glygen.org/publication/PubMed/10830841" } ] }, { "title": "Brain-specific metallothionein-3 has higher metal-binding capacity than ubiquitous metallothioneins and binds metals noncooperatively.", "journal": "Biochemistry", "date": "2002", "authors": "Palumaa P, Eriste E, Njunkova O, Pokras L, Jornvall H, Sillard R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "11994011", "url": "https://glygen.org/publication/PubMed/11994011" } ] }, { "title": "A distinct Cu(4)-thiolate cluster of human metallothionein-3 is located in the N-terminal domain.", "journal": "Journal of biological inorganic chemistry : JBIC : a publication of the Society of Biological Inorganic Chemistry", "date": "2002", "authors": "Roschitzki B, Vasak M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "12072966", "url": "https://glygen.org/publication/PubMed/12072966" } ] }, { "title": "Redox labile site in a Zn4 cluster of Cu4,Zn4-metallothionein-3.", "journal": "Biochemistry", "date": "2003", "authors": "Roschitzki B, Vasak M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "12911326", "url": "https://glygen.org/publication/PubMed/12911326" } ] }, { "title": "Purification of recombinant human apometallothionein-3 and reconstitution with zinc.", "journal": "Protein expression and purification", "date": "2003", "authors": "Eriste E, Kruusel K, Palumaa P, Jornvall H, Sillard R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "12963354", "url": "https://glygen.org/publication/PubMed/12963354" } ] }, { "title": "Functional differentiation in the mammalian metallothionein gene family: metal binding features of mouse MT4 and comparison with its paralog MT1.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Tio L, Villarreal L, Atrian S, Capdevila M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "15033980", "url": "https://glygen.org/publication/PubMed/15033980" } ] }, { "title": "Metal binding of metallothionein-3 versus metallothionein-2: lower affinity and higher plasticity.", "journal": "Biochimica et biophysica acta", "date": "2005", "authors": "Palumaa P, Tammiste I, Kruusel K, Kangur L, Jornvall H, Sillard R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "15698955", "url": "https://glygen.org/publication/PubMed/15698955" } ] }, { "title": "Zn7metallothionein-3 and the synaptic vesicle cycle: interaction of metallothionein-3 with the small GTPase Rab3A.", "journal": "Biochemistry", "date": "2005", "authors": "Knipp M, Meloni G, Roschitzki B, Vasak M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "15736926", "url": "https://glygen.org/publication/PubMed/15736926" } ] }, { "title": "Arsenic binding to human metallothionein.", "journal": "Journal of the American Chemical Society", "date": "2006", "authors": "Ngu TT, Stillman MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "16984198", "url": "https://glygen.org/publication/PubMed/16984198" } ] }, { "title": "High-yield expression in Escherichia coli of soluble human MT2A with native functions.", "journal": "Protein expression and purification", "date": "2007", "authors": "Yang F, Zhou M, He Z, Liu X, Sun L, Sun Y, Chen Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "17224279", "url": "https://glygen.org/publication/PubMed/17224279" } ] }, { "title": "Evidence for noncooperative metal binding to the alpha domain of human metallothionein.", "journal": "The FEBS journal", "date": "2007", "authors": "Rigby Duncan KE, Stillman MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "17388808", "url": "https://glygen.org/publication/PubMed/17388808" } ] }, { "title": "Redox silencing of copper in metal-linked neurodegenerative disorders: reaction of Zn7metallothionein-3 with Cu2+ ions.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Meloni G, Faller P, Vasak M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "17389590", "url": "https://glygen.org/publication/PubMed/17389590" } ] }, { "title": "The effect of nitric oxide on metal release from metallothionein-3: gradual unfolding of the protein.", "journal": "Journal of biological inorganic chemistry : JBIC : a publication of the Society of Biological Inorganic Chemistry", "date": "2008", "authors": "Wang H, Li H, Cai B, Huang ZX, Sun H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "18157556", "url": "https://glygen.org/publication/PubMed/18157556" } ] }, { "title": "Metal exchange in metallothioneins: a novel structurally significant Cd(5) species in the alpha domain of human metallothionein 1a.", "journal": "The FEBS journal", "date": "2008", "authors": "Rigby Duncan KE, Kirby CW, Stillman MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "18429853", "url": "https://glygen.org/publication/PubMed/18429853" } ] }, { "title": "Metal swap between Zn7-metallothionein-3 and amyloid-beta-Cu protects against amyloid-beta toxicity.", "journal": "Nature chemical biology", "date": "2008", "authors": "Meloni G, Sonois V, Delaine T, Guilloreau L, Gillet A, Teissie J, Faller P, Vasak M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "18454142", "url": "https://glygen.org/publication/PubMed/18454142" } ] }, { "title": "Noncooperative cadmium(II) binding to human metallothionein 1a.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Sutherland DE, Stillman MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "18533113", "url": "https://glygen.org/publication/PubMed/18533113" } ] }, { "title": "Effects of Zn(2+), Ca(2+), and Mg(2+) on the structure of Zn(7)metallothionein-3: evidence for an additional zinc binding site.", "journal": "Biochemistry", "date": "2009", "authors": "Meloni G, Polanski T, Braun O, Vasak M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "19425569", "url": "https://glygen.org/publication/PubMed/19425569" } ] }, { "title": "Affinity gradients drive copper to cellular destinations.", "journal": "Nature", "date": "2010", "authors": "Banci L, Bertini I, Ciofi-Baffoni S, Kozyreva T, Zovo K, Palumaa P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "20463663", "url": "https://glygen.org/publication/PubMed/20463663" } ] }, { "title": "The native copper- and zinc-binding protein metallothionein blocks copper-mediated Abeta aggregation and toxicity in rat cortical neurons.", "journal": "PloS one", "date": "2010", "authors": "Chung RS, Howells C, Eaton ED, Shabala L, Zovo K, Palumaa P, Sillard R, Woodhouse A, Bennett WR, Ray S, Vickers JC, West AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "20711450", "url": "https://glygen.org/publication/PubMed/20711450" } ] }, { "title": "Redox activity of alpha-synuclein-Cu is silenced by Zn(7)-metallothionein-3.", "journal": "Free radical biology & medicine", "date": "2011", "authors": "Meloni G, Vasak M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "21320589", "url": "https://glygen.org/publication/PubMed/21320589" } ] }, { "title": "Single domain metallothioneins: supermetalation of human MT 1a.", "journal": "Journal of the American Chemical Society", "date": "2012", "authors": "Sutherland DE, Willans MJ, Stillman MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "22242602", "url": "https://glygen.org/publication/PubMed/22242602" } ] }, { "title": "Rapid exchange of metal between Zn(7)-metallothionein-3 and amyloid-beta peptide promotes amyloid-related structural changes.", "journal": "Biochemistry", "date": "2012", "authors": "Pedersen JT, Hureau C, Hemmingsen L, Heegaard NH, Ostergaard J, Vasak M, Faller P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "22283439", "url": "https://glygen.org/publication/PubMed/22283439" } ] }, { "title": "Noncooperative metalation of metallothionein 1a and its isolated domains with zinc.", "journal": "Biochemistry", "date": "2012", "authors": "Sutherland DE, Summers KL, Stillman MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "22823575", "url": "https://glygen.org/publication/PubMed/22823575" } ] }, { "title": "Modeling the Zn(2+) and Cd(2+) metalation mechanism in mammalian metallothionein 1a.", "journal": "Biochemical and biophysical research communications", "date": "2012", "authors": "Sutherland DE, Summers KL, Stillman MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "22982309", "url": "https://glygen.org/publication/PubMed/22982309" } ] }, { "title": "The molecular mechanism for human metallothionein-3 to protect against the neuronal cytotoxicity of Abeta(1-42) with Cu ions.", "journal": "Journal of biological inorganic chemistry : JBIC : a publication of the Society of Biological Inorganic Chemistry", "date": "2013", "authors": "Luo Y, Xu Y, Bao Q, Ding Z, Zhu C, Huang ZX, Tan X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "23086305", "url": "https://glygen.org/publication/PubMed/23086305" } ] }, { "title": "Single-domain metallothioneins: evidence of the onset of clustered metal binding domains in Zn-rhMT 1a.", "journal": "Biochemistry", "date": "2013", "authors": "Summers KL, Sutherland DE, Stillman MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "23506369", "url": "https://glygen.org/publication/PubMed/23506369" } ] }, { "title": "Cysteine accessibility during As3+ metalation of the alpha- and beta-domains of recombinant human MT1a.", "journal": "Biochemical and biophysical research communications", "date": "2013", "authors": "Irvine GW, Summers KL, Stillman MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "23523794", "url": "https://glygen.org/publication/PubMed/23523794" } ] }, { "title": "Structure and expression of the human metallothionein genes.", "journal": "Experientia Suppl.", "date": "1987", "authors": "Gedamu L, Varshney U, Jahroudi N, Foster R, Shworak NW", "evidence": [ { "database": "UniProtKB", "id": "P13640", "url": "https://www.uniprot.org/uniprot/P13640" } ], "reference": [ { "type": "PubMed", "id": "2444457", "url": "https://glygen.org/publication/PubMed/2444457" } ] }, { "title": "High level expression, efficient purification, and bioactivity of recombinant human metallothionein 3 (rhMT3) from methylotrophic yeast Pichia pastoris.", "journal": "Protein expression and purification", "date": "2014", "authors": "Wu Q, Li B, Wu F, Yang L, Li S, Li H, Wu D, Cui T, Tang D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5661231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231" } ], "reference": [ { "type": "PubMed", "id": "24973778", "url": "https://glygen.org/publication/PubMed/24973778" } ] }, { "title": "DNA methylation of metallothionein genes is associated with the clinical features of renal cell carcinoma.", "journal": "Oncology reports", "date": "2019", "authors": "Maleckaite R, Zalimas A, Bakavicius A, Jankevicius F, Jarmalaite S, Daniunaite K", "evidence": [ { "database": "RefSeq", "id": "NP_001288196", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001288196" } ], "reference": [ { "type": "PubMed", "id": "31002354", "url": "https://glygen.org/publication/PubMed/31002354" } ] }, { "title": "The prognostic impact of hypermethylation for a panel of tumor suppressor genes and cell of origin subtype on diffuse large B-cell lymphoma.", "journal": "Molecular biology reports", "date": "2019", "authors": "Shawky SA, El-Borai MH, Khaled HM, Guda I, Mohanad M, Abdellateif MS, Zekri AN, Bahanasy AA", "evidence": [ { "database": "RefSeq", "id": "NP_001288196", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001288196" } ], "reference": [ { "type": "PubMed", "id": "31093876", "url": "https://glygen.org/publication/PubMed/31093876" } ] }, { "title": "The MT1G Gene in LUHMES Neurons Is a Sensitive Biomarker of Neurotoxicity.", "journal": "Neurotoxicity research", "date": "2020", "authors": "Tong ZB, Braisted J, Chu PH, Gerhold D", "evidence": [ { "database": "RefSeq", "id": "NP_001288196", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001288196" } ], "reference": [ { "type": "PubMed", "id": "32870474", "url": "https://glygen.org/publication/PubMed/32870474" } ] }, { "title": "Metallothionein-1G suppresses pancreatic cancer cell stemness by limiting activin A secretion via NF-kappaB inhibition.", "journal": "Theranostics", "date": "2021", "authors": "Li K, Zhang Z, Mei Y, Yang Q, Qiao S, Ni C, Yao Y, Li X, Li M, Wei D, Fu W, Guo X, Huang X, Yang H", "evidence": [ { "database": "RefSeq", "id": "NP_001288196", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001288196" } ], "reference": [ { "type": "PubMed", "id": "33537082", "url": "https://glygen.org/publication/PubMed/33537082" } ] }, { "title": "Upregulation of Metallothionein-1G Accelerates G1/S Transition in the Growth Phase of Acute Promyelocytic Leukemia NB4 Cells.", "journal": "Annals of clinical and laboratory science", "date": "2021", "authors": "Hirako N, Takahashi S", "evidence": [ { "database": "RefSeq", "id": "NP_001288196", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001288196" } ], "reference": [ { "type": "PubMed", "id": "33653779", "url": "https://glygen.org/publication/PubMed/33653779" } ] }, { "title": "Structure and expression of the human metallothionein-IG gene. Differential promoter activity of two linked metallothionein-I genes in response to heavy metals.", "journal": "J. Biol. Chem.", "date": "1988", "authors": "Foster R, Jahroudi N, Varshney U, Gedamu L", "evidence": [ { "database": "UniProtKB", "id": "P13640", "url": "https://www.uniprot.org/uniprot/P13640" } ], "reference": [ { "type": "PubMed", "id": "3403543", "url": "https://glygen.org/publication/PubMed/3403543" } ] }, { "title": "Induction by zinc of specific metallothionein isoforms in human monocytes.", "journal": "European journal of biochemistry", "date": "1994", "authors": "Pauwels M, van Weyenbergh J, Soumillion A, Proost P, De Ley M", "evidence": [ { "database": "UniProtKB", "id": "P13640", "url": "https://www.uniprot.org/uniprot/P13640" } ], "reference": [ { "type": "PubMed", "id": "8119276", "url": "https://glygen.org/publication/PubMed/8119276" } ] } ], "pathway": [ { "id": "hsa:4495", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4495", "resource": "KEGG Pathway" }, { "id": "R-HSA-5661231", "name": "Metallothioneins bind metals", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661231", "resource": "Reactome", "description": "Metallothioneins bind metals" } ], "orthologs": [ { "uniprot_canonical_ac": "P02795-1", "protein_name": "Metallothionein-2", "gene_name": "MT2A", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA", "length": 61 }, "evidence": [ { "id": "45918124", "url": "http://www.informatics.jax.org/homology/45918124", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P02798-1", "protein_name": "Metallothionein-2", "gene_name": "Mt2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MDPNCSCASDGSCSCAGACKCKQCKCTSCKKSCCSCCPVGCAKCSQGCICKEASDKCSCCA", "length": 61 }, "evidence": [ { "id": "45918124", "url": "http://www.informatics.jax.org/homology/45918124", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P02802-1", "protein_name": "Metallothionein-1", "gene_name": "Mt1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MDPNCSCSTGGSCTCTSSCACKNCKCTSCKKSCCSCCPVGCSKCAQGCVCKGAADKCTCCA", "length": 61 }, "evidence": [ { "id": "45918126", "url": "http://www.informatics.jax.org/homology/45918126", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P02803-1", "protein_name": "Metallothionein-1", "gene_name": "Mt1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MDPNCSCSTGGSCTCSSSCGCKNCKCTSCKKSCCSCCPVGCSKCAQGCVCKGASDKCTCCA", "length": 61 }, "evidence": [ { "id": "45918126", "url": "http://www.informatics.jax.org/homology/45918126", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P04355-1", "protein_name": "Metallothionein-2", "gene_name": "Mt2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MDPNCSCATDGSCSCAGSCKCKQCKCTSCKKSCCSCCPVGCAKCSQGCICKEASDKCSCCA", "length": 61 }, "evidence": [ { "id": "45918124", "url": "http://www.informatics.jax.org/homology/45918124", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P04731-1", "protein_name": "Metallothionein-1A", "gene_name": "MT1A", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDPNCSCATGGSCTCTGSCKCKECKCTSCKKSCCSCCPMSCAKCAQGCICKGASEKCSCCA", "length": 61 }, "evidence": [ { "id": "45918126", "url": "http://www.informatics.jax.org/homology/45918126", "database": "MGI" }, { "id": "45918124", "url": "http://www.informatics.jax.org/homology/45918124", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P04732-1", "protein_name": "Metallothionein-1E", "gene_name": "MT1E", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASEKCSCCA", "length": 61 }, "evidence": [ { "id": "45918126", "url": "http://www.informatics.jax.org/homology/45918126", "database": "MGI" }, { "id": "45918124", "url": "http://www.informatics.jax.org/homology/45918124", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P04733-1", "protein_name": "Metallothionein-1F", "gene_name": "MT1F", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCCD", "length": 61 }, "evidence": [ { "id": "45918126", "url": "http://www.informatics.jax.org/homology/45918126", "database": "MGI" }, { "id": "45918124", "url": "http://www.informatics.jax.org/homology/45918124", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P07438-1", "protein_name": "Metallothionein-1B", "gene_name": "MT1B", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDPNCSCTTGGSCACAGSCKCKECKCTSCKKCCCSCCPVGCAKCAQGCVCKGSSEKCRCCA", "length": 61 }, "evidence": [ { "id": "45918126", "url": "http://www.informatics.jax.org/homology/45918126", "database": "MGI" }, { "id": "45918124", "url": "http://www.informatics.jax.org/homology/45918124", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P80294-1", "protein_name": "Metallothionein-1H", "gene_name": "MT1H", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDPNCSCEAGGSCACAGSCKCKKCKCTSCKKSCCSCCPLGCAKCAQGCICKGASEKCSCCA", "length": 61 }, "evidence": [ { "id": "45918126", "url": "http://www.informatics.jax.org/homology/45918126", "database": "MGI" }, { "id": "45918124", "url": "http://www.informatics.jax.org/homology/45918124", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P80297-1", "protein_name": "Metallothionein-1X", "gene_name": "MT1X", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSCCA", "length": 61 }, "evidence": [ { "id": "45918126", "url": "http://www.informatics.jax.org/homology/45918126", "database": "MGI" }, { "id": "45918124", "url": "http://www.informatics.jax.org/homology/45918124", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q8N339-1", "protein_name": "Metallothionein-1M", "gene_name": "MT1M", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDPNCSCTTGVSCACTGSCTCKECKCTSCKKSCCSCCPVGCAKCAHGCVCKGTLENCSCCA", "length": 61 }, "evidence": [ { "id": "45918126", "url": "http://www.informatics.jax.org/homology/45918126", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "P13640", "url": "https://www.uniprot.org/uniprot/P13640" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "P13640", "url": "https://www.uniprot.org/uniprot/P13640" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 11, "go_terms": [ { "name": "response to inorganic substance", "id": "GO:0010035", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010035", "evidence": [ { "database": "UniProtKB", "id": "P13640", "url": "https://www.uniprot.org/uniprot/P13640" } ], "pmid": "" }, { "name": "cellular response to chemical stimulus", "id": "GO:0070887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070887", "evidence": [ { "database": "UniProtKB", "id": "P13640", "url": "https://www.uniprot.org/uniprot/P13640" } ], "pmid": "" }, { "name": "monocyte activation", "id": "GO:0042117", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042117", "evidence": [ { "database": "UniProtKB", "id": "P13640", "url": "https://www.uniprot.org/uniprot/P13640" } ], "pmid": "" }, { "name": "cellular response to vascular endothelial growth factor stimulus", "id": "GO:0035924", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035924", "evidence": [ { "database": "UniProtKB", "id": "P13640", "url": "https://www.uniprot.org/uniprot/P13640" } ], "pmid": "" }, { "name": "cellular response to cadmium ion", "id": "GO:0071276", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071276", "evidence": [ { "database": "UniProtKB", "id": "P13640", "url": "https://www.uniprot.org/uniprot/P13640" } ], "pmid": "" }, { "name": "cellular response to copper ion", "id": "GO:0071280", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071280", "evidence": [ { "database": "UniProtKB", "id": "P13640", "url": "https://www.uniprot.org/uniprot/P13640" } ], "pmid": "" }, { "name": "detoxification of copper ion", "id": "GO:0010273", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010273", "evidence": [ { "database": "UniProtKB", "id": "P13640", "url": "https://www.uniprot.org/uniprot/P13640" } ], "pmid": "" }, { "name": "intracellular zinc ion homeostasis", "id": "GO:0006882", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006882", "evidence": [ { "database": "UniProtKB", "id": "P13640", "url": "https://www.uniprot.org/uniprot/P13640" } ], "pmid": "" }, { "name": "cellular response to zinc ion", "id": "GO:0071294", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071294", "evidence": [ { "database": "UniProtKB", "id": "P13640", "url": "https://www.uniprot.org/uniprot/P13640" } ], "pmid": "" }, { "name": "negative regulation of growth", "id": "GO:0045926", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045926", "evidence": [ { "database": "UniProtKB", "id": "P13640", "url": "https://www.uniprot.org/uniprot/P13640" } ], "pmid": "" }, { "name": "monocyte differentiation", "id": "GO:0030224", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030224", "evidence": [ { "database": "UniProtKB", "id": "P13640", "url": "https://www.uniprot.org/uniprot/P13640" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P13640", "url": "https://www.uniprot.org/uniprot/P13640" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P13640", "url": "https://www.uniprot.org/uniprot/P13640" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 4, "end_pos": 6, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 59 ], "sequon_annotation_sites": [ { "start_pos": 4, "end_pos": 6 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 38 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }