{ "uniprot_canonical_ac": "P13611-1", "uniprot_ac": "P13611", "uniprot_id": "CSPG2_HUMAN", "mass": { "chemical_mass": 372820.0, "monoisotopic_mass": 372820.0 }, "refseq": { "ac": "NP_001119808", "name": "versican core protein isoform 2 precursor", "summary": "This gene is a member of the aggrecan/versican proteoglycan family. The protein encoded is a large chondroitin sulfate proteoglycan and is a major component of the extracellular matrix. This protein is involved in cell adhesion, proliferation, proliferation, migration and angiogenesis and plays a central role in tissue morphogenesis and maintenance. Mutations in this gene are the cause of Wagner syndrome type 1. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2009].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001119808" }, "gene_names": [ { "name": "VCAN", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P13611", "id": "P13611" }, { "name": "CSPG2; ERVR; GHAP; PG-M; WGN; WGN1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001119808", "id": "NP_001119808" }, { "name": "CSPG2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P13611", "id": "P13611" }, { "name": "VCAN", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001119808", "id": "NP_001119808" } ], "protein_names": [ { "name": "Versican core protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P13611" }, { "name": "Chondroitin sulfate proteoglycan 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13611" }, { "name": "Chondroitin sulfate proteoglycan core protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13611" }, { "name": "GHAP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13611" }, { "name": "Glial hyaluronate-binding protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13611" }, { "name": "Large fibroblast proteoglycan", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13611" }, { "name": "PG-M", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13611" }, { "name": "versican core protein isoform 2 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001119808", "id": "NP_001119808" }, { "name": "versican proteoglycan; versican core protein; glial hyaluronate-binding protein; large fibroblast proteoglycan; chondroitin sulfate proteoglycan core protein 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001119808", "id": "NP_001119808" } ], "function": [ { "annotation": "Identification of mutation gene prognostic biomarker in multiple myeloma through gene panel exome sequencing and transcriptome analysis in Chinese population.", "evidence": [ { "database": "RefSeq", "id": "NP_001119808", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001119808" }, { "database": "PubMed", "id": "37406588", "url": "https://glygen.org/publication/PubMed/37406588" } ] }, { "annotation": "May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611#function" } ] }, { "annotation": "TGF-beta1 dominates stromal fibroblast-mediated EMT via the FAP/VCAN axis in bladder cancer cells. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001119808", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001119808" }, { "database": "PubMed", "id": "37461061", "url": "https://glygen.org/publication/PubMed/37461061" } ] }, { "annotation": "This gene is a member of the aggrecan/versican proteoglycan family. The protein encoded is a large chondroitin sulfate proteoglycan and is a major component of the extracellular matrix. This protein is involved in cell adhesion, proliferation, proliferation, migration and angiogenesis and plays a central role in tissue morphogenesis and maintenance. Mutations in this gene are the cause of Wagner syndrome type 1. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2009].", "evidence": [ { "database": "RefSeq", "id": "NP_001119808", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001119808" } ] }, { "annotation": "V3: an enigmatic isoform of the proteoglycan versican. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_001119808", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001119808" }, { "database": "PubMed", "id": "37399500", "url": "https://glygen.org/publication/PubMed/37399500" } ] } ], "disease": [ { "disease_id": "MONDO:0007740", "recommended_name": { "id": "MONDO:0007740", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007740", "name": "Wagner disease", "description": "Wagner disease is a rare hereditary vitreoretinopathy characterized by an anomaleous vitreous associated with myopia, cataract, chorioretinal atrophy, and peripheral tractional or rhegmatogenous retinal detachment." }, "synonyms": [ { "id": "MONDO:0007740", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007740", "name": "VCAN-related vitreoretinopathy", "description": "" }, { "id": "MONDO:0007740", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007740", "name": "Wagner disease", "description": "" }, { "id": "MONDO:0007740", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007740", "name": "Wagner syndrome", "description": "" }, { "id": "MONDO:0007740", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007740", "name": "dominant hyaloideoretinal dystrophy of Wagner", "description": "" }, { "id": "MONDO:0007740", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007740", "name": "vitreoretinal degeneration, Wagner type", "description": "" }, { "id": "MONDO:0007740", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007740", "name": "ERVR", "description": "" }, { "id": "MONDO:0007740", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007740", "name": "WGN1", "description": "" }, { "id": "MONDO:0007740", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007740", "name": "WGVRP", "description": "" }, { "id": "MONDO:0007740", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007740", "name": "Wagner disease (formerly)", "description": "" }, { "id": "MONDO:0007740", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007740", "name": "Wagner syndrome 1", "description": "" }, { "id": "MONDO:0007740", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007740", "name": "Wagner syndrome type 1", "description": "" }, { "id": "MONDO:0007740", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007740", "name": "Wagner vitreoretinal Degeneration", "description": "" }, { "id": "MONDO:0007740", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007740", "name": "Wagner vitreoretinopathy", "description": "" }, { "id": "MONDO:0007740", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007740", "name": "erosive vitreoretinopathy", "description": "" }, { "id": "MONDO:0007740", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007740", "name": "hyaloideoretinal Degeneration of Wagner", "description": "" }, { "id": "MIM:143200", "resource": "MIM", "url": "https://www.omim.org/entry/143200", "name": "Wagner vitreoretinopathy", "description": "Wagner vitreoretinopathy" } ], "evidence": [ { "id": "143200", "database": "MIM", "url": "https://www.omim.org/entry/143200" } ] } ], "snv": [ { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" }, { "id": "rs377090663", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs377090663" }, { "id": "rs377090663", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs377090663" }, { "id": "rs377090663", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs377090663" }, { "id": "rs377090663", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs377090663#frequency_tab" }, { "id": "rs377090663", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs377090663" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1069, "end_pos": 1069, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 2 out of 6 filters: num. of cancers (3); n-glyco-sequon-gain (DGS->NGS).", "chr_id": "5", "chr_pos": "83521511", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "D1069", "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] }, { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] }, { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 2394, "end_pos": 2394, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "A", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NET->NEA); o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83540183", "ref_nt": "A", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "T2394", "disease": [ { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 2394, "end_pos": 2394, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NET->NEI); o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83540184", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T2394", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs778997926", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778997926" }, { "id": "rs778997926", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778997926" }, { "id": "rs778997926", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778997926" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 2455, "end_pos": 2455, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SST->NST); o-glyco-site-loss (S->N).", "chr_id": "5", "chr_pos": "83540367", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2455", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs773738341", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773738341" }, { "id": "rs773738341", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773738341" }, { "id": "rs773738341", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773738341" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 2791, "end_pos": 2791, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SVT->NVT); o-glyco-site-loss (S->N).", "chr_id": "5", "chr_pos": "83541375", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2791", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1413277452", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1413277452" }, { "id": "rs1413277452", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1413277452" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1001, "end_pos": 1001, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->C).", "chr_id": "5", "chr_pos": "83521308", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1001", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs145963743", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145963743" }, { "id": "rs145963743", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs145963743#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1008, "end_pos": 1008, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DQT->NQT).", "chr_id": "5", "chr_pos": "83521328", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D1008", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1396842109", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1396842109" }, { "id": "rs1396842109", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1396842109#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1015, "end_pos": 1015, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83521349", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1015", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs886060820", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs886060820" }, { "id": "rs886060820", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs886060820" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1023, "end_pos": 1023, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83521373", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1023", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs367806460", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs367806460" }, { "id": "rs367806460", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs367806460" }, { "id": "rs367806460", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs367806460#frequency_tab" }, { "id": "rs367806460", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs367806460" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1027, "end_pos": 1027, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83521385", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1027", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs772914412", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772914412" }, { "id": "rs772914412", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772914412" }, { "id": "rs772914412", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772914412" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1030, "end_pos": 1030, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83539053", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1030", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1281721856", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1281721856" }, { "id": "rs1281721856", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1281721856#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1030, "end_pos": 1030, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->K).", "chr_id": "5", "chr_pos": "83521395", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1030", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs768477797", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768477797" }, { "id": "rs768477797", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768477797" }, { "id": "rs768477797", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768477797" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1031, "end_pos": 1031, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83521397", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1031", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs949580210", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs949580210" }, { "id": "rs949580210", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs949580210" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1031, "end_pos": 1031, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83521398", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1031", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1031, "end_pos": 1031, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "P", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->P).", "chr_id": "5", "chr_pos": "83521397", "ref_nt": "A", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "T1031", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs750510960", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750510960" }, { "id": "rs750510960", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750510960" }, { "id": "rs750510960", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750510960" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1052, "end_pos": 1052, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83521461", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1052", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs999401675", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs999401675" }, { "id": "rs999401675", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs999401675#frequency_tab" }, { "id": "rs999401675", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs999401675" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1074, "end_pos": 1074, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83521527", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1074", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1345172093", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1345172093" }, { "id": "rs1345172093", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1345172093" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1092, "end_pos": 1092, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83521581", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1092", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs750607078", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750607078" }, { "id": "rs750607078", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750607078" }, { "id": "rs750607078", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750607078" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1093, "end_pos": 1093, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).", "chr_id": "5", "chr_pos": "83521583", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1093", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs745510517", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745510517" }, { "id": "rs745510517", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745510517" }, { "id": "rs745510517", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745510517" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1116, "end_pos": 1116, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83521652", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1116", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs147898515", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147898515" }, { "id": "rs147898515", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs147898515#frequency_tab" }, { "id": "rs147898515", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs147898515" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1121, "end_pos": 1121, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83521811", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1121", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1746107309", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1746107309" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1123, "end_pos": 1123, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->R).", "chr_id": "5", "chr_pos": "83521674", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1123", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1400827329", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1400827329" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1123, "end_pos": 1123, "sequence_org": "T", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->null).", "chr_id": "5", "chr_pos": "83521673_83521675", "ref_nt": "l", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1123", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1301371634", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1301371634" }, { "id": "rs1301371634", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1301371634" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1129, "end_pos": 1129, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KVS->NVS).", "chr_id": "5", "chr_pos": "83521693", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K1129", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs749552627", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749552627" }, { "id": "rs749552627", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749552627" }, { "id": "rs749552627", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs749552627#frequency_tab" }, { "id": "rs749552627", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749552627" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 112, "end_pos": 112, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DAS->NAS).", "chr_id": "5", "chr_pos": "83490361", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D112", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs766439672", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766439672" }, { "id": "rs766439672", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766439672" }, { "id": "rs766439672", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766439672" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1140, "end_pos": 1140, "sequence_org": "Y", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (YET->NET).", "chr_id": "5", "chr_pos": "83521724", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "Y1140", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" }, { "id": "rs781121274", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781121274" }, { "id": "rs781121274", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781121274" }, { "id": "rs781121274", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781121274" }, { "id": "rs781121274", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs781121274#frequency_tab" }, { "id": "rs781121274", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781121274" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1146, "end_pos": 1146, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (STT->NTT).", "chr_id": "5", "chr_pos": "83521743", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S1146", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs759723065", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759723065" }, { "id": "rs759723065", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759723065" }, { "id": "rs759723065", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs759723065" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1189, "end_pos": 1189, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KAT->NAT).", "chr_id": "5", "chr_pos": "83521873", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K1189", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs750242480", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750242480" }, { "id": "rs750242480", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750242480" }, { "id": "rs750242480", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750242480#frequency_tab" }, { "id": "rs750242480", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750242480" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1212, "end_pos": 1212, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "5", "chr_pos": "83521940", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1212", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs750242480", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750242480" }, { "id": "rs750242480", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750242480" }, { "id": "rs750242480", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750242480#frequency_tab" }, { "id": "rs750242480", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750242480" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1212, "end_pos": 1212, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "5", "chr_pos": "83521940", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1212", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1366270386", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1366270386" }, { "id": "rs1366270386", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1366270386" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1220, "end_pos": 1220, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).", "chr_id": "5", "chr_pos": "83521964", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1220", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1297457033", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1297457033" }, { "id": "rs1297457033", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1297457033#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1221, "end_pos": 1221, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "5", "chr_pos": "83521968", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1221", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1423605182", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1423605182" }, { "id": "rs1423605182", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1423605182" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1256, "end_pos": 1256, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "5", "chr_pos": "83522072", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1256", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs149651541", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149651541" }, { "id": "rs149651541", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs149651541" }, { "id": "rs149651541", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149651541" }, { "id": "rs149651541", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149651541" }, { "id": "rs149651541", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs149651541#frequency_tab" }, { "id": "rs149651541", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs149651541" }, { "id": "22810696", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22810696" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1261, "end_pos": 1261, "sequence_org": "T", "sequence_mut": "M", "comment": "Somatic mutation passed 1 out of 1 filters: o-glyco-site-loss (T->M).", "chr_id": "5", "chr_pos": "83522232", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1261", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs763152466", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763152466" }, { "id": "rs763152466", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763152466" }, { "id": "rs763152466", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs763152466#frequency_tab" }, { "id": "rs763152466", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763152466" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1262, "end_pos": 1262, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83522091", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1262", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs766266850", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766266850" }, { "id": "rs766266850", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766266850" }, { "id": "rs766266850", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766266850" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1271, "end_pos": 1271, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83522117", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1271", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs544824558", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs544824558" }, { "id": "rs544824558", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs544824558" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1271, "end_pos": 1271, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83522118", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1271", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs947364698", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs947364698" }, { "id": "rs947364698", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs947364698#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1291, "end_pos": 1291, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).", "chr_id": "5", "chr_pos": "83522177", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1291", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1291, "end_pos": 1291, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "R", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->R).", "chr_id": "5", "chr_pos": "83522178", "ref_nt": "C", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "T1291", "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1308, "end_pos": 1308, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "C", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->C).", "chr_id": "5", "chr_pos": "83522229", "ref_nt": "C", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "S1308", "disease": [ { "disease_id": "DOID:4362", "recommended_name": { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical cancer", "description": "A female reproductive organ cancer that is located_in the cervix." }, "synonyms": [ { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical neoplasm", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix uteri cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "neoplasm of uterine cervix", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "tumor of the Cervix Uteri", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer", "description": "A primary or metastatic malignant neoplasm involving the cervix." }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cancer of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer, somatic", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix uteri cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervix cancer", "description": "" }, { "id": "MIM:603956", "resource": "MIM", "url": "https://www.omim.org/entry/603956", "name": "Cervical cancer", "description": "Cervical cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1443911354", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1443911354" }, { "id": "rs1443911354", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1443911354" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1308, "end_pos": 1308, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "5", "chr_pos": "83522229", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1308", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" }, { "id": "rs149651541", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149651541" }, { "id": "rs149651541", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs149651541" }, { "id": "rs149651541", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149651541" }, { "id": "rs149651541", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149651541" }, { "id": "rs149651541", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs149651541#frequency_tab" }, { "id": "rs149651541", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs149651541" }, { "id": "22810696", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22810696" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1309, "end_pos": 1309, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "M", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->M).", "chr_id": "5", "chr_pos": "83522232", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T1309", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ] }, { "evidence": [ { "id": "rs1227374647", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1227374647" }, { "id": "rs1227374647", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1227374647#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1315, "end_pos": 1315, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "5", "chr_pos": "83522250", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1315", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1172026308", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1172026308" }, { "id": "rs1172026308", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1172026308" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 1332, "end_pos": 1332, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).", "chr_id": "5", "chr_pos": "83547993", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N1332", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" }, { "id": "rs1399353079", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1399353079" }, { "id": "rs1399353079", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1399353079" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 1334, "end_pos": 1334, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NKT->NKK).", "chr_id": "5", "chr_pos": "83522307", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "T1334", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 1334, "end_pos": 1334, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "R", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NKT->NKR).", "chr_id": "5", "chr_pos": "83522307", "ref_nt": "C", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "T1334", "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1239633964", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1239633964" }, { "id": "rs1239633964", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1239633964#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 1398, "end_pos": 1398, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->HAT).", "chr_id": "5", "chr_pos": "83537195", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N1398", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1332752846", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1332752846" }, { "id": "rs1332752846", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1332752846" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 1398, "end_pos": 1398, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAT->SAT).", "chr_id": "5", "chr_pos": "83537196", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N1398", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs201388504", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201388504" }, { "id": "rs201388504", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs201388504" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1403, "end_pos": 1403, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83553483", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1403", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1186770708", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1186770708" }, { "id": "rs1186770708", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1186770708" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1403, "end_pos": 1403, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83553484", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1403", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1382210345", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1382210345" }, { "id": "rs1382210345", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1382210345#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1404, "end_pos": 1404, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83537213", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1404", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1369739388", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1369739388" }, { "id": "rs1369739388", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1369739388#frequency_tab" }, { "id": "rs1369739388", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1369739388" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1404, "end_pos": 1404, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83537214", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1404", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1418, "end_pos": 1418, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "A", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83537255", "ref_nt": "A", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "T1418", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1746756536", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1746756536" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1419, "end_pos": 1419, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83537258", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1419", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1282521167", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1282521167" }, { "id": "rs1282521167", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1282521167#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 1442, "end_pos": 1442, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->HFS).", "chr_id": "5", "chr_pos": "83537327", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N1442", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs765589028", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765589028" }, { "id": "rs765589028", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765589028" }, { "id": "rs765589028", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs765589028#frequency_tab" }, { "id": "rs765589028", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765589028" }, { "id": "22895193", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22895193" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 1444, "end_pos": 1444, "sequence_org": "S", "sequence_mut": "L", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->NFL).", "chr_id": "5", "chr_pos": "83537334", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1444", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs765589028", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765589028" }, { "id": "rs765589028", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765589028" }, { "id": "rs765589028", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs765589028#frequency_tab" }, { "id": "rs765589028", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765589028" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 1444, "end_pos": 1444, "sequence_org": "S", "sequence_mut": "W", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->NFW).", "chr_id": "5", "chr_pos": "83537334", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1444", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1445, "end_pos": 1445, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DSS->NSS).", "chr_id": "5", "chr_pos": "83537336", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "D1445", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs868317793", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs868317793" }, { "id": "rs868317793", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs868317793#frequency_tab" }, { "id": "rs868317793", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs868317793" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1449, "end_pos": 1449, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SDT->NDT).", "chr_id": "5", "chr_pos": "83537349", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1449", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs201669036", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201669036" }, { "id": "rs201669036", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs201669036" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1473, "end_pos": 1473, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->K).", "chr_id": "5", "chr_pos": "83537421", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1473", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs763346903", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763346903" }, { "id": "rs763346903", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763346903" }, { "id": "rs763346903", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763346903" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1480, "end_pos": 1480, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83537442", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1480", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs750018598", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750018598" }, { "id": "rs750018598", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750018598" }, { "id": "rs750018598", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750018598" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1537, "end_pos": 1537, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83537613", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1537", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs61754534", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61754534" }, { "id": "rs61754534", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61754534" }, { "id": "rs61754534", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs61754534#frequency_tab" }, { "id": "rs61754534", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs61754534" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1548, "end_pos": 1548, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "5", "chr_pos": "83537646", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1548", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs35443373", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs35443373" }, { "id": "rs35443373", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs35443373" }, { "id": "rs35443373", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs35443373" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1577, "end_pos": 1577, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (STS->NTS).", "chr_id": "5", "chr_pos": "83537733", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1577", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1386946213", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1386946213" }, { "id": "rs1386946213", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1386946213#frequency_tab" }, { "id": "rs1386946213", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1386946213" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1602, "end_pos": 1602, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->N).", "chr_id": "5", "chr_pos": "83537808", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1602", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1348157221", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1348157221" }, { "id": "rs1348157221", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1348157221#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1615, "end_pos": 1615, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83537846", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1615", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1278108656", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1278108656" }, { "id": "rs1278108656", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1278108656" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1615, "end_pos": 1615, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83537847", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1615", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1616, "end_pos": 1616, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "K", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (KES->NES).", "chr_id": "5", "chr_pos": "83537851", "ref_nt": "A", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "K1616", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1231457801", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1231457801" }, { "id": "rs1231457801", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1231457801" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1631, "end_pos": 1631, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "5", "chr_pos": "83537894", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1631", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs771923925", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771923925" }, { "id": "rs771923925", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771923925" }, { "id": "rs771923925", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771923925" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1633, "end_pos": 1633, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SSS->NSS).", "chr_id": "5", "chr_pos": "83537901", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1633", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1399205925", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1399205925" }, { "id": "rs1399205925", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1399205925" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1654, "end_pos": 1654, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83537964", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1654", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs567339457", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs567339457" }, { "id": "rs567339457", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs567339457" }, { "id": "rs567339457", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs567339457" }, { "id": "rs567339457", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs567339457#frequency_tab" }, { "id": "rs567339457", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs567339457" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1688, "end_pos": 1688, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83538066", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T1688", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1710, "end_pos": 1710, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DTS->NTS).", "chr_id": "5", "chr_pos": "83538131", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "D1710", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs754070094", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754070094" }, { "id": "rs754070094", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754070094" }, { "id": "rs754070094", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754070094#frequency_tab" }, { "id": "rs754070094", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754070094" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1716, "end_pos": 1716, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->C).", "chr_id": "5", "chr_pos": "83538150", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1716", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs754070094", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754070094" }, { "id": "rs754070094", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754070094" }, { "id": "rs754070094", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754070094#frequency_tab" }, { "id": "rs754070094", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754070094" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1716, "end_pos": 1716, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "5", "chr_pos": "83538150", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1716", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs113965318", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs113965318" }, { "id": "rs113965318", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs113965318" }, { "id": "rs113965318", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs113965318" }, { "id": "rs113965318", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs113965318#frequency_tab" }, { "id": "rs113965318", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs113965318" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1719, "end_pos": 1719, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83538158", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0.01058", "site_lbl": "T1719", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs768122148", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768122148" }, { "id": "rs768122148", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768122148" }, { "id": "rs768122148", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs768122148#frequency_tab" }, { "id": "rs768122148", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768122148" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1731, "end_pos": 1731, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83538194", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1731", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1731, "end_pos": 1731, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "P", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->P).", "chr_id": "5", "chr_pos": "83538194", "ref_nt": "A", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "T1731", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1203720187", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1203720187" }, { "id": "rs1203720187", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1203720187" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1734, "end_pos": 1734, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83538203", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1734", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" }, { "id": "rs200941140", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200941140" }, { "id": "rs200941140", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200941140" }, { "id": "rs200941140", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200941140" }, { "id": "rs200941140", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200941140#frequency_tab" }, { "id": "rs200941140", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200941140" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1734, "end_pos": 1734, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "M", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->M).", "chr_id": "5", "chr_pos": "83538204", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T1734", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs770967916", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770967916" }, { "id": "rs770967916", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs770967916" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1743, "end_pos": 1743, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "5", "chr_pos": "83538231", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1743", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs561638583", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs561638583" }, { "id": "rs561638583", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs561638583" }, { "id": "rs561638583", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs561638583#frequency_tab" }, { "id": "rs561638583", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs561638583" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1744, "end_pos": 1744, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83538234", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0", "site_lbl": "T1744", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs561638583", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs561638583" }, { "id": "rs561638583", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs561638583" }, { "id": "rs561638583", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs561638583#frequency_tab" }, { "id": "rs561638583", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs561638583" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1744, "end_pos": 1744, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->R).", "chr_id": "5", "chr_pos": "83538234", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0", "site_lbl": "T1744", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" }, { "id": "rs376380721", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs376380721" }, { "id": "rs376380721", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs376380721" }, { "id": "rs376380721", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs376380721" }, { "id": "rs376380721", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs376380721#frequency_tab" }, { "id": "rs376380721", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs376380721" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1747, "end_pos": 1747, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "L", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->L).", "chr_id": "5", "chr_pos": "83538243", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S1747", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs376380721", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs376380721" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1747, "end_pos": 1747, "sequence_org": "S", "sequence_mut": "W", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->W).", "chr_id": "5", "chr_pos": "83538243", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1747", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs781151320", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781151320" }, { "id": "rs781151320", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781151320" }, { "id": "rs781151320", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781151320" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1758, "end_pos": 1758, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "5", "chr_pos": "83538275", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1758", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs748974379", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748974379" }, { "id": "rs748974379", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748974379" }, { "id": "rs748974379", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748974379" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1763, "end_pos": 1763, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->K).", "chr_id": "5", "chr_pos": "83538291", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1763", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1746812214", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1746812214" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1778, "end_pos": 1778, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83538335", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1778", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1344714550", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1344714550" }, { "id": "rs1344714550", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1344714550" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1778, "end_pos": 1778, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83538336", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1778", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1399474673", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1399474673" }, { "id": "rs1399474673", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1399474673#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1806, "end_pos": 1806, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83538419", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1806", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1806, "end_pos": 1806, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83538420", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T1806", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1810, "end_pos": 1810, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->I).", "chr_id": "5", "chr_pos": "83538432", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S1810", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1270257649", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1270257649" }, { "id": "rs1270257649", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1270257649#frequency_tab" }, { "id": "rs1270257649", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1270257649" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1811, "end_pos": 1811, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "5", "chr_pos": "83538435", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1811", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs891555177", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs891555177" }, { "id": "rs891555177", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs891555177#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1847, "end_pos": 1847, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83538542", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1847", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs201704138", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201704138" }, { "id": "rs201704138", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs201704138" }, { "id": "rs201704138", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201704138" }, { "id": "rs201704138", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201704138" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1847, "end_pos": 1847, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83538543", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1847", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs201704138", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201704138" }, { "id": "rs201704138", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs201704138" }, { "id": "rs201704138", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201704138" }, { "id": "rs201704138", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201704138" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1847, "end_pos": 1847, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->N).", "chr_id": "5", "chr_pos": "83538543", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1847", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1242661637", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1242661637" }, { "id": "rs1242661637", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1242661637" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1848, "end_pos": 1848, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83538545", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1848", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1180014038", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1180014038" }, { "id": "rs1180014038", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1180014038#frequency_tab" }, { "id": "rs1180014038", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1180014038" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1880, "end_pos": 1880, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83538641", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1880", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs141477510", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141477510" }, { "id": "rs141477510", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs141477510" }, { "id": "rs141477510", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141477510" }, { "id": "rs141477510", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs141477510#frequency_tab" }, { "id": "rs141477510", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs141477510" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1917, "end_pos": 1917, "sequence_org": "Y", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (Y->C).", "chr_id": "5", "chr_pos": "83538753", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0.003195", "site_lbl": "Y1917", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs141477510", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141477510" }, { "id": "rs141477510", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs141477510" }, { "id": "rs141477510", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141477510" }, { "id": "rs141477510", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs141477510#frequency_tab" }, { "id": "rs141477510", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs141477510" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1917, "end_pos": 1917, "sequence_org": "Y", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (Y->F).", "chr_id": "5", "chr_pos": "83538753", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.003195", "site_lbl": "Y1917", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1746836392", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1746836392" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1933, "end_pos": 1933, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DFS->NFS).", "chr_id": "5", "chr_pos": "83538800", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D1933", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs763788046", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763788046" }, { "id": "rs763788046", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763788046" }, { "id": "rs763788046", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763788046" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1935, "end_pos": 1935, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "5", "chr_pos": "83538807", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1935", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs762857668", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762857668" }, { "id": "rs762857668", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762857668" }, { "id": "rs762857668", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762857668" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1935, "end_pos": 1935, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "5", "chr_pos": "83538806", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1935", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1319949232", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1319949232" }, { "id": "rs1319949232", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1319949232#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1943, "end_pos": 1943, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83538831", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1943", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1945, "end_pos": 1945, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "F", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->F).", "chr_id": "5", "chr_pos": "83538837", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S1945", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1425874327", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1425874327" }, { "id": "rs1425874327", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1425874327" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1973, "end_pos": 1973, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83538920", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1973", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1996, "end_pos": 1996, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->N).", "chr_id": "5", "chr_pos": "83538990", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "T1996", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs772914412", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772914412" }, { "id": "rs772914412", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772914412" }, { "id": "rs772914412", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772914412" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2017, "end_pos": 2017, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83539053", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2017", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1253548750", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1253548750" }, { "id": "rs1253548750", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1253548750#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2020, "end_pos": 2020, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "5", "chr_pos": "83539063", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2020", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs765958183", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765958183" }, { "id": "rs765958183", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765958183" }, { "id": "rs765958183", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765958183" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2021, "end_pos": 2021, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "5", "chr_pos": "83539064", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2021", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2034, "end_pos": 2034, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->Y).", "chr_id": "5", "chr_pos": "83539104", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S2034", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs745971281", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745971281" }, { "id": "rs745971281", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745971281" }, { "id": "rs745971281", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs745971281#frequency_tab" }, { "id": "rs745971281", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745971281" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2036, "end_pos": 2036, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83539109", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2036", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs745971281", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745971281" }, { "id": "rs745971281", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745971281" }, { "id": "rs745971281", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs745971281#frequency_tab" }, { "id": "rs745971281", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745971281" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2036, "end_pos": 2036, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).", "chr_id": "5", "chr_pos": "83539109", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2036", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1301109992", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1301109992" }, { "id": "rs1301109992", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1301109992" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2039, "end_pos": 2039, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->C).", "chr_id": "5", "chr_pos": "83539119", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2039", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2039, "end_pos": 2039, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "F", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->F).", "chr_id": "5", "chr_pos": "83539119", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S2039", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs267600718", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs267600718" }, { "id": "rs267600718", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs267600718" }, { "id": "20016485", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20016485" }, { "id": "rs750543900", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750543900" }, { "id": "rs750543900", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750543900" }, { "id": "rs750543900", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750543900#frequency_tab" }, { "id": "rs750543900", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750543900" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 203, "end_pos": 203, "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DQT->NQT).", "chr_id": "5", "chr_pos": "83493707", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D203", "keywords": [ "ebi", "somatic", "germline" ] }, { "evidence": [ { "id": "rs1234335415", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1234335415" }, { "id": "rs1234335415", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1234335415#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2058, "end_pos": 2058, "sequence_org": "S", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->A).", "chr_id": "5", "chr_pos": "83539175", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2058", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs368052136", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368052136" }, { "id": "rs368052136", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368052136" }, { "id": "rs368052136", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs368052136" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2063, "end_pos": 2063, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83539191", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2063", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs368052136", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368052136" }, { "id": "rs368052136", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368052136" }, { "id": "rs368052136", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs368052136" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2063, "end_pos": 2063, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->K).", "chr_id": "5", "chr_pos": "83539191", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2063", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs772019229", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772019229" }, { "id": "rs772019229", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772019229" }, { "id": "rs772019229", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs772019229#frequency_tab" }, { "id": "rs772019229", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772019229" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2069, "end_pos": 2069, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83539208", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2069", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs371500390", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371500390" }, { "id": "rs371500390", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs371500390" }, { "id": "rs371500390", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371500390" }, { "id": "rs371500390", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371500390#frequency_tab" }, { "id": "rs371500390", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371500390" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2069, "end_pos": 2069, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->M).", "chr_id": "5", "chr_pos": "83539209", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.000399", "site_lbl": "T2069", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs772019229", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772019229" }, { "id": "rs772019229", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772019229" }, { "id": "rs772019229", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs772019229#frequency_tab" }, { "id": "rs772019229", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772019229" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2069, "end_pos": 2069, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).", "chr_id": "5", "chr_pos": "83539208", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2069", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1188185859", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1188185859" }, { "id": "rs1188185859", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1188185859" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2091, "end_pos": 2091, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83539274", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2091", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1424868389", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1424868389" }, { "id": "rs1424868389", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1424868389" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 2112, "end_pos": 2112, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SET->NET).", "chr_id": "5", "chr_pos": "83539338", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2112", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 2133, "end_pos": 2133, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "P", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NSP->NST).", "chr_id": "5", "chr_pos": "83539400", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "P2133", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1287405000", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1287405000" }, { "id": "rs1287405000", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1287405000#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2135, "end_pos": 2135, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83539406", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2135", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1580045942", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1580045942" }, { "id": "rs1580045942", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1580045942" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2135, "end_pos": 2135, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83539407", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2135", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2144, "end_pos": 2144, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "A", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83539433", "ref_nt": "A", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "T2144", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1262639975", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1262639975" }, { "id": "rs1262639975", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1262639975" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2144, "end_pos": 2144, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83539434", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2144", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs371992747", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371992747" }, { "id": "rs371992747", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371992747" }, { "id": "rs371992747", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs371992747#frequency_tab" }, { "id": "rs371992747", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs371992747" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2153, "end_pos": 2153, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83539460", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2153", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs374880165", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374880165" }, { "id": "rs374880165", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374880165" }, { "id": "rs374880165", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs374880165#frequency_tab" }, { "id": "rs374880165", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs374880165" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2159, "end_pos": 2159, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83539479", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2159", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs369268448", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369268448" }, { "id": "rs369268448", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369268448" }, { "id": "rs369268448", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs369268448#frequency_tab" }, { "id": "rs369268448", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs369268448" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2160, "end_pos": 2160, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->K).", "chr_id": "5", "chr_pos": "83539482", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2160", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1489718469", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1489718469" }, { "id": "rs1489718469", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1489718469" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 2181, "end_pos": 2181, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMS->NMC).", "chr_id": "5", "chr_pos": "83539545", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2181", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1489718469", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1489718469" }, { "id": "rs1489718469", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1489718469" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 2181, "end_pos": 2181, "sequence_org": "S", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMS->NMY).", "chr_id": "5", "chr_pos": "83539545", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2181", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs774010660", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774010660" }, { "id": "rs774010660", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774010660" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2194, "end_pos": 2194, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83539583", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2194", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs747561816", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747561816" }, { "id": "rs747561816", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747561816" }, { "id": "rs747561816", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs747561816#frequency_tab" }, { "id": "rs747561816", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747561816" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2194, "end_pos": 2194, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83539584", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2194", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1580046309", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1580046309" }, { "id": "rs1580046309", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1580046309" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2200, "end_pos": 2200, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83539602", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2200", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1392189089", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1392189089" }, { "id": "rs1392189089", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1392189089#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2203, "end_pos": 2203, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "5", "chr_pos": "83539611", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2203", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1265627926", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1265627926" }, { "id": "rs1265627926", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1265627926#frequency_tab" }, { "id": "rs1265627926", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1265627926" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2213, "end_pos": 2213, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83539640", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2213", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1561256681", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1561256681" }, { "id": "rs1561256681", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1561256681" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2254, "end_pos": 2254, "sequence_org": "S", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->A).", "chr_id": "5", "chr_pos": "83539763", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2254", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs764072946", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764072946" }, { "id": "rs764072946", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764072946" }, { "id": "rs764072946", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764072946" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2254, "end_pos": 2254, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->C).", "chr_id": "5", "chr_pos": "83539764", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2254", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs746473196", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746473196" }, { "id": "rs746473196", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746473196" }, { "id": "rs746473196", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746473196#frequency_tab" }, { "id": "rs746473196", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746473196" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 2274, "end_pos": 2274, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->NFA).", "chr_id": "5", "chr_pos": "83539823", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2274", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs746473196", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746473196" }, { "id": "rs746473196", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746473196" }, { "id": "rs746473196", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746473196#frequency_tab" }, { "id": "rs746473196", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746473196" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 2274, "end_pos": 2274, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->NFP).", "chr_id": "5", "chr_pos": "83539823", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2274", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs770126619", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770126619" }, { "id": "rs770126619", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770126619" }, { "id": "rs770126619", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770126619" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 2280, "end_pos": 2280, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->KNT).", "chr_id": "5", "chr_pos": "83539843", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N2280", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs996154023", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs996154023" }, { "id": "rs996154023", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs996154023#frequency_tab" }, { "id": "rs996154023", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs996154023" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 2280, "end_pos": 2280, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->SNT).", "chr_id": "5", "chr_pos": "83539842", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N2280", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs886044566", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs886044566" }, { "id": "rs886044566", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs886044566" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 2282, "end_pos": 2282, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->NNA).", "chr_id": "5", "chr_pos": "83539847", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2282", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs753027786", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753027786" }, { "id": "rs753027786", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753027786" }, { "id": "rs753027786", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753027786" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 2304, "end_pos": 2304, "sequence_org": "M", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NRM->NRT).", "chr_id": "5", "chr_pos": "83539914", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "M2304", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs772149513", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772149513" }, { "id": "rs772149513", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772149513" }, { "id": "rs772149513", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs772149513#frequency_tab" }, { "id": "rs772149513", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772149513" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 2337, "end_pos": 2337, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SDT->NDT).", "chr_id": "5", "chr_pos": "83540013", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2337", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs765414121", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765414121" }, { "id": "rs765414121", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765414121" }, { "id": "rs765414121", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765414121" }, { "id": "rs765414121", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs765414121#frequency_tab" }, { "id": "rs765414121", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765414121" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2345, "end_pos": 2345, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->M).", "chr_id": "5", "chr_pos": "83540037", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2345", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2353, "end_pos": 2353, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "M", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "5", "chr_pos": "83540061", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T2353", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs747960971", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747960971" }, { "id": "rs747960971", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747960971" }, { "id": "rs747960971", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs747960971#frequency_tab" }, { "id": "rs747960971", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747960971" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 2360, "end_pos": 2360, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->SQT).", "chr_id": "5", "chr_pos": "83540082", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N2360", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs372717498", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372717498" }, { "id": "rs372717498", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372717498" }, { "id": "rs372717498", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs372717498#frequency_tab" }, { "id": "rs372717498", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs372717498" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 2362, "end_pos": 2362, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->NQN).", "chr_id": "5", "chr_pos": "83540088", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2362", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 2384, "end_pos": 2384, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "K", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (KNS->NNS).", "chr_id": "5", "chr_pos": "83540155", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "K2384", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1463318267", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1463318267" }, { "id": "rs1463318267", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1463318267#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 2385, "end_pos": 2385, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->KSS).", "chr_id": "5", "chr_pos": "83540158", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N2385", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1212010124", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1212010124" }, { "id": "rs1212010124", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1212010124" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2395, "end_pos": 2395, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83540187", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2395", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs201401506", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201401506" }, { "id": "rs201401506", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201401506#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2396, "end_pos": 2396, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83540190", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2396", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1441191636", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1441191636" }, { "id": "rs1441191636", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1441191636#frequency_tab" }, { "id": "rs1441191636", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1441191636" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2416, "end_pos": 2416, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83540250", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2416", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1746915479", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1746915479" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2417, "end_pos": 2417, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "5", "chr_pos": "83540252", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2417", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs745845546", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745845546" }, { "id": "rs745845546", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745845546" }, { "id": "rs745845546", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745845546" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2448, "end_pos": 2448, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83540346", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2448", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs745845546", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745845546" }, { "id": "rs745845546", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745845546" }, { "id": "rs745845546", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745845546" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2448, "end_pos": 2448, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->N).", "chr_id": "5", "chr_pos": "83540346", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2448", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2455, "end_pos": 2455, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->I).", "chr_id": "5", "chr_pos": "83540367", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S2455", "disease": [ { "disease_id": "DOID:1115", "recommended_name": { "id": "DOID:1115", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1115", "name": "sarcoma", "description": "A cell type cancer that has_material_basis_in abnormally proliferating cells derives from embryonic mesoderm." }, "synonyms": [ { "id": "DOID:1115", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1115", "name": "connective and soft tissue neoplasm", "description": "" }, { "id": "DOID:1115", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1115", "name": "tumor of soft tissue and skeleton", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2455, "end_pos": 2455, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "R", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->R).", "chr_id": "5", "chr_pos": "83540368", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S2455", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs772295394", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772295394" }, { "id": "rs772295394", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772295394" }, { "id": "rs772295394", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs772295394#frequency_tab" }, { "id": "rs772295394", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772295394" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2456, "end_pos": 2456, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->C).", "chr_id": "5", "chr_pos": "83540369", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2456", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs772295394", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772295394" }, { "id": "rs772295394", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772295394" }, { "id": "rs772295394", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs772295394#frequency_tab" }, { "id": "rs772295394", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772295394" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2456, "end_pos": 2456, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "5", "chr_pos": "83540369", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2456", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2458, "end_pos": 2458, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "A", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83540375", "ref_nt": "A", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "T2458", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1341136100", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1341136100" }, { "id": "rs1341136100", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1341136100" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2458, "end_pos": 2458, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83540376", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2458", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs956586027", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs956586027" }, { "id": "rs956586027", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs956586027" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 2462, "end_pos": 2462, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DGS->NGS).", "chr_id": "5", "chr_pos": "83540387", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D2462", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs61754536", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61754536" }, { "id": "rs61754536", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs61754536" }, { "id": "rs61754536", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61754536" }, { "id": "rs61754536", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs61754536#frequency_tab" }, { "id": "rs61754536", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs61754536" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2473, "end_pos": 2473, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "5", "chr_pos": "83540422", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0.004992", "site_lbl": "S2473", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 2496, "end_pos": 2496, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "N", "sequence_mut": "D", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NKS->DKS).", "chr_id": "5", "chr_pos": "83540489", "ref_nt": "A", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "N2496", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs763749021", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763749021" }, { "id": "rs763749021", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763749021" }, { "id": "rs763749021", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs763749021#frequency_tab" }, { "id": "rs763749021", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763749021" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 2496, "end_pos": 2496, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->KKS).", "chr_id": "5", "chr_pos": "83540491", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N2496", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs761405097", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761405097" }, { "id": "rs761405097", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761405097" }, { "id": "rs761405097", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761405097#frequency_tab" }, { "id": "rs761405097", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761405097" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 2498, "end_pos": 2498, "sequence_org": "S", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->NKI).", "chr_id": "5", "chr_pos": "83540496", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2498", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 2498, "end_pos": 2498, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NKS->NKN).", "chr_id": "5", "chr_pos": "83540496", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S2498", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs767297152", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767297152" }, { "id": "rs767297152", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767297152" }, { "id": "rs767297152", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs767297152#frequency_tab" }, { "id": "rs767297152", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767297152" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 2498, "end_pos": 2498, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKS->NKR).", "chr_id": "5", "chr_pos": "83540497", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2498", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2503, "end_pos": 2503, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "A", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83540510", "ref_nt": "A", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "T2503", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1457765669", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1457765669" }, { "id": "rs1457765669", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1457765669" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2503, "end_pos": 2503, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83540511", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2503", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs781559384", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781559384" }, { "id": "rs781559384", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs781559384" }, { "id": "rs781559384", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs781559384" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2515, "end_pos": 2515, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->C).", "chr_id": "5", "chr_pos": "83540547", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2515", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs746235751", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746235751" }, { "id": "rs746235751", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746235751" }, { "id": "rs746235751", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746235751#frequency_tab" }, { "id": "rs746235751", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746235751" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2516, "end_pos": 2516, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83540549", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2516", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs79327411", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs79327411" }, { "id": "rs79327411", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs79327411" }, { "id": "rs79327411", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs79327411" }, { "id": "rs79327411", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs79327411#frequency_tab" }, { "id": "rs79327411", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs79327411" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2516, "end_pos": 2516, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83540550", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.000599", "site_lbl": "T2516", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1357394432", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1357394432" }, { "id": "rs1357394432", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1357394432" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2530, "end_pos": 2530, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "5", "chr_pos": "83540591", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2530", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1009437763", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1009437763" }, { "id": "rs1009437763", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1009437763" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2540, "end_pos": 2540, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83540622", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2540", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs764183248", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764183248" }, { "id": "rs764183248", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764183248" }, { "id": "rs764183248", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764183248" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2540, "end_pos": 2540, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).", "chr_id": "5", "chr_pos": "83540621", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2540", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2571, "end_pos": 2571, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83540715", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T2571", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs149032014", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149032014" }, { "id": "rs149032014", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs149032014" }, { "id": "rs149032014", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149032014" }, { "id": "rs149032014", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs149032014#frequency_tab" }, { "id": "rs149032014", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs149032014" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2572, "end_pos": 2572, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "5", "chr_pos": "83540718", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "S2572", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs780511968", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780511968" }, { "id": "rs780511968", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780511968" }, { "id": "rs780511968", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780511968" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 2610, "end_pos": 2610, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DES->NES).", "chr_id": "5", "chr_pos": "83540831", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D2610", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs755439783", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755439783" }, { "id": "rs755439783", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755439783" }, { "id": "rs755439783", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755439783#frequency_tab" }, { "id": "rs755439783", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755439783" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 2615, "end_pos": 2615, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DST->NST).", "chr_id": "5", "chr_pos": "83540846", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D2615", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs201327923", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201327923" }, { "id": "rs201327923", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs201327923" }, { "id": "rs201327923", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201327923" }, { "id": "rs201327923", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201327923#frequency_tab" }, { "id": "rs201327923", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201327923" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 2628, "end_pos": 2628, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->KLS).", "chr_id": "5", "chr_pos": "83540887", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "N2628", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1211231666", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1211231666" }, { "id": "rs1211231666", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1211231666" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 2652, "end_pos": 2652, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DES->NES).", "chr_id": "5", "chr_pos": "83540957", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D2652", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs756823982", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756823982" }, { "id": "rs756823982", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756823982" }, { "id": "rs756823982", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs756823982#frequency_tab" }, { "id": "rs756823982", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs756823982" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2656, "end_pos": 2656, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83540969", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2656", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs150166604", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs150166604" }, { "id": "rs150166604", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs150166604" }, { "id": "rs150166604", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs150166604#frequency_tab" }, { "id": "rs150166604", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs150166604" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2656, "end_pos": 2656, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83540970", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2656", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1402773257", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1402773257" }, { "id": "rs1402773257", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1402773257#frequency_tab" }, { "id": "rs1402773257", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1402773257" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2661, "end_pos": 2661, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "5", "chr_pos": "83540984", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2661", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2661, "end_pos": 2661, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->N).", "chr_id": "5", "chr_pos": "83540985", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S2661", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1387105957", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1387105957" }, { "id": "rs1387105957", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1387105957#frequency_tab" }, { "id": "rs1402773257", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1402773257" }, { "id": "rs1402773257", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1402773257#frequency_tab" }, { "id": "rs1402773257", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1402773257" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2661, "end_pos": 2661, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "5", "chr_pos": "83540986", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2661", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs61733390", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61733390" }, { "id": "rs61733390", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs61733390" }, { "id": "rs61733390", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61733390" }, { "id": "rs61733390", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs61733390#frequency_tab" }, { "id": "rs61733390", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs61733390" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2671, "end_pos": 2671, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83541015", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.001398", "site_lbl": "T2671", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs61733390", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61733390" }, { "id": "rs61733390", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs61733390" }, { "id": "rs61733390", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61733390" }, { "id": "rs61733390", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs61733390#frequency_tab" }, { "id": "rs61733390", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs61733390" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2671, "end_pos": 2671, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->K).", "chr_id": "5", "chr_pos": "83541015", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.001398", "site_lbl": "T2671", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1434129544", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1434129544" }, { "id": "rs1434129544", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1434129544#frequency_tab" }, { "id": "rs1434129544", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1434129544" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2691, "end_pos": 2691, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83541075", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2691", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs763286067", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763286067" }, { "id": "rs763286067", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763286067" }, { "id": "rs763286067", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763286067" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2699, "end_pos": 2699, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "5", "chr_pos": "83541099", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2699", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1197311115", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1197311115" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2701, "end_pos": 2701, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83541105", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2701", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1197311115", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1197311115" }, { "id": "rs1197311115", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1197311115" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2701, "end_pos": 2701, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->K).", "chr_id": "5", "chr_pos": "83541105", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2701", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2723, "end_pos": 2723, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->I).", "chr_id": "5", "chr_pos": "83541171", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S2723", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1561258611", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1561258611" }, { "id": "rs1561258611", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1561258611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2723, "end_pos": 2723, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "5", "chr_pos": "83541171", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2723", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs778883363", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778883363" }, { "id": "rs778883363", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778883363" }, { "id": "rs778883363", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778883363#frequency_tab" }, { "id": "rs778883363", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778883363" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2723, "end_pos": 2723, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "5", "chr_pos": "83541172", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2723", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" }, { "id": "rs745955605", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745955605" }, { "id": "rs745955605", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745955605" }, { "id": "rs745955605", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745955605" }, { "id": "rs745955605", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745955605" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 2733, "end_pos": 2733, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DQS->NQS).", "chr_id": "5", "chr_pos": "83541200", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "D2733", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ] }, { "evidence": [ { "id": "rs1485725400", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1485725400" }, { "id": "rs1485725400", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1485725400#frequency_tab" }, { "id": "rs1485725400", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1485725400" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2760, "end_pos": 2760, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->C).", "chr_id": "5", "chr_pos": "83541282", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2760", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1485725400", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1485725400" }, { "id": "rs1485725400", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1485725400#frequency_tab" }, { "id": "rs1485725400", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1485725400" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2760, "end_pos": 2760, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "5", "chr_pos": "83541282", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2760", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1226021119", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1226021119" }, { "id": "rs1226021119", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1226021119#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2781, "end_pos": 2781, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "5", "chr_pos": "83541345", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2781", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1226079483", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1226079483" }, { "id": "rs1226079483", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1226079483" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2785, "end_pos": 2785, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83541357", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2785", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs761118884", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761118884" }, { "id": "rs761118884", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761118884" }, { "id": "rs761118884", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761118884#frequency_tab" }, { "id": "rs761118884", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761118884" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2791, "end_pos": 2791, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "5", "chr_pos": "83541376", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2791", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs776293278", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776293278" }, { "id": "rs776293278", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776293278" }, { "id": "rs776293278", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776293278" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2793, "end_pos": 2793, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83541380", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2793", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs139471788", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139471788" }, { "id": "rs139471788", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs139471788" }, { "id": "rs139471788", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139471788" }, { "id": "rs139471788", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs139471788#frequency_tab" }, { "id": "rs139471788", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs139471788" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 2809, "end_pos": 2809, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DTT->NTT).", "chr_id": "5", "chr_pos": "83541428", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.000399", "site_lbl": "D2809", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1036832714", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1036832714" }, { "id": "rs1036832714", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1036832714" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2811, "end_pos": 2811, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83541434", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2811", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" }, { "id": "rs759103599", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759103599" }, { "id": "rs759103599", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759103599" }, { "id": "rs759103599", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759103599" }, { "id": "rs759103599", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs759103599" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2826, "end_pos": 2826, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "L", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->L).", "chr_id": "5", "chr_pos": "83541480", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S2826", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ] }, { "evidence": [ { "id": "rs955434648", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs955434648" }, { "id": "rs955434648", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs955434648#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2827, "end_pos": 2827, "sequence_org": "S", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->Y).", "chr_id": "5", "chr_pos": "83541483", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2827", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs762541461", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762541461" }, { "id": "rs762541461", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762541461" }, { "id": "rs762541461", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762541461" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2830, "end_pos": 2830, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83541492", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2830", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" }, { "id": "rs1373649150", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1373649150" }, { "id": "rs1373649150", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1373649150" }, { "id": "rs1373649150", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1373649150#frequency_tab" }, { "id": "rs1373649150", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1373649150" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2847, "end_pos": 2847, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "G", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->G).", "chr_id": "5", "chr_pos": "83541542", "ref_nt": "A", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "S2847", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs1392909335", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1392909335" }, { "id": "rs1392909335", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1392909335" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2856, "end_pos": 2856, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "5", "chr_pos": "83541570", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2856", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1397075309", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1397075309" }, { "id": "rs1397075309", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1397075309" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2860, "end_pos": 2860, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "5", "chr_pos": "83541582", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2860", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2860, "end_pos": 2860, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->Y).", "chr_id": "5", "chr_pos": "83541582", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S2860", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs564945051", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs564945051" }, { "id": "rs564945051", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs564945051" }, { "id": "rs564945051", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs564945051" }, { "id": "rs564945051", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs564945051" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2875, "end_pos": 2875, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83541626", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T2875", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs751856883", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751856883" }, { "id": "rs751856883", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751856883" }, { "id": "rs751856883", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs751856883#frequency_tab" }, { "id": "rs751856883", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751856883" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2879, "end_pos": 2879, "sequence_org": "S", "sequence_mut": "*", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->*).", "chr_id": "5", "chr_pos": "83541639", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2879", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs751856883", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751856883" }, { "id": "rs751856883", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751856883" }, { "id": "rs751856883", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs751856883#frequency_tab" }, { "id": "rs751856883", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751856883" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2879, "end_pos": 2879, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "5", "chr_pos": "83541639", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2879", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1212398617", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1212398617" }, { "id": "rs1212398617", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1212398617" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 2934, "end_pos": 2934, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->YKT).", "chr_id": "5", "chr_pos": "83541803", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N2934", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs148263424", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs148263424" }, { "id": "rs148263424", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs148263424" }, { "id": "rs148263424", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs148263424" }, { "id": "rs148263424", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs148263424#frequency_tab" }, { "id": "rs148263424", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs148263424" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2958, "end_pos": 2958, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83541876", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.000998", "site_lbl": "T2958", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2977, "end_pos": 2977, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->Y).", "chr_id": "5", "chr_pos": "83541933", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S2977", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1201226006", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1201226006" }, { "id": "rs1201226006", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1201226006" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2981, "end_pos": 2981, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "5", "chr_pos": "83541944", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2981", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs756880346", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756880346" }, { "id": "rs756880346", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756880346" }, { "id": "rs756880346", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs756880346#frequency_tab" }, { "id": "rs756880346", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs756880346" }, { "id": "22610119", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22610119" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 3003, "end_pos": 3003, "sequence_org": "T", "sequence_mut": "M", "comment": "Somatic mutation passed 1 out of 1 filters: o-glyco-site-loss (T->M).", "chr_id": "5", "chr_pos": "83542011", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T3003", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs1212054791", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1212054791" }, { "id": "rs1212054791", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1212054791" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 3006, "end_pos": 3006, "sequence_org": "S", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->Y).", "chr_id": "5", "chr_pos": "83542020", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S3006", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 3023, "end_pos": 3023, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DST->NST).", "chr_id": "5", "chr_pos": "83542070", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "D3023", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs757872221", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757872221" }, { "id": "rs757872221", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757872221" }, { "id": "rs757872221", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757872221" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 3024, "end_pos": 3024, "sequence_org": "S", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->Y).", "chr_id": "5", "chr_pos": "83542074", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S3024", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs367904766", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs367904766" }, { "id": "rs367904766", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs367904766" }, { "id": "rs367904766", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs367904766#frequency_tab" }, { "id": "rs367904766", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs367904766" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 3025, "end_pos": 3025, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->M).", "chr_id": "5", "chr_pos": "83542077", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T3025", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1265659118", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1265659118" }, { "id": "rs1265659118", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1265659118" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 3029, "end_pos": 3029, "sequence_org": "S", "sequence_mut": "*", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->*).", "chr_id": "5", "chr_pos": "83542089", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S3029", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1265659118", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1265659118" }, { "id": "rs1265659118", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1265659118" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 3029, "end_pos": 3029, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "5", "chr_pos": "83542089", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S3029", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs753158938", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753158938" }, { "id": "rs753158938", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753158938" }, { "id": "rs753158938", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753158938" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 3045, "end_pos": 3045, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83542136", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T3045", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs73148633", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs73148633" }, { "id": "rs73148633", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs73148633" }, { "id": "rs73148633", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs73148633" }, { "id": "rs73148633", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs73148633" }, { "id": "rs73148633", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs73148633#frequency_tab" }, { "id": "rs73148633", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs73148633" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 3045, "end_pos": 3045, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83542137", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T3045", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs73148633", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs73148633" }, { "id": "rs73148633", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs73148633" }, { "id": "rs73148633", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs73148633" }, { "id": "rs73148633", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs73148633#frequency_tab" }, { "id": "rs73148633", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs73148633" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 3045, "end_pos": 3045, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->K).", "chr_id": "5", "chr_pos": "83542137", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T3045", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs73148633", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs73148633" }, { "id": "rs73148633", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs73148633" }, { "id": "rs73148633", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs73148633" }, { "id": "rs73148633", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs73148633#frequency_tab" }, { "id": "rs73148633", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs73148633" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 3045, "end_pos": 3045, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->R).", "chr_id": "5", "chr_pos": "83542137", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T3045", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1180337461", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1180337461" }, { "id": "rs1180337461", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1180337461" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 3069, "end_pos": 3069, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->NEA).", "chr_id": "5", "chr_pos": "83542208", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T3069", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1006291562", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1006291562" }, { "id": "rs1006291562", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1006291562" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 3069, "end_pos": 3069, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->NER).", "chr_id": "5", "chr_pos": "83542209", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T3069", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" }, { "id": "rs746105412", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746105412" }, { "id": "rs746105412", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746105412" }, { "id": "rs746105412", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746105412" }, { "id": "rs746105412", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs746105412#frequency_tab" }, { "id": "rs746105412", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746105412" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 3083, "end_pos": 3083, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "M", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->M).", "chr_id": "5", "chr_pos": "83542251", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T3083", "disease": [ { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs1405125242", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1405125242" }, { "id": "rs1405125242", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1405125242#frequency_tab" }, { "id": "rs1405125242", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1405125242" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 3102, "end_pos": 3102, "sequence_org": "G", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NGG->NGS).", "chr_id": "5", "chr_pos": "83545575", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "G3102", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1450755250", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1450755250" }, { "id": "rs1450755250", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1450755250" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 3255, "end_pos": 3255, "sequence_org": "P", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NQP->NQT).", "chr_id": "5", "chr_pos": "83572443", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P3255", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs766056072", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766056072" }, { "id": "rs766056072", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766056072" }, { "id": "rs766056072", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766056072" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 332, "end_pos": 332, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->NQI).", "chr_id": "5", "chr_pos": "83512349", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T332", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs766056072", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766056072" }, { "id": "rs766056072", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766056072" }, { "id": "rs766056072", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766056072" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 332, "end_pos": 332, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->NQR).", "chr_id": "5", "chr_pos": "83512349", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T332", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1208321423", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1208321423" }, { "id": "rs1208321423", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1208321423" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 3355, "end_pos": 3355, "sequence_org": "P", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPS->NLS).", "chr_id": "5", "chr_pos": "83580307", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P3355", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" }, { "id": "rs572990120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs572990120" }, { "id": "rs572990120", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs572990120" }, { "id": "rs572990120", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs572990120" }, { "id": "rs572990120", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs572990120" }, { "id": "rs572990120", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs572990120#frequency_tab" }, { "id": "rs572990120", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs572990120" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 3355, "end_pos": 3355, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "P", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NPS->NSS).", "chr_id": "5", "chr_pos": "83580162", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "P3355", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 3355, "end_pos": 3355, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "P", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NPS->NTS).", "chr_id": "5", "chr_pos": "83580162", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "P3355", "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 3368, "end_pos": 3368, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "K", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (KNS->NNS).", "chr_id": "5", "chr_pos": "83580347", "ref_nt": "A", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "K3368", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" }, { "id": "rs757285561", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757285561" }, { "id": "rs757285561", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757285561" }, { "id": "rs757285561", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757285561" }, { "id": "rs757285561", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757285561" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 3369, "end_pos": 3369, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "N", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NSS->HSS).", "chr_id": "5", "chr_pos": "83580348", "ref_nt": "A", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "N3369", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 3369, "end_pos": 3369, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NSS->KSS).", "chr_id": "5", "chr_pos": "83580350", "ref_nt": "T", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "N3369", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1471664584", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1471664584" }, { "id": "rs1471664584", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1471664584" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 3369, "end_pos": 3369, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "5", "chr_pos": "83580349", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N3369", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 3371, "end_pos": 3371, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "L", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NSS->NSL).", "chr_id": "5", "chr_pos": "83580355", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S3371", "disease": [ { "disease_id": "DOID:1793", "recommended_name": { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic cancer", "description": "An endocrine gland cancer located_in the pancreas." }, "synonyms": [ { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca body of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca head of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca tail of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of body of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of head of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of tail of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreas neoplasm", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic neoplasm", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic tumor", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1359331141", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1359331141" }, { "id": "rs1359331141", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1359331141" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 3378, "end_pos": 3378, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSI->NST).", "chr_id": "5", "chr_pos": "83580376", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I3378", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs769106432", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769106432" }, { "id": "rs769106432", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769106432" }, { "id": "rs769106432", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769106432" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 3379, "end_pos": 3379, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->HTS).", "chr_id": "5", "chr_pos": "83580378", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N3379", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1360523104", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1360523104" }, { "id": "rs1360523104", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1360523104" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 3381, "end_pos": 3381, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->NTP).", "chr_id": "5", "chr_pos": "83580384", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S3381", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" }, { "id": "rs143128206", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143128206" }, { "id": "rs143128206", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs143128206" }, { "id": "rs143128206", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143128206" }, { "id": "rs143128206", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143128206" }, { "id": "rs143128206", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs143128206#frequency_tab" }, { "id": "rs143128206", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs143128206" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 355, "end_pos": 355, "subjects_tested": "443", "subjects_positive": "1", "frequency": "0.2", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DLS->NLS). In dbSNP: rs143128206.", "chr_id": "5", "chr_pos": "83519369", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "D355", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [], "start_pos": 360, "end_pos": 360, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "A", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "5", "chr_pos": "83519384", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "A360", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] }, { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs868622388", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs868622388" }, { "id": "rs868622388", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs868622388" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 376, "end_pos": 376, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DRT->NRT).", "chr_id": "5", "chr_pos": "83519432", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D376", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1450280825", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1450280825" }, { "id": "rs1450280825", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1450280825#frequency_tab" }, { "id": "rs1450280825", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1450280825" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 393, "end_pos": 393, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83519483", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T393", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs766777035", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766777035" }, { "id": "rs766777035", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766777035" }, { "id": "rs766777035", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs766777035#frequency_tab" }, { "id": "rs766777035", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766777035" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 438, "end_pos": 438, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DYS->NYS).", "chr_id": "5", "chr_pos": "83519618", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D438", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs368696727", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368696727" }, { "id": "rs368696727", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs368696727" }, { "id": "rs368696727", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs368696727#frequency_tab" }, { "id": "rs368696727", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs368696727" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 442, "end_pos": 442, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->C).", "chr_id": "5", "chr_pos": "83519631", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S442", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" }, { "id": "rs868317793", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs868317793" }, { "id": "rs868317793", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs868317793#frequency_tab" }, { "id": "rs868317793", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs868317793" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 462, "end_pos": 462, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (STT->NTT).", "chr_id": "5", "chr_pos": "83519691", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S462", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs747793450", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747793450" }, { "id": "rs747793450", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747793450" }, { "id": "rs747793450", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747793450" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 464, "end_pos": 464, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83519697", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T464", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs528488016", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs528488016" }, { "id": "rs528488016", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs528488016" }, { "id": "rs528488016", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs528488016#frequency_tab" }, { "id": "rs528488016", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs528488016" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 471, "end_pos": 471, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->M).", "chr_id": "5", "chr_pos": "83519718", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T471", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1390722075", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1390722075" }, { "id": "rs1390722075", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1390722075" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 500, "end_pos": 500, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83519805", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T500", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs756803099", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756803099" }, { "id": "rs756803099", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756803099" }, { "id": "rs756803099", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs756803099" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 516, "end_pos": 516, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).", "chr_id": "5", "chr_pos": "83519852", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T516", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1561243463", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1561243463" }, { "id": "rs1561243463", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1561243463" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 522, "end_pos": 522, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83519871", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T522", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1386848087", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1386848087" }, { "id": "rs1386848087", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1386848087" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 538, "end_pos": 538, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TVS->NVS).", "chr_id": "5", "chr_pos": "83519919", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T538", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1580627364", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1580627364" }, { "id": "rs1580627364", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1580627364" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 544, "end_pos": 544, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83520080", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T544", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs536252273", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs536252273" }, { "id": "rs536252273", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs536252273" }, { "id": "rs536252273", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs536252273" }, { "id": "rs536252273", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs536252273#frequency_tab" }, { "id": "rs536252273", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs536252273" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 544, "end_pos": 544, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83520081", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.001198", "site_lbl": "T544", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1482034579", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1482034579" }, { "id": "rs1482034579", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1482034579#frequency_tab" }, { "id": "rs1482034579", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1482034579" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 551, "end_pos": 551, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83519958", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T551", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs760401724", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760401724" }, { "id": "rs760401724", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs760401724" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 563, "end_pos": 563, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->R).", "chr_id": "5", "chr_pos": "83519994", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T563", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 566, "end_pos": 566, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "F", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->F).", "chr_id": "5", "chr_pos": "83520003", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S566", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs759634176", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759634176" }, { "id": "rs759634176", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759634176" }, { "id": "rs759634176", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs759634176#frequency_tab" }, { "id": "rs759634176", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs759634176" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 567, "end_pos": 567, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DES->NES).", "chr_id": "5", "chr_pos": "83537663", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D567", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 569, "end_pos": 569, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->I).", "chr_id": "5", "chr_pos": "83520012", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S569", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1333450409", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1333450409" }, { "id": "rs1333450409", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1333450409#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 569, "end_pos": 569, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "5", "chr_pos": "83520012", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S569", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs766131650", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766131650" }, { "id": "rs766131650", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766131650" }, { "id": "rs766131650", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs766131650#frequency_tab" }, { "id": "rs766131650", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766131650" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 569, "end_pos": 569, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "5", "chr_pos": "83520013", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S569", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 57, "end_pos": 57, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "N", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTS->ITS).", "chr_id": "5", "chr_pos": "83490197", "ref_nt": "A", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "N57", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1580627339", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1580627339" }, { "id": "rs1580627339", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1580627339" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 589, "end_pos": 589, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).", "chr_id": "5", "chr_pos": "83520071", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T589", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1395985141", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1395985141" }, { "id": "rs1395985141", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1395985141" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 590, "end_pos": 590, "sequence_org": "I", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (IHT->NHT).", "chr_id": "5", "chr_pos": "83520075", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I590", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1367769624", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1367769624" }, { "id": "rs1367769624", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1367769624#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 59, "end_pos": 59, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->NTG).", "chr_id": "5", "chr_pos": "83490202", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S59", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs769983691", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769983691" }, { "id": "rs769983691", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769983691" }, { "id": "rs769983691", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs769983691" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 59, "end_pos": 59, "sequence_org": "S", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->NTI).", "chr_id": "5", "chr_pos": "83490203", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S59", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs775793051", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775793051" }, { "id": "rs775793051", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775793051" }, { "id": "rs775793051", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775793051" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 59, "end_pos": 59, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->NTR).", "chr_id": "5", "chr_pos": "83490204", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S59", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 632, "end_pos": 632, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->K).", "chr_id": "5", "chr_pos": "83520201", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "T632", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs143729093", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143729093" }, { "id": "rs143729093", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs143729093" }, { "id": "rs143729093", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143729093" }, { "id": "rs143729093", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs143729093#frequency_tab" }, { "id": "rs143729093", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs143729093" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 632, "end_pos": 632, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->M).", "chr_id": "5", "chr_pos": "83520201", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.001997", "site_lbl": "T632", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs761622471", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761622471" }, { "id": "rs761622471", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761622471" }, { "id": "rs761622471", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761622471#frequency_tab" }, { "id": "rs761622471", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761622471" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 641, "end_pos": 641, "sequence_org": "S", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->A).", "chr_id": "5", "chr_pos": "83520227", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S641", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs761622471", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761622471" }, { "id": "rs761622471", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761622471" }, { "id": "rs761622471", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761622471#frequency_tab" }, { "id": "rs761622471", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761622471" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 641, "end_pos": 641, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "5", "chr_pos": "83520227", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S641", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs767181153", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767181153" }, { "id": "rs767181153", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767181153" }, { "id": "rs767181153", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767181153" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 642, "end_pos": 642, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83520230", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T642", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 643, "end_pos": 643, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83520234", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T643", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs753392015", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753392015" }, { "id": "rs753392015", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753392015" }, { "id": "rs753392015", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753392015" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 649, "end_pos": 649, "sequence_org": "H", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (HRT->NRT).", "chr_id": "5", "chr_pos": "83520251", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "H649", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs141958435", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141958435" }, { "id": "rs141958435", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141958435" }, { "id": "rs141958435", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs141958435#frequency_tab" }, { "id": "rs141958435", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs141958435" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 651, "end_pos": 651, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).", "chr_id": "5", "chr_pos": "83520257", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T651", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs202018506", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs202018506" }, { "id": "rs202018506", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs202018506" }, { "id": "rs202018506", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs202018506" }, { "id": "rs202018506", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs202018506" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 668, "end_pos": 668, "sequence_org": "I", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (IST->NST).", "chr_id": "5", "chr_pos": "83520309", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "I668", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs752088303", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752088303" }, { "id": "rs752088303", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752088303" }, { "id": "rs752088303", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752088303" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 670, "end_pos": 670, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83537972", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T670", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1227006850", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1227006850" }, { "id": "rs1227006850", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1227006850" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 670, "end_pos": 670, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83520315", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T670", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs753306511", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753306511" }, { "id": "rs753306511", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753306511" }, { "id": "rs753306511", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753306511" }, { "id": "rs753306511", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753306511" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 687, "end_pos": 687, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83520365", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T687", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs61754531", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61754531" }, { "id": "rs61754531", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs61754531" }, { "id": "rs61754531", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs61754531" }, { "id": "rs61754531", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs61754531#frequency_tab" }, { "id": "rs61754531", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs61754531" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 689, "end_pos": 689, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83520371", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0.003195", "site_lbl": "T689", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs199694481", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199694481" }, { "id": "rs199694481", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs199694481" }, { "id": "rs199694481", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199694481" }, { "id": "rs199694481", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs199694481#frequency_tab" }, { "id": "rs199694481", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs199694481" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 727, "end_pos": 727, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->C).", "chr_id": "5", "chr_pos": "83520486", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "S727", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" }, { "id": "rs199694481", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199694481" }, { "id": "rs199694481", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs199694481" }, { "id": "rs199694481", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199694481" }, { "id": "rs199694481", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs199694481#frequency_tab" }, { "id": "rs199694481", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs199694481" }, { "id": "21720365", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21720365" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 727, "end_pos": 727, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "F", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->F).", "chr_id": "5", "chr_pos": "83520486", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S727", "disease": [ { "disease_id": "DOID:2394", "recommended_name": { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovarian cancer", "description": "A female reproductive organ cancer that is located_in the ovary." }, "synonyms": [ { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "malignant Ovarian tumor", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "malignant tumour of ovary", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovarian neoplasm", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovary neoplasm", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "primary ovarian cancer", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "tumor of the Ovary", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to, 1", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "OVCAS1", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to, 1", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer", "description": "A primary or metastatic malignant neoplasm involving the ovary. Most primary malignant ovarian neoplasms are either carcinomas (serous, mucinous, or endometrioid adenocarcinomas) or malignant germ cell tumors. Metastatic malignant neoplasms to the ovary include carcinomas, lymphomas, and melanomas." }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovary neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "tumor of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "tumour of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "cancer of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "cancer of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant neoplasm of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant neoplasm of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian tumor", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian tumour", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovary neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumor of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumor of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumour of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumour of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer, somatic", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian malignant tumor", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian malignant tumour", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovary cancer", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer, epithelial", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "primary ovarian cancer", "description": "" }, { "id": "MIM:167000", "resource": "MIM", "url": "https://www.omim.org/entry/167000", "name": "Ovarian cancer", "description": "Ovarian cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ] }, { "evidence": [ { "id": "rs748936358", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748936358" }, { "id": "rs748936358", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748936358" }, { "id": "rs748936358", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748936358" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 737, "end_pos": 737, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83520659", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T737", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs766727030", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766727030" }, { "id": "rs766727030", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766727030" }, { "id": "rs766727030", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs766727030#frequency_tab" }, { "id": "rs766727030", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766727030" }, { "id": "rs750786127", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750786127" }, { "id": "rs750786127", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750786127" }, { "id": "rs750786127", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750786127" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 751, "end_pos": 751, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83520701", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T751", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs760966215", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760966215" }, { "id": "rs760966215", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760966215" }, { "id": "rs760966215", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs760966215#frequency_tab" }, { "id": "rs760966215", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760966215" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 751, "end_pos": 751, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83520558", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T751", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 754, "end_pos": 754, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83520567", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T754", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 754, "end_pos": 754, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->K).", "chr_id": "5", "chr_pos": "83520567", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "T754", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 754, "end_pos": 754, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "R", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->R).", "chr_id": "5", "chr_pos": "83520567", "ref_nt": "C", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "T754", "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs771249413", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771249413" }, { "id": "rs771249413", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771249413" }, { "id": "rs771249413", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771249413" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 784, "end_pos": 784, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->NII).", "chr_id": "5", "chr_pos": "83520801", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T784", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1298913329", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1298913329" }, { "id": "rs1298913329", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1298913329#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 792, "end_pos": 792, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83520681", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T792", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs766727030", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766727030" }, { "id": "rs766727030", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766727030" }, { "id": "rs766727030", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs766727030#frequency_tab" }, { "id": "rs766727030", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766727030" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 799, "end_pos": 799, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83520701", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T799", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1423319973", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1423319973" }, { "id": "rs1423319973", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1423319973" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 799, "end_pos": 799, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).", "chr_id": "5", "chr_pos": "83520845", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T799", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1331684769", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1331684769" }, { "id": "rs1331684769", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1331684769#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 809, "end_pos": 809, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "5", "chr_pos": "83520732", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N809", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1271774961", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1271774961" }, { "id": "rs1271774961", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1271774961#frequency_tab" }, { "id": "rs1271774961", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1271774961" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 811, "end_pos": 811, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->NTI).", "chr_id": "5", "chr_pos": "83520738", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T811", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1271774961", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1271774961" }, { "id": "rs1271774961", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1271774961#frequency_tab" }, { "id": "rs1271774961", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1271774961" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 811, "end_pos": 811, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->NTK).", "chr_id": "5", "chr_pos": "83520738", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T811", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1271269610", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1271269610" }, { "id": "rs1271269610", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1271269610" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 811, "end_pos": 811, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->NTP).", "chr_id": "5", "chr_pos": "83538395", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T811", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 855, "end_pos": 855, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83520870", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T855", "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1242661637", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1242661637" }, { "id": "rs1242661637", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1242661637" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 861, "end_pos": 861, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83538545", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T861", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" }, { "id": "rs1455689491", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1455689491" }, { "id": "rs1455689491", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1455689491" }, { "id": "rs1455689491", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1455689491#frequency_tab" }, { "id": "rs1455689491", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1455689491" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 861, "end_pos": 861, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83520888", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T861", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs757945772", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757945772" }, { "id": "rs757945772", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757945772" }, { "id": "rs757945772", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757945772" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 869, "end_pos": 869, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83520911", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T869", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs138220992", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138220992" }, { "id": "rs138220992", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs138220992" }, { "id": "rs138220992", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs138220992" }, { "id": "rs138220992", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs138220992#frequency_tab" }, { "id": "rs138220992", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs138220992" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 886, "end_pos": 886, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "83520962", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T886", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1261180767", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1261180767" }, { "id": "rs1261180767", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1261180767#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 887, "end_pos": 887, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->K).", "chr_id": "5", "chr_pos": "83520966", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T887", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs149153726", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149153726" }, { "id": "rs149153726", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs149153726" }, { "id": "rs149153726", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149153726" }, { "id": "rs149153726", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs149153726#frequency_tab" }, { "id": "rs149153726", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs149153726" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 889, "end_pos": 889, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83520972", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.001797", "site_lbl": "T889", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1746076053", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1746076053" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 939, "end_pos": 939, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "83521122", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T939", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs780636997", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780636997" }, { "id": "rs780636997", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780636997" }, { "id": "rs780636997", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780636997" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 956, "end_pos": 956, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SYS->NYS).", "chr_id": "5", "chr_pos": "83521173", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S956", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13611", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 989, "end_pos": 989, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->Y).", "chr_id": "5", "chr_pos": "83521272", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S989", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "76.13", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000038427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000038427" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "80.35", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000038427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000038427" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "87.67", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000038427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000038427" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "93.32", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000038427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000038427" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "93.42", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000038427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000038427" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "88.99", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000038427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000038427" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "72.02", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000038427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000038427" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "84.36", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000038427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000038427" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "81.75", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000038427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000038427" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "90.62", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000038427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000038427" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "77.5", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000038427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000038427" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "75.3", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000038427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000038427" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "92.02", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000038427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000038427" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P13611", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13611" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P13611", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13611" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P13611", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13611" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P13611", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13611" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P13611", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13611" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P13611", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13611" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P13611", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13611" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P13611", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13611" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P13611", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13611" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P13611", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13611" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P13611", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13611" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P13611", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13611" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "common_name": "Human" } ], "gene": [ { "name": "VCAN", "url": "https://www.uniprot.org/uniprot/P13611", "locus": { "chromosome": "5", "start_pos": 83582303, "end_pos": 83471618, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000038427", "url": "https://www.ensembl.org/id/ENSG00000038427" } ] } } ], "crossref": [ { "id": "ENSG00000038427", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000038427", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P13611", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13611", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd00033", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00033", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd00054", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00054", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd03517", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03517", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd03520", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03520", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd03588", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03588", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd05901", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05901", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "VCAN", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=VCAN", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "1462", "url": "https://www.ncbi.nlm.nih.gov/gene/1462", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1890", "url": "https://glyconnect.expasy.org/browser/proteins/1890", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "2464", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=2464", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P13611", "url": "https://www.ebi.ac.uk/intact/interactors/id:P13611*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000152", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000152", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000436", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000436", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000538", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000538", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000742", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000742", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001304", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001304", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001881", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001881", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016186", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016186", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016187", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016187", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018097", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018097", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018378", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018378", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033987", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033987", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035976", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035976", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:1462", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1462", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "118661", "url": "http://www.omim.org/entry/118661", "database": "MIM", "categories": [ "Other" ] }, { "id": "143200", "url": "http://www.omim.org/entry/143200", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P13611", "url": "https://www.nextprot.org/entry/NX_P13611", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P13611", "url": "https://oglcnac.org/atlas/detail/P13611", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P13611", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P13611", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "ELTWKPE", "url": "https://omabrowser.org/oma/group/ELTWKPE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5323609at2759", "url": "http://www.orthodb.org/?query=5323609at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR22804", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22804", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR22804:SF41", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22804:SF41", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR22804:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22804:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00008", "url": "http://pfam.xfam.org/family/PF00008", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00059", "url": "http://pfam.xfam.org/family/PF00059", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00084", "url": "http://pfam.xfam.org/family/PF00084", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00193", "url": "http://pfam.xfam.org/family/PF00193", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "http://pfam.xfam.org/family/PF07686", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P13611", "url": "https://pharos.nih.gov/targets/P13611", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000055082", "url": "https://proconsortium.org/app/entry/PR:000055082", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055083", "url": "https://proconsortium.org/app/entry/PR:000055083", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055084", "url": "https://proconsortium.org/app/entry/PR:000055084", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055085", "url": "https://proconsortium.org/app/entry/PR:000055085", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055086", "url": "https://proconsortium.org/app/entry/PR:000055086", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055087", "url": "https://proconsortium.org/app/entry/PR:000055087", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055088", "url": "https://proconsortium.org/app/entry/PR:000055088", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055089", "url": "https://proconsortium.org/app/entry/PR:000055089", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055090", "url": "https://proconsortium.org/app/entry/PR:000055090", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055091", "url": "https://proconsortium.org/app/entry/PR:000055091", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055092", "url": "https://proconsortium.org/app/entry/PR:000055092", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055093", "url": "https://proconsortium.org/app/entry/PR:000055093", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055094", "url": "https://proconsortium.org/app/entry/PR:000055094", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055095", "url": "https://proconsortium.org/app/entry/PR:000055095", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055096", "url": "https://proconsortium.org/app/entry/PR:000055096", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055097", "url": "https://proconsortium.org/app/entry/PR:000055097", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055098", "url": "https://proconsortium.org/app/entry/PR:000055098", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055099", "url": "https://proconsortium.org/app/entry/PR:000055099", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055100", "url": "https://proconsortium.org/app/entry/PR:000055100", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055101", "url": "https://proconsortium.org/app/entry/PR:000055101", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055102", "url": "https://proconsortium.org/app/entry/PR:000055102", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055103", "url": "https://proconsortium.org/app/entry/PR:000055103", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055104", "url": "https://proconsortium.org/app/entry/PR:000055104", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055105", "url": "https://proconsortium.org/app/entry/PR:000055105", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055106", "url": "https://proconsortium.org/app/entry/PR:000055106", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055107", "url": "https://proconsortium.org/app/entry/PR:000055107", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055108", "url": "https://proconsortium.org/app/entry/PR:000055108", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055109", "url": "https://proconsortium.org/app/entry/PR:000055109", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055110", "url": "https://proconsortium.org/app/entry/PR:000055110", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055111", "url": "https://proconsortium.org/app/entry/PR:000055111", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055112", "url": "https://proconsortium.org/app/entry/PR:000055112", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055113", "url": "https://proconsortium.org/app/entry/PR:000055113", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055114", "url": "https://proconsortium.org/app/entry/PR:000055114", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055115", "url": "https://proconsortium.org/app/entry/PR:000055115", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055116", "url": "https://proconsortium.org/app/entry/PR:000055116", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055117", "url": "https://proconsortium.org/app/entry/PR:000055117", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055118", "url": "https://proconsortium.org/app/entry/PR:000055118", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055119", "url": "https://proconsortium.org/app/entry/PR:000055119", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055120", "url": "https://proconsortium.org/app/entry/PR:000055120", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055121", "url": "https://proconsortium.org/app/entry/PR:000055121", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055122", "url": "https://proconsortium.org/app/entry/PR:000055122", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055123", "url": "https://proconsortium.org/app/entry/PR:000055123", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055124", "url": "https://proconsortium.org/app/entry/PR:000055124", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055125", "url": "https://proconsortium.org/app/entry/PR:000055125", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055126", "url": "https://proconsortium.org/app/entry/PR:000055126", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055127", "url": "https://proconsortium.org/app/entry/PR:000055127", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055128", "url": "https://proconsortium.org/app/entry/PR:000055128", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055129", "url": "https://proconsortium.org/app/entry/PR:000055129", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055130", "url": "https://proconsortium.org/app/entry/PR:000055130", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055131", "url": "https://proconsortium.org/app/entry/PR:000055131", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055132", "url": "https://proconsortium.org/app/entry/PR:000055132", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055133", "url": "https://proconsortium.org/app/entry/PR:000055133", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055134", "url": "https://proconsortium.org/app/entry/PR:000055134", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055135", "url": "https://proconsortium.org/app/entry/PR:000055135", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055136", "url": "https://proconsortium.org/app/entry/PR:000055136", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055137", "url": "https://proconsortium.org/app/entry/PR:000055137", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055138", "url": "https://proconsortium.org/app/entry/PR:000055138", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055139", "url": "https://proconsortium.org/app/entry/PR:000055139", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055140", "url": "https://proconsortium.org/app/entry/PR:000055140", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055141", "url": "https://proconsortium.org/app/entry/PR:000055141", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055142", "url": "https://proconsortium.org/app/entry/PR:000055142", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055143", "url": "https://proconsortium.org/app/entry/PR:000055143", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055144", "url": "https://proconsortium.org/app/entry/PR:000055144", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055145", "url": "https://proconsortium.org/app/entry/PR:000055145", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055146", "url": "https://proconsortium.org/app/entry/PR:000055146", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055147", "url": "https://proconsortium.org/app/entry/PR:000055147", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055148", "url": "https://proconsortium.org/app/entry/PR:000055148", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055149", "url": "https://proconsortium.org/app/entry/PR:000055149", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055150", "url": "https://proconsortium.org/app/entry/PR:000055150", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055151", "url": "https://proconsortium.org/app/entry/PR:000055151", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055152", "url": "https://proconsortium.org/app/entry/PR:000055152", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055153", "url": "https://proconsortium.org/app/entry/PR:000055153", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055154", "url": "https://proconsortium.org/app/entry/PR:000055154", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055155", "url": "https://proconsortium.org/app/entry/PR:000055155", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055156", "url": "https://proconsortium.org/app/entry/PR:000055156", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055157", "url": "https://proconsortium.org/app/entry/PR:000055157", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055158", "url": "https://proconsortium.org/app/entry/PR:000055158", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055159", "url": "https://proconsortium.org/app/entry/PR:000055159", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055160", "url": "https://proconsortium.org/app/entry/PR:000055160", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055161", "url": "https://proconsortium.org/app/entry/PR:000055161", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055162", "url": "https://proconsortium.org/app/entry/PR:000055162", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055163", "url": "https://proconsortium.org/app/entry/PR:000055163", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055164", "url": "https://proconsortium.org/app/entry/PR:000055164", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055165", "url": "https://proconsortium.org/app/entry/PR:000055165", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055166", "url": "https://proconsortium.org/app/entry/PR:000055166", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055167", "url": "https://proconsortium.org/app/entry/PR:000055167", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055168", "url": "https://proconsortium.org/app/entry/PR:000055168", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055169", "url": "https://proconsortium.org/app/entry/PR:000055169", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055170", "url": "https://proconsortium.org/app/entry/PR:000055170", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055171", "url": "https://proconsortium.org/app/entry/PR:000055171", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055172", "url": "https://proconsortium.org/app/entry/PR:000055172", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055173", "url": "https://proconsortium.org/app/entry/PR:000055173", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055174", "url": "https://proconsortium.org/app/entry/PR:000055174", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055175", "url": "https://proconsortium.org/app/entry/PR:000055175", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055176", "url": "https://proconsortium.org/app/entry/PR:000055176", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055177", "url": "https://proconsortium.org/app/entry/PR:000055177", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055178", "url": "https://proconsortium.org/app/entry/PR:000055178", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055179", "url": "https://proconsortium.org/app/entry/PR:000055179", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055180", "url": "https://proconsortium.org/app/entry/PR:000055180", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055181", "url": "https://proconsortium.org/app/entry/PR:000055181", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055182", "url": "https://proconsortium.org/app/entry/PR:000055182", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055183", "url": "https://proconsortium.org/app/entry/PR:000055183", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055184", "url": "https://proconsortium.org/app/entry/PR:000055184", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055185", "url": "https://proconsortium.org/app/entry/PR:000055185", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055186", "url": "https://proconsortium.org/app/entry/PR:000055186", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055187", "url": "https://proconsortium.org/app/entry/PR:000055187", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055188", "url": "https://proconsortium.org/app/entry/PR:000055188", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055189", "url": "https://proconsortium.org/app/entry/PR:000055189", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055190", "url": "https://proconsortium.org/app/entry/PR:000055190", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055191", "url": "https://proconsortium.org/app/entry/PR:000055191", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055192", "url": "https://proconsortium.org/app/entry/PR:000055192", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055193", "url": "https://proconsortium.org/app/entry/PR:000055193", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055194", "url": "https://proconsortium.org/app/entry/PR:000055194", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055195", "url": "https://proconsortium.org/app/entry/PR:000055195", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055196", "url": "https://proconsortium.org/app/entry/PR:000055196", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055197", "url": "https://proconsortium.org/app/entry/PR:000055197", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055198", "url": "https://proconsortium.org/app/entry/PR:000055198", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055199", "url": "https://proconsortium.org/app/entry/PR:000055199", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055200", "url": "https://proconsortium.org/app/entry/PR:000055200", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055201", "url": "https://proconsortium.org/app/entry/PR:000055201", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055202", "url": "https://proconsortium.org/app/entry/PR:000055202", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055203", "url": "https://proconsortium.org/app/entry/PR:000055203", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055204", "url": "https://proconsortium.org/app/entry/PR:000055204", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055205", "url": "https://proconsortium.org/app/entry/PR:000055205", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055206", "url": "https://proconsortium.org/app/entry/PR:000055206", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055207", "url": "https://proconsortium.org/app/entry/PR:000055207", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055208", "url": "https://proconsortium.org/app/entry/PR:000055208", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055209", "url": "https://proconsortium.org/app/entry/PR:000055209", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055210", "url": "https://proconsortium.org/app/entry/PR:000055210", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055211", "url": "https://proconsortium.org/app/entry/PR:000055211", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055212", "url": "https://proconsortium.org/app/entry/PR:000055212", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055213", "url": "https://proconsortium.org/app/entry/PR:000055213", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055214", "url": "https://proconsortium.org/app/entry/PR:000055214", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055215", "url": "https://proconsortium.org/app/entry/PR:000055215", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055216", "url": "https://proconsortium.org/app/entry/PR:000055216", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055217", "url": "https://proconsortium.org/app/entry/PR:000055217", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055218", "url": "https://proconsortium.org/app/entry/PR:000055218", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055219", "url": "https://proconsortium.org/app/entry/PR:000055219", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055220", "url": "https://proconsortium.org/app/entry/PR:000055220", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055221", "url": "https://proconsortium.org/app/entry/PR:000055221", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055222", "url": "https://proconsortium.org/app/entry/PR:000055222", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055223", "url": "https://proconsortium.org/app/entry/PR:000055223", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055224", "url": "https://proconsortium.org/app/entry/PR:000055224", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055225", "url": "https://proconsortium.org/app/entry/PR:000055225", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055226", "url": "https://proconsortium.org/app/entry/PR:000055226", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055227", "url": "https://proconsortium.org/app/entry/PR:000055227", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055228", "url": "https://proconsortium.org/app/entry/PR:000055228", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055229", "url": "https://proconsortium.org/app/entry/PR:000055229", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055230", "url": "https://proconsortium.org/app/entry/PR:000055230", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055231", "url": "https://proconsortium.org/app/entry/PR:000055231", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055232", "url": "https://proconsortium.org/app/entry/PR:000055232", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055233", "url": "https://proconsortium.org/app/entry/PR:000055233", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055234", "url": "https://proconsortium.org/app/entry/PR:000055234", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055235", "url": "https://proconsortium.org/app/entry/PR:000055235", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055236", "url": "https://proconsortium.org/app/entry/PR:000055236", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055237", "url": "https://proconsortium.org/app/entry/PR:000055237", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055238", "url": "https://proconsortium.org/app/entry/PR:000055238", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055239", "url": "https://proconsortium.org/app/entry/PR:000055239", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055240", "url": "https://proconsortium.org/app/entry/PR:000055240", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055241", "url": "https://proconsortium.org/app/entry/PR:000055241", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055242", "url": "https://proconsortium.org/app/entry/PR:000055242", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055243", "url": "https://proconsortium.org/app/entry/PR:000055243", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055244", "url": "https://proconsortium.org/app/entry/PR:000055244", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055245", "url": "https://proconsortium.org/app/entry/PR:000055245", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055246", "url": "https://proconsortium.org/app/entry/PR:000055246", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055247", "url": "https://proconsortium.org/app/entry/PR:000055247", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055248", "url": "https://proconsortium.org/app/entry/PR:000055248", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055249", "url": "https://proconsortium.org/app/entry/PR:000055249", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055250", "url": "https://proconsortium.org/app/entry/PR:000055250", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055251", "url": "https://proconsortium.org/app/entry/PR:000055251", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055252", "url": "https://proconsortium.org/app/entry/PR:000055252", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055253", "url": "https://proconsortium.org/app/entry/PR:000055253", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055254", "url": "https://proconsortium.org/app/entry/PR:000055254", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055255", "url": "https://proconsortium.org/app/entry/PR:000055255", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055256", "url": "https://proconsortium.org/app/entry/PR:000055256", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055257", "url": "https://proconsortium.org/app/entry/PR:000055257", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055258", "url": "https://proconsortium.org/app/entry/PR:000055258", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055259", "url": "https://proconsortium.org/app/entry/PR:000055259", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055260", "url": "https://proconsortium.org/app/entry/PR:000055260", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055261", "url": "https://proconsortium.org/app/entry/PR:000055261", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055262", "url": "https://proconsortium.org/app/entry/PR:000055262", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055263", "url": "https://proconsortium.org/app/entry/PR:000055263", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055264", "url": "https://proconsortium.org/app/entry/PR:000055264", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055265", "url": "https://proconsortium.org/app/entry/PR:000055265", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055266", "url": "https://proconsortium.org/app/entry/PR:000055266", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055267", "url": "https://proconsortium.org/app/entry/PR:000055267", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055268", "url": "https://proconsortium.org/app/entry/PR:000055268", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055269", "url": "https://proconsortium.org/app/entry/PR:000055269", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055270", "url": "https://proconsortium.org/app/entry/PR:000055270", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055271", "url": "https://proconsortium.org/app/entry/PR:000055271", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055272", "url": "https://proconsortium.org/app/entry/PR:000055272", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055273", "url": "https://proconsortium.org/app/entry/PR:000055273", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055274", "url": "https://proconsortium.org/app/entry/PR:000055274", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055275", "url": "https://proconsortium.org/app/entry/PR:000055275", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055276", "url": "https://proconsortium.org/app/entry/PR:000055276", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055277", "url": "https://proconsortium.org/app/entry/PR:000055277", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055278", "url": "https://proconsortium.org/app/entry/PR:000055278", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055279", "url": "https://proconsortium.org/app/entry/PR:000055279", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055280", "url": "https://proconsortium.org/app/entry/PR:000055280", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055281", "url": "https://proconsortium.org/app/entry/PR:000055281", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055282", "url": "https://proconsortium.org/app/entry/PR:000055282", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055283", "url": "https://proconsortium.org/app/entry/PR:000055283", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055284", "url": "https://proconsortium.org/app/entry/PR:000055284", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055285", "url": "https://proconsortium.org/app/entry/PR:000055285", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055286", "url": "https://proconsortium.org/app/entry/PR:000055286", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055287", "url": "https://proconsortium.org/app/entry/PR:000055287", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055288", "url": "https://proconsortium.org/app/entry/PR:000055288", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055289", "url": "https://proconsortium.org/app/entry/PR:000055289", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055290", "url": "https://proconsortium.org/app/entry/PR:000055290", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055291", "url": "https://proconsortium.org/app/entry/PR:000055291", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055292", "url": "https://proconsortium.org/app/entry/PR:000055292", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055293", "url": "https://proconsortium.org/app/entry/PR:000055293", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055294", "url": "https://proconsortium.org/app/entry/PR:000055294", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055295", "url": "https://proconsortium.org/app/entry/PR:000055295", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055296", "url": "https://proconsortium.org/app/entry/PR:000055296", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055297", "url": "https://proconsortium.org/app/entry/PR:000055297", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055298", "url": "https://proconsortium.org/app/entry/PR:000055298", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055299", "url": "https://proconsortium.org/app/entry/PR:000055299", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055300", "url": "https://proconsortium.org/app/entry/PR:000055300", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055301", "url": "https://proconsortium.org/app/entry/PR:000055301", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055302", "url": "https://proconsortium.org/app/entry/PR:000055302", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055303", "url": "https://proconsortium.org/app/entry/PR:000055303", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055304", "url": "https://proconsortium.org/app/entry/PR:000055304", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055305", "url": "https://proconsortium.org/app/entry/PR:000055305", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055306", "url": "https://proconsortium.org/app/entry/PR:000055306", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055307", "url": "https://proconsortium.org/app/entry/PR:000055307", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055308", "url": "https://proconsortium.org/app/entry/PR:000055308", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055309", "url": "https://proconsortium.org/app/entry/PR:000055309", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055310", "url": "https://proconsortium.org/app/entry/PR:000055310", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055311", "url": "https://proconsortium.org/app/entry/PR:000055311", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055312", "url": "https://proconsortium.org/app/entry/PR:000055312", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055313", "url": "https://proconsortium.org/app/entry/PR:000055313", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055314", "url": "https://proconsortium.org/app/entry/PR:000055314", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055315", "url": "https://proconsortium.org/app/entry/PR:000055315", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055316", "url": "https://proconsortium.org/app/entry/PR:000055316", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055317", "url": "https://proconsortium.org/app/entry/PR:000055317", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055318", "url": "https://proconsortium.org/app/entry/PR:000055318", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055319", "url": "https://proconsortium.org/app/entry/PR:000055319", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055320", "url": "https://proconsortium.org/app/entry/PR:000055320", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055321", "url": "https://proconsortium.org/app/entry/PR:000055321", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055322", "url": "https://proconsortium.org/app/entry/PR:000055322", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055323", "url": "https://proconsortium.org/app/entry/PR:000055323", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055324", "url": "https://proconsortium.org/app/entry/PR:000055324", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055325", "url": "https://proconsortium.org/app/entry/PR:000055325", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055326", "url": "https://proconsortium.org/app/entry/PR:000055326", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055327", "url": "https://proconsortium.org/app/entry/PR:000055327", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055328", "url": "https://proconsortium.org/app/entry/PR:000055328", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055329", "url": "https://proconsortium.org/app/entry/PR:000055329", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055330", "url": "https://proconsortium.org/app/entry/PR:000055330", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055331", "url": "https://proconsortium.org/app/entry/PR:000055331", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055332", "url": "https://proconsortium.org/app/entry/PR:000055332", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055333", "url": "https://proconsortium.org/app/entry/PR:000055333", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055334", "url": "https://proconsortium.org/app/entry/PR:000055334", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055335", "url": "https://proconsortium.org/app/entry/PR:000055335", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055336", "url": "https://proconsortium.org/app/entry/PR:000055336", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055337", "url": "https://proconsortium.org/app/entry/PR:000055337", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055338", "url": "https://proconsortium.org/app/entry/PR:000055338", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055339", "url": "https://proconsortium.org/app/entry/PR:000055339", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055340", "url": "https://proconsortium.org/app/entry/PR:000055340", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055341", "url": "https://proconsortium.org/app/entry/PR:000055341", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055342", "url": "https://proconsortium.org/app/entry/PR:000055342", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055343", "url": "https://proconsortium.org/app/entry/PR:000055343", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055344", "url": "https://proconsortium.org/app/entry/PR:000055344", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055345", "url": "https://proconsortium.org/app/entry/PR:000055345", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055346", "url": "https://proconsortium.org/app/entry/PR:000055346", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055347", "url": "https://proconsortium.org/app/entry/PR:000055347", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055348", "url": "https://proconsortium.org/app/entry/PR:000055348", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055349", "url": "https://proconsortium.org/app/entry/PR:000055349", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055350", "url": "https://proconsortium.org/app/entry/PR:000055350", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055351", "url": "https://proconsortium.org/app/entry/PR:000055351", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055352", "url": "https://proconsortium.org/app/entry/PR:000055352", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055353", "url": "https://proconsortium.org/app/entry/PR:000055353", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055354", "url": "https://proconsortium.org/app/entry/PR:000055354", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055355", "url": "https://proconsortium.org/app/entry/PR:000055355", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000055356", "url": "https://proconsortium.org/app/entry/PR:000055356", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P13611", "url": "http://purl.obolibrary.org/obo/PR_P13611", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2022870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022870", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2022923", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022923", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2024101", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024101", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3560783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3560783", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3560801", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3560801", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3595172", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3595172", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3595174", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3595174", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3595177", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3595177", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-4420332", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420332", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8957275", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8957275", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001119808", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001119808", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P13611", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "D6RGZ6", "url": "https://www.uniprot.org/uniprot/D6RGZ6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RGZ6-1", "url": "https://www.uniprot.org/uniprot/D6RGZ6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PF17", "url": "https://www.uniprot.org/uniprot/E9PF17", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PF17-1", "url": "https://www.uniprot.org/uniprot/E9PF17-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13611-1", "url": "https://www.uniprot.org/uniprot/P13611-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13611-2", "url": "https://www.uniprot.org/uniprot/P13611-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13611-3", "url": "https://www.uniprot.org/uniprot/P13611-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13611-4", "url": "https://www.uniprot.org/uniprot/P13611-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13611-5", "url": "https://www.uniprot.org/uniprot/P13611-5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q86W61", "url": "https://www.uniprot.org/uniprot/Q86W61", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q86W61-1", "url": "https://www.uniprot.org/uniprot/Q86W61-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MFINIKSILWMCSTLIVTHALHKVKVGKSPPVRGSLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAAQKACLDVGAVIATPEQLFAAYEDGFEQCDAGWLADQTVRYPIRAPRVGCYGDKMGKAGVRTYGFRSPQETYDVYCYVDHLDGDVFHLTVPSKFTFEEAAKECENQDARLATVGELQAAWRNGFDQCDYGWLSDASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKPKEATTIDLSILAETASPSLSKEPQMVSDRTTPIIPLVDELPVIPTEFPPVGNIVSFEQKATVQPQAITDSLATKLPTPTGSTKKPWDMDDYSPSASGPLGKLDISEIKEEVLQSTTGVSHYATDSWDGVVEDKQTQESVTQIEQIEVGPLVTSMEILKHIPSKEFPVTETPLVTARMILESKTEKKMVSTVSELVTTGHYGFTLGEEDDEDRTLTVGSDESTLIFDQIPEVITVSKTSEDTIHTHLEDLESVSASTTVSPLIMPDNNGSSMDDWEERQTSGRITEEFLGKYLSTTPFPSQHRTEIELFPYSGDKILVEGISTVIYPSLQTEMTHRRERTETLIPEMRTDTYTDEIQEEITKSPFMGKTEEEVFSGMKLSTSLSEPIHVTESSVEMTKSFDFPTLITKLSAEPTEVRDMEEDFTATPGTTKYDENITTVLLAHGTLSVEAATVSKWSWDEDNTTSKPLESTEPSASSKLPPALLTTVGMNGKDKDIPSFTEDGADEFTLIPDSTQKQLEEVTDEDIAAHGKFTIRFQPTTSTGIAEKSTLRDSTTEEKVPPITSTEGQVYATMEGSALGEVEDVDLSKPVSTVPQFAHTSEVEGLAFVSYSSTQEPTTYVDSSHTIPLSVIPKTDWGVLVPSVPSEDEVLGEPSQDILVIDQTRLEATISPETMRTTKITEGTTQEEFPWKEQTAEKPVPALSSTAWTPKEAVTPLDEQEGDGSAYTVSEDELLTGSERVPVLETTPVGKIDHSVSYPPGAVTEHKVKTDEVVTLTPRIGPKVSLSPGPEQKYETEGSSTTGFTSSLSPFSTHITQLMEETTTEKTSLEDIDLGSGLFEKPKATELIEFSTIKVTVPSDITTAFSSVDRLHTTSAFKPSSAITKKPPLIDREPGEETTSDMVIIGESTSHVPPTTLEDIVAKETETDIDREYFTTSSPPATQPTRPPTVEDKEAFGPQALSTPQPPASTKFHPDINVYIIEVRENKTGRMSDLSVIGHPIDSESKEDEPCSEETDPVHDLMAEILPEFPDIIEIDLYHSEENEEEEEECANATDVTTTPSVQYINGKHLVTTVPKDPEAAEARRGQFESVAPSQNFSDSSESDTHPFVIAKTELSTAVQPNESTETTESLEVTWKPETYPETSEHFSGGEPDVFPTVPFHEEFESGTAKKGAESVTERDTEVGHQAHEHTEPVSLFPEESSGEIAIDQESQKIAFARATEVTFGEEVEKSTSVTYTPTIVPSSASAYVSEEEAVTLIGNPWPDDLLSTKESWVEATPRQVVELSGSSSIPITEGSGEAEEDEDTMFTMVTDLSQRNTTDTLITLDTSRIITESFFEVPATTIYPVSEQPSAKVVPTKFVSETDTSEWISSTTVEEKKRKEEEGTTGTASTFEVYSSTQRSDQLILPFELESPNVATSSDSGTRKSFMSLTTPTQSEREMTDSTPVFTETNTLENLGAQTTEHSSIHQPGVQEGLTTLPRSPASVFMEQGSGEAAADPETTTVSSFSLNVEYAIQAEKEVAGTLSPHVETTFSTEPTGLVLSTVMDRVVAENITQTSREIVISERLGEPNYGAEIRGFSTGFPLEEDFSGDFREYSTVSHPIAKEETVMMEGSGDAAFRDTQTSPSTVPTSVHISHISDSEGPSSTMVSTSAFPWEEFTSSAEGSGEQLVTVSSSVVPVLPSAVQKFSGTASSIIDEGLGEVGTVNEIDRRSTILPTAEVEGTKAPVEKEEVKVSGTVSTNFPQTIEPAKLWSRQEVNPVRQEIESETTSEEQIQEEKSFESPQNSPATEQTIFDSQTFTETELKTTDYSVLTTKKTYSDDKEMKEEDTSLVNMSTPDPDANGLESYTTLPEATEKSHFFLATALVTESIPAEHVVTDSPIKKEESTKHFPKGMRPTIQESDTELLFSGLGSGEEVLPTLPTESVNFTEVEQINNTLYPHTSQVESTSSDKIEDFNRMENVAKEVGPLVSQTDIFEGSGSVTSTTLIEILSDTGAEGPTVAPLPFSTDIGHPQNQTVRWAEEIQTSRPQTITEQDSNKNSSTAEINETTTSSTDFLARAYGFEMAKEFVTSAPKPSDLYYEPSGEGSGEVDIVDSFHTSATTQATRQESSTTFVSDGSLEKHPEVPSAKAVTADGFPTVSVMLPLHSEQNKSSPDPTSTLSNTVSYERSTDGSFQDRFREFEDSTLKPNRKKPTENIIIDLDKEDKDLILTITESTILEILPELTSDKNTIIDIDHTKPVYEDILGMQTDIDTEVPSEPHDSNDESNDDSTQVQEIYEAAVNLSLTEETFEGSADVLASYTQATHDESMTYEDRSQLDHMGFHFTTGIPAPSTETELDVLLPTATSLPIPRKSATVIPEIEGIKAEAKALDDMFESSTLSDGQAIADQSEIIPTLGQFERTQEEYEDKKHAGPSFQPEFSSGAEEALVDHTPYLSIATTHLMDQSVTEVPDVMEGSNPPYYTDTTLAVSTFAKLSSQTPSSPLTIYSGSEASGHTEIPQPSALPGIDVGSSVMSPQDSFKEIHVNIEATFKPSSEEYLHITEPPSLSPDTKLEPSEDDGKPELLEEMEASPTELIAVEGTEILQDFQNKTDGQVSGEAIKMFPTIKTPEAGTVITTADEIELEGATQWPHSTSASATYGVEAGVVPWLSPQTSERPTLSSSPEINPETQAALIRGQDSTIAASEQQVAARILDSNDQATVNPVEFNTEVATPPFSLLETSNETDFLIGINEESVEGTAIYLPGPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMNPSAYQRTYSMKYFKNSSSAKDNSINTSKHDHRWSRRWQESRR", "length": 3396, "header": "sp|P13611-1|CSPG2_HUMAN Isoform 1 of Versican core protein OS=Homo sapiens OX=9606 GN=VCAN PE=1 SV=3 CANONICAL=P13611-1" }, "isoforms": [ { "isoform_ac": "D6RGZ6-1", "url": "", "sequence": { "sequence": "MFINIKSILWMCSTLIVTHALHKVKVGKSPPVRGSLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAAQKACLDVGAVIATPEQLFAAYEDGFEQCDAGWLADQTVRYPIRAPRVGCYGDKMGKAGVRTYGFRSPQETYDVYCYVDHLDGDVFHLTVPSKFTFEEAAKECENQDARLATVGELQAAWRNGFDQCDYGWLSDASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKRRMSDLSVIGHPIDSESKEDEPCSEETDPVHDLMAEILPEFPDIIEIDLYHSEENEEEEEECANATDVTTTPSVQYINGKHLVTTVPKDPEAAEARRGQFESVAPSQNFSDSSESDTHPFVIAKTELSTAVQPNESTETTESLEVTWKPETYPETSEHFSGGEPDVFPTVPFHEEFESGTAKKGAESVTERDTEVGHQAHEHTEPVSLFPEESSGEIAIDQESQKIAFARATEVTFGEEVEKSTSVTYTPTIVPSSASAYVSEEEAVTLIGNPWPDDLLSTKESWVEATPRQVVELSGSSSIPITEGSGEAEEDEDTMFTMVTDLSQRNTTDTLITLDTSRIITESFFEVPATTIYPVSEQPSAKVVPTKFVSETDTSEWISSTTVEEKKRKEEEGTTGTASTFEVYSSTQRSDQLILPFELESPNVATSSDSGTRKSFMSLTTPTQSEREMTDSTPVFTETNTLENLGAQTTEHSSIHQPGVQEGLTTLPRSPASVFMEQGSGEAAADPETTTVSSFSLNVEYAIQAEKEVAGTLSPHVETTFSTEPTGLVLSTVMDRVVAENITQTSREIVISERLGEPNYGAEIRGFSTGFPLEEDFSGDFREYSTVSHPIAKEETVMMEGSGDAAFRDTQTSPSTVPTSVHISHISDSEGPSSTMVSTSAFPWEEFTSSAEGSGEQLVTVSSSVVPVLPSAVQKFSGTASSIIDEGLGEVGTVNEIDRRSTILPTAEVEGTKAPVEKEEVKVSGTVSTNFPQTIEPAKLWSRQEVNPVRQEIESETTSEEQIQEEKSFESPQNSPATEQTIFDSQTFTETELKTTDYSVLTTKKTYSDDKEMKEEDTSLVNMSTPDPDANGLESYTTLPEATEKSHFFLATALVTESIPAEHVVTDSPI", "length": 1240, "header": "tr|D6RGZ6-1|D6RGZ6_HUMAN Computationally mapped isoform of Versican OS=Homo sapiens OX=9606 GN=VCAN PE=1 SV=1 CANONICAL=P13611-1" }, "locus": { "chromosome": "5", "start_pos": 83539684, "end_pos": 83483519, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000513960.5", "url": "https://www.ensembl.org/id/ENST00000513960.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000426251.1", "url": "https://www.ensembl.org/id/ENSP00000426251.1" } ] } }, { "isoform_ac": "E9PF17-1", "url": "", "sequence": { "sequence": "MPTLPPSYNTSEFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAAQKACLDVGAVIATPEQLFAAYEDGFEQCDAGWLADQTVRYPIRAPRVGCYGDKMGKAGVRTYGFRSPQETYDVYCYVDHLDGDVFHLTVPSKFTFEEAAKECENQDARLATVGELQAAWRNGFDQCDYGWLSDASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKPKEATTIDLSILAETASPSLSKEPQMVSDRTTPIIPLVDELPVIPTEFPPVGNIVSFEQKATVQPQAITDSLATKLPTPTGSTKKPWDMDDYSPSASGPLGKLDISEIKEEVLQSTTGVSHYATDSWDGVVEDKQTQESVTQIEQIEVGPLVTSMEILKHIPSKEFPVTETPLVTARMILESKTEKKMVSTVSELVTTGHYGFTLGEEDDEDRTLTVGSDESTLIFDQIPEVITVSKTSEDTIHTHLEDLESVSASTTVSPLIMPDNNGSSMDDWEERQTSGRITEEFLGKYLSTTPFPSQHRTEIELFPYSGDKILVEGISTVIYPSLQTEMTHRRERTETLIPEMRTDTYTDEIQEEITKSPFMGKTEEEVFSGMKLSTSLSEPIHVTESSVEMTKSFDFPTLITKLSAEPTEVRDMEEDFTATPGTTKYDENITTVLLAHGTLSVEAATVSKWSWDEDNTTSKPLESTEPSASSKLPPALLTTVGMNGKDKDIPSFTEDGADEFTLIPDSTQKQLEEVTDEDIAAHGKFTIRFQPTTSTGIAEKSTLRDSTTEEKVPPITSTEGQVYATMEGSALGEVEDVDLSKPVSTVPQFAHTSEVEGLAFVSYSSTQEPTTYVDSSHTIPLSVIPKTDWGVLVPSVPSEDEVLGEPSQDILVIDQTRLEATISPETMRTTKITEGTTQEEFPWKEQTAEKPVPALSSTAWTPKEAVTPLDEQEGDGSAYTVSEDELLTGSERVPVLETTPVGKIDHSVSYPPGAVTEHKVKTDEVVTLTPRIGPKVSLSPGPEQKYETEGSSTTGFTSSLSPFSTHITQLMEETTTEKTSLEDIDLGSGLFEKPKATELIEFSTIKVTVPSDITTAFSSVDRLHTTSAFKPSSAITKKPPLIDREPGEETTSDMVIIGESTSHVPPTTLEDIVAKETETDIDREYFTTSSPPATQPTRPPTVEDKEAFGPQALSTPQPPASTKFHPDINVYIIEVRENKTGPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMNPSAYQRTYSMKYFKNSSSAKDNSINTSKHDHRWSRRWQESRR", "length": 1594, "header": "tr|E9PF17-1|CSPG2_HUMAN Computationally mapped isoform of Versican core protein OS=Homo sapiens OX=9606 GN=VCAN PE=1 SV=2 CANONICAL=P13611-1" }, "locus": { "chromosome": "5", "start_pos": 83580431, "end_pos": 83490172, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000512590.6", "url": "https://www.ensembl.org/id/ENST00000512590.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000425959.2", "url": "https://www.ensembl.org/id/ENSP00000425959.2" } ] } }, { "isoform_ac": "P13611-1", "url": "", "sequence": { "sequence": "MFINIKSILWMCSTLIVTHALHKVKVGKSPPVRGSLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAAQKACLDVGAVIATPEQLFAAYEDGFEQCDAGWLADQTVRYPIRAPRVGCYGDKMGKAGVRTYGFRSPQETYDVYCYVDHLDGDVFHLTVPSKFTFEEAAKECENQDARLATVGELQAAWRNGFDQCDYGWLSDASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKPKEATTIDLSILAETASPSLSKEPQMVSDRTTPIIPLVDELPVIPTEFPPVGNIVSFEQKATVQPQAITDSLATKLPTPTGSTKKPWDMDDYSPSASGPLGKLDISEIKEEVLQSTTGVSHYATDSWDGVVEDKQTQESVTQIEQIEVGPLVTSMEILKHIPSKEFPVTETPLVTARMILESKTEKKMVSTVSELVTTGHYGFTLGEEDDEDRTLTVGSDESTLIFDQIPEVITVSKTSEDTIHTHLEDLESVSASTTVSPLIMPDNNGSSMDDWEERQTSGRITEEFLGKYLSTTPFPSQHRTEIELFPYSGDKILVEGISTVIYPSLQTEMTHRRERTETLIPEMRTDTYTDEIQEEITKSPFMGKTEEEVFSGMKLSTSLSEPIHVTESSVEMTKSFDFPTLITKLSAEPTEVRDMEEDFTATPGTTKYDENITTVLLAHGTLSVEAATVSKWSWDEDNTTSKPLESTEPSASSKLPPALLTTVGMNGKDKDIPSFTEDGADEFTLIPDSTQKQLEEVTDEDIAAHGKFTIRFQPTTSTGIAEKSTLRDSTTEEKVPPITSTEGQVYATMEGSALGEVEDVDLSKPVSTVPQFAHTSEVEGLAFVSYSSTQEPTTYVDSSHTIPLSVIPKTDWGVLVPSVPSEDEVLGEPSQDILVIDQTRLEATISPETMRTTKITEGTTQEEFPWKEQTAEKPVPALSSTAWTPKEAVTPLDEQEGDGSAYTVSEDELLTGSERVPVLETTPVGKIDHSVSYPPGAVTEHKVKTDEVVTLTPRIGPKVSLSPGPEQKYETEGSSTTGFTSSLSPFSTHITQLMEETTTEKTSLEDIDLGSGLFEKPKATELIEFSTIKVTVPSDITTAFSSVDRLHTTSAFKPSSAITKKPPLIDREPGEETTSDMVIIGESTSHVPPTTLEDIVAKETETDIDREYFTTSSPPATQPTRPPTVEDKEAFGPQALSTPQPPASTKFHPDINVYIIEVRENKTGRMSDLSVIGHPIDSESKEDEPCSEETDPVHDLMAEILPEFPDIIEIDLYHSEENEEEEEECANATDVTTTPSVQYINGKHLVTTVPKDPEAAEARRGQFESVAPSQNFSDSSESDTHPFVIAKTELSTAVQPNESTETTESLEVTWKPETYPETSEHFSGGEPDVFPTVPFHEEFESGTAKKGAESVTERDTEVGHQAHEHTEPVSLFPEESSGEIAIDQESQKIAFARATEVTFGEEVEKSTSVTYTPTIVPSSASAYVSEEEAVTLIGNPWPDDLLSTKESWVEATPRQVVELSGSSSIPITEGSGEAEEDEDTMFTMVTDLSQRNTTDTLITLDTSRIITESFFEVPATTIYPVSEQPSAKVVPTKFVSETDTSEWISSTTVEEKKRKEEEGTTGTASTFEVYSSTQRSDQLILPFELESPNVATSSDSGTRKSFMSLTTPTQSEREMTDSTPVFTETNTLENLGAQTTEHSSIHQPGVQEGLTTLPRSPASVFMEQGSGEAAADPETTTVSSFSLNVEYAIQAEKEVAGTLSPHVETTFSTEPTGLVLSTVMDRVVAENITQTSREIVISERLGEPNYGAEIRGFSTGFPLEEDFSGDFREYSTVSHPIAKEETVMMEGSGDAAFRDTQTSPSTVPTSVHISHISDSEGPSSTMVSTSAFPWEEFTSSAEGSGEQLVTVSSSVVPVLPSAVQKFSGTASSIIDEGLGEVGTVNEIDRRSTILPTAEVEGTKAPVEKEEVKVSGTVSTNFPQTIEPAKLWSRQEVNPVRQEIESETTSEEQIQEEKSFESPQNSPATEQTIFDSQTFTETELKTTDYSVLTTKKTYSDDKEMKEEDTSLVNMSTPDPDANGLESYTTLPEATEKSHFFLATALVTESIPAEHVVTDSPIKKEESTKHFPKGMRPTIQESDTELLFSGLGSGEEVLPTLPTESVNFTEVEQINNTLYPHTSQVESTSSDKIEDFNRMENVAKEVGPLVSQTDIFEGSGSVTSTTLIEILSDTGAEGPTVAPLPFSTDIGHPQNQTVRWAEEIQTSRPQTITEQDSNKNSSTAEINETTTSSTDFLARAYGFEMAKEFVTSAPKPSDLYYEPSGEGSGEVDIVDSFHTSATTQATRQESSTTFVSDGSLEKHPEVPSAKAVTADGFPTVSVMLPLHSEQNKSSPDPTSTLSNTVSYERSTDGSFQDRFREFEDSTLKPNRKKPTENIIIDLDKEDKDLILTITESTILEILPELTSDKNTIIDIDHTKPVYEDILGMQTDIDTEVPSEPHDSNDESNDDSTQVQEIYEAAVNLSLTEETFEGSADVLASYTQATHDESMTYEDRSQLDHMGFHFTTGIPAPSTETELDVLLPTATSLPIPRKSATVIPEIEGIKAEAKALDDMFESSTLSDGQAIADQSEIIPTLGQFERTQEEYEDKKHAGPSFQPEFSSGAEEALVDHTPYLSIATTHLMDQSVTEVPDVMEGSNPPYYTDTTLAVSTFAKLSSQTPSSPLTIYSGSEASGHTEIPQPSALPGIDVGSSVMSPQDSFKEIHVNIEATFKPSSEEYLHITEPPSLSPDTKLEPSEDDGKPELLEEMEASPTELIAVEGTEILQDFQNKTDGQVSGEAIKMFPTIKTPEAGTVITTADEIELEGATQWPHSTSASATYGVEAGVVPWLSPQTSERPTLSSSPEINPETQAALIRGQDSTIAASEQQVAARILDSNDQATVNPVEFNTEVATPPFSLLETSNETDFLIGINEESVEGTAIYLPGPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMNPSAYQRTYSMKYFKNSSSAKDNSINTSKHDHRWSRRWQESRR", "length": 3396, "header": "sp|P13611-1|CSPG2_HUMAN Isoform 1 of Versican core protein OS=Homo sapiens OX=9606 GN=VCAN PE=1 SV=3 CANONICAL=P13611-1" }, "locus": { "chromosome": "5", "start_pos": 83580431, "end_pos": 83483519, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000265077.8", "url": "https://www.ensembl.org/id/ENST00000265077.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000265077.3", "url": "https://www.ensembl.org/id/ENSP00000265077.3" } ] } }, { "isoform_ac": "P13611-2", "url": "", "sequence": { "sequence": "MFINIKSILWMCSTLIVTHALHKVKVGKSPPVRGSLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAAQKACLDVGAVIATPEQLFAAYEDGFEQCDAGWLADQTVRYPIRAPRVGCYGDKMGKAGVRTYGFRSPQETYDVYCYVDHLDGDVFHLTVPSKFTFEEAAKECENQDARLATVGELQAAWRNGFDQCDYGWLSDASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKRRMSDLSVIGHPIDSESKEDEPCSEETDPVHDLMAEILPEFPDIIEIDLYHSEENEEEEEECANATDVTTTPSVQYINGKHLVTTVPKDPEAAEARRGQFESVAPSQNFSDSSESDTHPFVIAKTELSTAVQPNESTETTESLEVTWKPETYPETSEHFSGGEPDVFPTVPFHEEFESGTAKKGAESVTERDTEVGHQAHEHTEPVSLFPEESSGEIAIDQESQKIAFARATEVTFGEEVEKSTSVTYTPTIVPSSASAYVSEEEAVTLIGNPWPDDLLSTKESWVEATPRQVVELSGSSSIPITEGSGEAEEDEDTMFTMVTDLSQRNTTDTLITLDTSRIITESFFEVPATTIYPVSEQPSAKVVPTKFVSETDTSEWISSTTVEEKKRKEEEGTTGTASTFEVYSSTQRSDQLILPFELESPNVATSSDSGTRKSFMSLTTPTQSEREMTDSTPVFTETNTLENLGAQTTEHSSIHQPGVQEGLTTLPRSPASVFMEQGSGEAAADPETTTVSSFSLNVEYAIQAEKEVAGTLSPHVETTFSTEPTGLVLSTVMDRVVAENITQTSREIVISERLGEPNYGAEIRGFSTGFPLEEDFSGDFREYSTVSHPIAKEETVMMEGSGDAAFRDTQTSPSTVPTSVHISHISDSEGPSSTMVSTSAFPWEEFTSSAEGSGEQLVTVSSSVVPVLPSAVQKFSGTASSIIDEGLGEVGTVNEIDRRSTILPTAEVEGTKAPVEKEEVKVSGTVSTNFPQTIEPAKLWSRQEVNPVRQEIESETTSEEQIQEEKSFESPQNSPATEQTIFDSQTFTETELKTTDYSVLTTKKTYSDDKEMKEEDTSLVNMSTPDPDANGLESYTTLPEATEKSHFFLATALVTESIPAEHVVTDSPIKKEESTKHFPKGMRPTIQESDTELLFSGLGSGEEVLPTLPTESVNFTEVEQINNTLYPHTSQVESTSSDKIEDFNRMENVAKEVGPLVSQTDIFEGSGSVTSTTLIEILSDTGAEGPTVAPLPFSTDIGHPQNQTVRWAEEIQTSRPQTITEQDSNKNSSTAEINETTTSSTDFLARAYGFEMAKEFVTSAPKPSDLYYEPSGEGSGEVDIVDSFHTSATTQATRQESSTTFVSDGSLEKHPEVPSAKAVTADGFPTVSVMLPLHSEQNKSSPDPTSTLSNTVSYERSTDGSFQDRFREFEDSTLKPNRKKPTENIIIDLDKEDKDLILTITESTILEILPELTSDKNTIIDIDHTKPVYEDILGMQTDIDTEVPSEPHDSNDESNDDSTQVQEIYEAAVNLSLTEETFEGSADVLASYTQATHDESMTYEDRSQLDHMGFHFTTGIPAPSTETELDVLLPTATSLPIPRKSATVIPEIEGIKAEAKALDDMFESSTLSDGQAIADQSEIIPTLGQFERTQEEYEDKKHAGPSFQPEFSSGAEEALVDHTPYLSIATTHLMDQSVTEVPDVMEGSNPPYYTDTTLAVSTFAKLSSQTPSSPLTIYSGSEASGHTEIPQPSALPGIDVGSSVMSPQDSFKEIHVNIEATFKPSSEEYLHITEPPSLSPDTKLEPSEDDGKPELLEEMEASPTELIAVEGTEILQDFQNKTDGQVSGEAIKMFPTIKTPEAGTVITTADEIELEGATQWPHSTSASATYGVEAGVVPWLSPQTSERPTLSSSPEINPETQAALIRGQDSTIAASEQQVAARILDSNDQATVNPVEFNTEVATPPFSLLETSNETDFLIGINEESVEGTAIYLPGPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMNPSAYQRTYSMKYFKNSSSAKDNSINTSKHDHRWSRRWQESRR", "length": 2409, "header": "sp|P13611-2|CSPG2_HUMAN Isoform 2 of Versican core protein OS=Homo sapiens OX=9606 GN=VCAN PE=1 SV=3 CANONICAL=P13611-1" }, "locus": { "chromosome": "5", "start_pos": 83580431, "end_pos": 83483519, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000343200.9", "url": "https://www.ensembl.org/id/ENST00000343200.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000340062.5", "url": "https://www.ensembl.org/id/ENSP00000340062.5" } ] } }, { "isoform_ac": "P13611-3", "url": "", "sequence": { "sequence": "MFINIKSILWMCSTLIVTHALHKVKVGKSPPVRGSLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAAQKACLDVGAVIATPEQLFAAYEDGFEQCDAGWLADQTVRYPIRAPRVGCYGDKMGKAGVRTYGFRSPQETYDVYCYVDHLDGDVFHLTVPSKFTFEEAAKECENQDARLATVGELQAAWRNGFDQCDYGWLSDASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKPKEATTIDLSILAETASPSLSKEPQMVSDRTTPIIPLVDELPVIPTEFPPVGNIVSFEQKATVQPQAITDSLATKLPTPTGSTKKPWDMDDYSPSASGPLGKLDISEIKEEVLQSTTGVSHYATDSWDGVVEDKQTQESVTQIEQIEVGPLVTSMEILKHIPSKEFPVTETPLVTARMILESKTEKKMVSTVSELVTTGHYGFTLGEEDDEDRTLTVGSDESTLIFDQIPEVITVSKTSEDTIHTHLEDLESVSASTTVSPLIMPDNNGSSMDDWEERQTSGRITEEFLGKYLSTTPFPSQHRTEIELFPYSGDKILVEGISTVIYPSLQTEMTHRRERTETLIPEMRTDTYTDEIQEEITKSPFMGKTEEEVFSGMKLSTSLSEPIHVTESSVEMTKSFDFPTLITKLSAEPTEVRDMEEDFTATPGTTKYDENITTVLLAHGTLSVEAATVSKWSWDEDNTTSKPLESTEPSASSKLPPALLTTVGMNGKDKDIPSFTEDGADEFTLIPDSTQKQLEEVTDEDIAAHGKFTIRFQPTTSTGIAEKSTLRDSTTEEKVPPITSTEGQVYATMEGSALGEVEDVDLSKPVSTVPQFAHTSEVEGLAFVSYSSTQEPTTYVDSSHTIPLSVIPKTDWGVLVPSVPSEDEVLGEPSQDILVIDQTRLEATISPETMRTTKITEGTTQEEFPWKEQTAEKPVPALSSTAWTPKEAVTPLDEQEGDGSAYTVSEDELLTGSERVPVLETTPVGKIDHSVSYPPGAVTEHKVKTDEVVTLTPRIGPKVSLSPGPEQKYETEGSSTTGFTSSLSPFSTHITQLMEETTTEKTSLEDIDLGSGLFEKPKATELIEFSTIKVTVPSDITTAFSSVDRLHTTSAFKPSSAITKKPPLIDREPGEETTSDMVIIGESTSHVPPTTLEDIVAKETETDIDREYFTTSSPPATQPTRPPTVEDKEAFGPQALSTPQPPASTKFHPDINVYIIEVRENKTGPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMNPSAYQRTYSMKYFKNSSSAKDNSINTSKHDHRWSRRWQESRR", "length": 1642, "header": "sp|P13611-3|CSPG2_HUMAN Isoform 3 of Versican core protein OS=Homo sapiens OX=9606 GN=VCAN PE=1 SV=3 CANONICAL=P13611-1" }, "locus": { "chromosome": "5", "start_pos": 83580431, "end_pos": 83483519, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000342785.8", "url": "https://www.ensembl.org/id/ENST00000342785.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000342768.4", "url": "https://www.ensembl.org/id/ENSP00000342768.4" } ] } }, { "isoform_ac": "P13611-4", "url": "", "sequence": { "sequence": "MFINIKSILWMCSTLIVTHALHKVKVGKSPPVRGSLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAAQKACLDVGAVIATPEQLFAAYEDGFEQCDAGWLADQTVRYPIRAPRVGCYGDKMGKAGVRTYGFRSPQETYDVYCYVDHLDGDVFHLTVPSKFTFEEAAKECENQDARLATVGELQAAWRNGFDQCDYGWLSDASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKRPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMNPSAYQRTYSMKYFKNSSSAKDNSINTSKHDHRWSRRWQESRR", "length": 655, "header": "sp|P13611-4|CSPG2_HUMAN Isoform 4 of Versican core protein OS=Homo sapiens OX=9606 GN=VCAN PE=1 SV=3 CANONICAL=P13611-1" }, "locus": { "chromosome": "5", "start_pos": 83580431, "end_pos": 83483519, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000502527.2", "url": "https://www.ensembl.org/id/ENST00000502527.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000421362.2", "url": "https://www.ensembl.org/id/ENSP00000421362.2" } ] } }, { "isoform_ac": "P13611-5", "url": "", "sequence": { "sequence": "MFINIKSILWMCSTLIVTHALHKVKVGKSPPVRGSLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAAQKACLDVGAVIATPEQLFAAYEDGFEQCDAGWLADQTVRYPIRAPRVGCYGDKMGKAGVRTYGFRSPQETYDVYCYVDHLDGDVFHLTVPSKFTFEEAAKECENQDARLATVGELQAAWRNGFDQCDYGWLSDASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKPKEATTIDLSILAETASPSLSKEPQMVSDRTTPIIPLVDELPVIPTEFPPVGNIVSFEQKATVQPQAITDSLATKLPTPTGSTKKPWDMDDYSPSASGPLGKLDISEIKEEVLQSTTGVSHYATDSWDGVVEDKQTQESVTQIEQIEVGPLVTSMEILKHIPSKEFPVTETPLVTARMILESKTEKKMVSTVSELVTTGHYGFTLGEEDDEDRTLTVGSDESTLIFDQIPEVITVSKTSEDTIHTHLEDLESVSASTTVSPLIMPDNNGSSMDDWEERQTSGRITEEFLGKYLSTTPFPSQHRTEIELFPYSGDKILVEGISTVIYPSLQTEMTHRRERTETLIPEMRTDTYTDEIQEEITKSPFMGKTEEEVFSGMKLSTSLSEPIHVTESSVEMTKSFDFPTLITKLSAEPTEVRDMEEDFTATPGTTKYDENITTVLLAHGTLSVEAATVSKWSWDEDNTTSKPLESTEPSASSKLPPALLTTVGMNGKDKDIPSFTEDGADEFTLIPDSTQKQLEEVTDEDIAAHGKFTIRFQPTTSTGIAEKSTLRDSTTEEKVPPITSTEGQVYATMEGSALGEVEDVDLSKPVSTVPQFAHTSEVEGLAFVSYSSTQEPTTYVDSSHTIPLSVIPKTDWGVLVPSVPSEDEVLGEPSQDILVIDQTRLEATISPETMRTTKITEGTTQEEFPWKEQTAEKPVPALSSTAWTPKEAVTPLDEQEGDGSAYTVSEDELLTGSERVPVLETTPVGKIDHSVSYPPGAVTEHKVKTDEVVTLTPRIGPKVSLSPGPEQKYETEGSSTTGFTSSLSPFSTHITQLMEETTTEKTSLEDIDLGSGLFEKPKATELIEFSTIKVTVPSDITTAFSSVDRLHTTSAFKPSSAITKKPPLIDREPGEETTSDMVIIGESTSHVPPTTLEDIVAKETETDIDREYFTTSSPPATQPTRPPTVEDKEAFGPQALSTPQPPASTKFHPDINVYIIEVRENKTGRMSDLSVIGHPIDSESKEDEPCSEETDPVHDLMAEILPEFPDIIEIDLYHSEENEEEEEECANATDVTTTPSVQYINGKHLVTTVPKDPEAAEARRGQFESVAPSQNFSDSSESDTHPFVIAKTELSTAVQPNESTETTESLEVTWKPETYPETSEHFSGGEPDVFPTVPFHEEFESGTAKKGAESVTERDTEVGHQAHEHTEPVSLFPEESSGEIAIDQESQKIAFARATEVTFGEEVEKSTSVTYTPTIVPSSASAYVSEEEAVTLIGNPWPDDLLSTKESWVEATPRQVVELSGSSSIPITEGSGEAEEDEDTMFTMVTDLSQRNTTDTLITLDTSRIITESFFEVPATTIYPVSEQPSAKVVPTKFVSETDTSEWISSTTVEEKKRKEEEGTTGTASTFEVYSSTQRSDQLILPFELESPNVATSSDSGTRKSFMSLTTPTQSEREMTDSTPVFTETNTLENLGAQTTEHSSIHQPGVQEGLTTLPRSPASVFMEQGSGEAAADPETTTVSSFSLNVEYAIQAEKEVAGTLSPHVETTFSTEPTGLVLSTVMDRVVAENITQTSREIVISERLGEPNYGAEIRGFSTGFPLEEDFSGDFREYSTVSHPIAKEETVMMEGSGDAAFRDTQTSPSTVPTSVHISHISDSEGPSSTMVSTSAFPWEEFTSSAEGSGEQLVTVSSSVVPVLPSAVQKFSGTASSIIDEGLGEVGTVNEIDRRSTILPTAEVEGTKAPVEKEEVKVSGTVSTNFPQTIEPAKLWSRQEVNPVRQEIESETTSEEQIQEEKSFESPQNSPATEQTIFDSQTFTETELKTTDYSVLTTKKTYSDDKEMKEEDTSLVNMSTPDPDANGLESYTTLPEATEKSHFFLATALVTESIPAEHVVTDSPIKKEESTKHFPKGMRPTIQESDTELLFSGLGSGEEVLPTLPTESVNFTEVEQINNTLYPHTSQVESTSSDKIEDFNRMENVAKEVGPLVSQTDIFEGSGSVTSTTLIEILSDTGAEGPTVAPLPFSTDIGHPQNQTVRWAEEIQTSRPQTITEQDSNKNSSTAEINETTTSSTDFLARAYGFEMAKEFVTSAPKPSDLYYEPSGEGSGEVDIVDSFHTSATTQATRQESSTTFVSDGSLEKHPEVPSAKAVTADGFPTVSVMLPLHSEQNKSSPDPTSTLSNTVSYERSTDGSFQDRFREFEDSTLKPNRKKPTENIIIDLDKEDKDLILTITESTILEILPELTSDKNTIIDIDHTKPVYEDILGMQTDIDTEVPSEPHDSNDESNDDSTQVQEIYEAAVNLSLTEETFEGSADVLASYTQATHDESMTYEDRSQLDHMGFHFTTGIPAPSTETELDVLLPTATSLPIPRKSATVIPEIEGIKAEAKALDDMFESSTLSDGQAIADQSEIIPTLGQFERTQEEYEDKKHAGPSFQPEFSSGAEEALVDHTPYLSIATTHLMDQSVTEVPDVMEGSNPPYYTDTTLAVSTFAKLSSQTPSSPLTIYSGSEASGHTEIPQPSALPGIDVGSSVMSPQDSFKEIHVNIEATFKPSSEEYLHITEPPSLSPDTKLEPSEDDGKPELLEEMEASPTELIAVEGTEILQDFQNKTDGQVSGEAIKMFPTIKTPEAGTVITTADEIELEGATQWPHSTSASATYGVEAGVVPWLSPQTSERPTLSSSPEINPETQAALIRGQDSTIAASEQQVAARILDSNDQATVNPVEFNTEVATPPFSLLETSNETDFLIGINEESVEGTAIYLPGPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMNRKWSFRKNGLPCYNNY", "length": 3370, "header": "sp|P13611-5|CSPG2_HUMAN Isoform 5 of Versican core protein OS=Homo sapiens OX=9606 GN=VCAN PE=1 SV=3 CANONICAL=P13611-1" }, "locus": {} }, { "isoform_ac": "Q86W61-1", "url": "", "sequence": { "sequence": "MFINIKSILWMCSTLIVTHALHKVKVGKSPPVRGSLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAAQKACLDVGAVIATPEQLFAAYEDGFEQCDAGWLADQTVRYPIRAPRVGCYGDKMGKAGVRTYGFRSPQETYDVYCYVDHLDGDVFHLTVPSKFTFEEAAKECENQDARLATVGELQAAWRNGFDQCDYGWLSDASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKRKCLIPF", "length": 354, "header": "tr|Q86W61-1|Q86W61_HUMAN Computationally mapped isoform of VCAN protein OS=Homo sapiens OX=9606 GN=VCAN PE=1 SV=1 CANONICAL=P13611-1" }, "locus": { "chromosome": "5", "start_pos": 83512416, "end_pos": 83483519, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000513984.5", "url": "https://www.ensembl.org/id/ENST00000513984.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000426715.1", "url": "https://www.ensembl.org/id/ENSP00000426715.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1001, "start_aa": "Ser", "end_pos": 1001, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1001", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1001, "start_aa": "Ser", "end_pos": 1001, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1001", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1015, "start_aa": "Thr", "end_pos": 1015, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1015", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1023, "start_aa": "Thr", "end_pos": 1023, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1023", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1027, "start_aa": "Thr", "end_pos": 1027, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1027", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1030, "start_aa": "Thr", "end_pos": 1030, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1030", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1030, "start_aa": "Thr", "end_pos": 1030, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1030", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1031, "start_aa": "Thr", "end_pos": 1031, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1031", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "EQTAEKPVPALSSTAWTPK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1039, "start_aa": "Glu", "end_pos": 1057, "end_aa": "Lys", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1041, "start_aa": "Thr", "end_pos": 1041, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1041", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1052, "start_aa": "Thr", "end_pos": 1052, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1052", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1074, "start_aa": "Thr", "end_pos": 1074, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1074", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1092, "start_aa": "Thr", "end_pos": 1092, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1092", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1093, "start_aa": "Thr", "end_pos": 1093, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1093", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "IDHSVSYPPGAVTEHK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1098, "start_aa": "Ile", "end_pos": 1113, "end_aa": "Lys", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1101, "start_aa": "Ser", "end_pos": 1101, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1101", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1103, "start_aa": "Ser", "end_pos": 1103, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1103", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1110, "start_aa": "Thr", "end_pos": 1110, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1110", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1116, "start_aa": "Thr", "end_pos": 1116, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1116", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1121, "start_aa": "Thr", "end_pos": 1121, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1121", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1123, "start_aa": "Thr", "end_pos": 1123, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1123", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1131, "start_aa": "Ser", "end_pos": 1131, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1131", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1133, "start_aa": "Ser", "end_pos": 1133, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1133", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1191, "start_aa": "Thr", "end_pos": 1191, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1191", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1212, "start_aa": "Ser", "end_pos": 1212, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1212", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1219, "start_aa": "Thr", "end_pos": 1219, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1219", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1220, "start_aa": "Thr", "end_pos": 1220, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1220", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1221, "start_aa": "Ser", "end_pos": 1221, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1221", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1256, "start_aa": "Ser", "end_pos": 1256, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1256", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1256, "start_aa": "Ser", "end_pos": 1256, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1256", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1261, "start_aa": "Thr", "end_pos": 1261, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1261", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1261, "start_aa": "Thr", "end_pos": 1261, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1261", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1262, "start_aa": "Thr", "end_pos": 1262, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1262", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1271, "start_aa": "Thr", "end_pos": 1271, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1271", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1291, "start_aa": "Thr", "end_pos": 1291, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1291", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1291, "start_aa": "Thr", "end_pos": 1291, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1291", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1291, "start_aa": "Thr", "end_pos": 1291, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1291", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1295, "start_aa": "Thr", "end_pos": 1295, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1295", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1308, "start_aa": "Ser", "end_pos": 1308, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1308", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1309, "start_aa": "Thr", "end_pos": 1309, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1309", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1309, "start_aa": "Thr", "end_pos": 1309, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1309", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1315, "start_aa": "Ser", "end_pos": 1315, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1315", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1316, "start_aa": "Thr", "end_pos": 1316, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1316", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 1332, "start_aa": "Asn", "end_pos": 1332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1332", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 1398, "start_aa": "Asn", "end_pos": 1398, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1398", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1403, "start_aa": "Thr", "end_pos": 1403, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1403", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1404, "start_aa": "Thr", "end_pos": 1404, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1404", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "HLVTTVPK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1415, "start_aa": "His", "end_pos": 1422, "end_aa": "Lys", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "HLVTTVPKDPEAAEAR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1415, "start_aa": "His", "end_pos": 1430, "end_aa": "Arg", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1418, "start_aa": "Thr", "end_pos": 1418, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1418", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1418, "start_aa": "Thr", "end_pos": 1418, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1418", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1419, "start_aa": "Thr", "end_pos": 1419, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1419", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1442, "start_aa": "Asn", "end_pos": 1442, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1442", "evidence": [ { "id": "1890", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1890" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 1442, "start_aa": "Asn", "end_pos": 1442, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1442", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1447, "start_aa": "Ser", "end_pos": 1447, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1447", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1451, "start_aa": "Thr", "end_pos": 1451, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1451", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1451, "start_aa": "Thr", "end_pos": 1451, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1451", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 1468, "start_aa": "Asn", "end_pos": 1468, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1468", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" } ] }, { "glytoucan_ac": "G57317CE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1473, "start_aa": "Thr", "end_pos": 1473, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1473", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1474, "start_aa": "Thr", "end_pos": 1474, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1474", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1480, "start_aa": "Thr", "end_pos": 1480, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1480", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1490, "start_aa": "Ser", "end_pos": 1490, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1490", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1503, "start_aa": "Thr", "end_pos": 1503, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1503", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1503, "start_aa": "Thr", "end_pos": 1503, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1503", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1537, "start_aa": "Thr", "end_pos": 1537, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1537", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1537, "start_aa": "Thr", "end_pos": 1537, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1537", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (Xyl...) (chondroitin sulfate) serine", "start_pos": 1548, "start_aa": "Ser", "end_pos": 1548, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1548", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" }, { "id": "32337544", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32337544" }, { "id": "36213313", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36213313" }, { "id": "25326458", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25326458" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1566, "start_aa": "Thr", "end_pos": 1566, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1566", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1566, "start_aa": "Thr", "end_pos": 1566, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1566", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1569, "start_aa": "Thr", "end_pos": 1569, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1569", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1569, "start_aa": "Thr", "end_pos": 1569, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1569", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1602, "start_aa": "Thr", "end_pos": 1602, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1602", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1602, "start_aa": "Thr", "end_pos": 1602, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1602", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1615, "start_aa": "Thr", "end_pos": 1615, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1615", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (Xyl...) (chondroitin sulfate) serine", "start_pos": 1631, "start_aa": "Ser", "end_pos": 1631, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1631", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" }, { "id": "32337544", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32337544" }, { "id": "36213313", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36213313" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1654, "start_aa": "Thr", "end_pos": 1654, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1654", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G62461SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1663, "start_aa": "Asn", "end_pos": 1663, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1663", "evidence": [ { "id": "1890", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1890" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 1663, "start_aa": "Asn", "end_pos": 1663, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1663", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1665, "start_aa": "Thr", "end_pos": 1665, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1665", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G73004SD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1687, "start_aa": "Thr", "end_pos": 1687, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1687", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1688, "start_aa": "Thr", "end_pos": 1688, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1688", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1716, "start_aa": "Ser", "end_pos": 1716, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1716", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1719, "start_aa": "Thr", "end_pos": 1719, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1719", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1731, "start_aa": "Thr", "end_pos": 1731, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1731", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1734, "start_aa": "Thr", "end_pos": 1734, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1734", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1734, "start_aa": "Thr", "end_pos": 1734, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1734", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1734, "start_aa": "Thr", "end_pos": 1734, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1734", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1734, "start_aa": "Thr", "end_pos": 1734, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1734", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G88713AC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1734, "start_aa": "Thr", "end_pos": 1734, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1734", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57317CE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1742, "start_aa": "Ser", "end_pos": 1742, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1742", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1742, "start_aa": "Ser", "end_pos": 1742, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1742", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1743, "start_aa": "Ser", "end_pos": 1743, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1743", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1744, "start_aa": "Thr", "end_pos": 1744, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1744", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1747, "start_aa": "Ser", "end_pos": 1747, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1747", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1747, "start_aa": "Ser", "end_pos": 1747, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1747", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1758, "start_aa": "Ser", "end_pos": 1758, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1758", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1763, "start_aa": "Thr", "end_pos": 1763, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1763", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1765, "start_aa": "Ser", "end_pos": 1765, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1765", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1769, "start_aa": "Thr", "end_pos": 1769, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1769", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1772, "start_aa": "Ser", "end_pos": 1772, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1772", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1775, "start_aa": "Ser", "end_pos": 1775, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1775", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1777, "start_aa": "Thr", "end_pos": 1777, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1777", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1778, "start_aa": "Thr", "end_pos": 1778, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1778", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1780, "start_aa": "Thr", "end_pos": 1780, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1780", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1806, "start_aa": "Thr", "end_pos": 1806, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1806", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57317CE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1806, "start_aa": "Thr", "end_pos": 1806, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1806", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G73004SD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1806, "start_aa": "Thr", "end_pos": 1806, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1806", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1807, "start_aa": "Thr", "end_pos": 1807, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1807", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1810, "start_aa": "Ser", "end_pos": 1810, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1810", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1810, "start_aa": "Ser", "end_pos": 1810, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1810", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1810, "start_aa": "Ser", "end_pos": 1810, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1810", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1811, "start_aa": "Ser", "end_pos": 1811, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1811", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57317CE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1847, "start_aa": "Thr", "end_pos": 1847, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1847", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1848, "start_aa": "Thr", "end_pos": 1848, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1848", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1853, "start_aa": "Ser", "end_pos": 1853, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1853", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1853, "start_aa": "Ser", "end_pos": 1853, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1853", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1880, "start_aa": "Thr", "end_pos": 1880, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1880", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G33791AF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1898, "start_aa": "Asn", "end_pos": 1898, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1898", "evidence": [ { "id": "1890", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1890" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G57888GL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1898, "start_aa": "Asn", "end_pos": 1898, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1898", "evidence": [ { "id": "1890", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1890" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 1898, "start_aa": "Asn", "end_pos": 1898, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1898", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1909, "start_aa": "Ser", "end_pos": 1909, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1909", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "Y", "relation": "attached", "comment": "", "start_pos": 1917, "start_aa": "Tyr", "end_pos": 1917, "end_aa": "Tyr", "residue": "Tyr", "site_lbl": "Tyr1917", "evidence": [ { "id": "GLY_000268", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000268" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1925, "start_aa": "Ser", "end_pos": 1925, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1925", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1926, "start_aa": "Thr", "end_pos": 1926, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1926", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1926, "start_aa": "Thr", "end_pos": 1926, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1926", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1935, "start_aa": "Ser", "end_pos": 1935, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1935", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (Xyl...) (chondroitin sulfate) serine", "start_pos": 1935, "start_aa": "Ser", "end_pos": 1935, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1935", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" }, { "id": "36213313", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36213313" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "EYSTVSHPIAK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1940, "start_aa": "Glu", "end_pos": 1950, "end_aa": "Lys", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1942, "start_aa": "Ser", "end_pos": 1942, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1942", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1942, "start_aa": "Ser", "end_pos": 1942, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1942", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 1942, "start_aa": "Ser", "end_pos": 1942, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1942", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1943, "start_aa": "Thr", "end_pos": 1943, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1943", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1943, "start_aa": "Thr", "end_pos": 1943, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1943", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1943, "start_aa": "Thr", "end_pos": 1943, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1943", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1945, "start_aa": "Ser", "end_pos": 1945, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1945", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (Xyl...) (chondroitin sulfate) serine", "start_pos": 1959, "start_aa": "Ser", "end_pos": 1959, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1959", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" }, { "id": "32337544", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32337544" }, { "id": "36213313", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36213313" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1973, "start_aa": "Thr", "end_pos": 1973, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1973", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 1996, "start_aa": "Thr", "end_pos": 1996, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1996", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57317CE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2017, "start_aa": "Thr", "end_pos": 2017, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2017", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2020, "start_aa": "Ser", "end_pos": 2020, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2020", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2021, "start_aa": "Ser", "end_pos": 2021, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2021", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2021, "start_aa": "Ser", "end_pos": 2021, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2021", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2034, "start_aa": "Ser", "end_pos": 2034, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2034", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2036, "start_aa": "Thr", "end_pos": 2036, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2036", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2036, "start_aa": "Thr", "end_pos": 2036, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2036", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2036, "start_aa": "Thr", "end_pos": 2036, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2036", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57317CE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2036, "start_aa": "Thr", "end_pos": 2036, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2036", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2036, "start_aa": "Thr", "end_pos": 2036, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2036", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2039, "start_aa": "Ser", "end_pos": 2039, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2039", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2050, "start_aa": "Thr", "end_pos": 2050, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2050", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2050, "start_aa": "Thr", "end_pos": 2050, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2050", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2058, "start_aa": "Ser", "end_pos": 2058, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2058", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2059, "start_aa": "Thr", "end_pos": 2059, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2059", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2063, "start_aa": "Thr", "end_pos": 2063, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2063", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2069, "start_aa": "Thr", "end_pos": 2069, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2069", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2069, "start_aa": "Thr", "end_pos": 2069, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2069", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2083, "start_aa": "Thr", "end_pos": 2083, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2083", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2083, "start_aa": "Thr", "end_pos": 2083, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2083", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2083, "start_aa": "Thr", "end_pos": 2083, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2083", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57317CE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2083, "start_aa": "Thr", "end_pos": 2083, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2083", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2083, "start_aa": "Thr", "end_pos": 2083, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2083", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G88713AC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2083, "start_aa": "Thr", "end_pos": 2083, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2083", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2085, "start_aa": "Ser", "end_pos": 2085, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2085", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2086, "start_aa": "Thr", "end_pos": 2086, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2086", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2086, "start_aa": "Thr", "end_pos": 2086, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2086", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2091, "start_aa": "Thr", "end_pos": 2091, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2091", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2135, "start_aa": "Thr", "end_pos": 2135, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2135", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2135, "start_aa": "Thr", "end_pos": 2135, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2135", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57317CE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2135, "start_aa": "Thr", "end_pos": 2135, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2135", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G73004SD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2135, "start_aa": "Thr", "end_pos": 2135, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2135", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G88713AC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2135, "start_aa": "Thr", "end_pos": 2135, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2135", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2144, "start_aa": "Thr", "end_pos": 2144, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2144", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2144, "start_aa": "Thr", "end_pos": 2144, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2144", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2152, "start_aa": "Thr", "end_pos": 2152, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2152", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2152, "start_aa": "Thr", "end_pos": 2152, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2152", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2152, "start_aa": "Thr", "end_pos": 2152, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2152", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G73004SD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2152, "start_aa": "Thr", "end_pos": 2152, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2152", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2153, "start_aa": "Thr", "end_pos": 2153, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2153", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2153, "start_aa": "Thr", "end_pos": 2153, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2153", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2159, "start_aa": "Thr", "end_pos": 2159, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2159", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2160, "start_aa": "Thr", "end_pos": 2160, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2160", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 2179, "start_aa": "Asn", "end_pos": 2179, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2179", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2194, "start_aa": "Thr", "end_pos": 2194, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2194", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2194, "start_aa": "Thr", "end_pos": 2194, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2194", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2200, "start_aa": "Thr", "end_pos": 2200, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2200", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2203, "start_aa": "Ser", "end_pos": 2203, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2203", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2213, "start_aa": "Thr", "end_pos": 2213, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2213", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2213, "start_aa": "Thr", "end_pos": 2213, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2213", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2213, "start_aa": "Thr", "end_pos": 2213, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2213", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2213, "start_aa": "Thr", "end_pos": 2213, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2213", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2215, "start_aa": "Ser", "end_pos": 2215, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2215", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2215, "start_aa": "Ser", "end_pos": 2215, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2215", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (Xyl...) (chondroitin sulfate) serine", "start_pos": 2247, "start_aa": "Ser", "end_pos": 2247, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2247", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" }, { "id": "32337544", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32337544" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (Xyl...) (chondroitin sulfate) serine", "start_pos": 2254, "start_aa": "Ser", "end_pos": 2254, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2254", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" }, { "id": "36213313", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36213313" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 2272, "start_aa": "Asn", "end_pos": 2272, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2272", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 2280, "start_aa": "Asn", "end_pos": 2280, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2280", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2294, "start_aa": "Ser", "end_pos": 2294, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2294", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57317CE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2328, "start_aa": "Thr", "end_pos": 2328, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2328", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2330, "start_aa": "Thr", "end_pos": 2330, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2330", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2330, "start_aa": "Thr", "end_pos": 2330, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2330", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57317CE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2330, "start_aa": "Thr", "end_pos": 2330, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2330", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2330, "start_aa": "Thr", "end_pos": 2330, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2330", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G73004SD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2330, "start_aa": "Thr", "end_pos": 2330, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2330", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2331, "start_aa": "Thr", "end_pos": 2331, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2331", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2331, "start_aa": "Thr", "end_pos": 2331, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2331", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2345, "start_aa": "Thr", "end_pos": 2345, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2345", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 2360, "start_aa": "Asn", "end_pos": 2360, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2360", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 2385, "start_aa": "Asn", "end_pos": 2385, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2385", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 2392, "start_aa": "Asn", "end_pos": 2392, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2392", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2394, "start_aa": "Thr", "end_pos": 2394, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2394", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57317CE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2394, "start_aa": "Thr", "end_pos": 2394, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2394", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G73004SD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2394, "start_aa": "Thr", "end_pos": 2394, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2394", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G88713AC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2394, "start_aa": "Thr", "end_pos": 2394, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2394", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G27391WQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2395, "start_aa": "Thr", "end_pos": 2395, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2395", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2395, "start_aa": "Thr", "end_pos": 2395, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2395", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2395, "start_aa": "Thr", "end_pos": 2395, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2395", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2395, "start_aa": "Thr", "end_pos": 2395, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2395", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2395, "start_aa": "Thr", "end_pos": 2395, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2395", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2396, "start_aa": "Thr", "end_pos": 2396, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2396", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2396, "start_aa": "Thr", "end_pos": 2396, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2396", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "Y", "relation": "attached", "comment": "", "start_pos": 2406, "start_aa": "Tyr", "end_pos": 2406, "end_aa": "Tyr", "residue": "Tyr", "site_lbl": "Tyr2406", "evidence": [ { "id": "GLY_000268", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000268" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2416, "start_aa": "Thr", "end_pos": 2416, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2416", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2417, "start_aa": "Ser", "end_pos": 2417, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2417", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2422, "start_aa": "Ser", "end_pos": 2422, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2422", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2448, "start_aa": "Thr", "end_pos": 2448, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2448", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2455, "start_aa": "Ser", "end_pos": 2455, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2455", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2456, "start_aa": "Ser", "end_pos": 2456, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2456", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2456, "start_aa": "Ser", "end_pos": 2456, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2456", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2456, "start_aa": "Ser", "end_pos": 2456, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2456", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2457, "start_aa": "Thr", "end_pos": 2457, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2457", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2457, "start_aa": "Thr", "end_pos": 2457, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2457", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2457, "start_aa": "Thr", "end_pos": 2457, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2457", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2458, "start_aa": "Thr", "end_pos": 2458, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2458", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2473, "start_aa": "Ser", "end_pos": 2473, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2473", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 2496, "start_aa": "Asn", "end_pos": 2496, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2496", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2503, "start_aa": "Thr", "end_pos": 2503, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2503", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2503, "start_aa": "Thr", "end_pos": 2503, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2503", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2505, "start_aa": "Thr", "end_pos": 2505, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2505", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2505, "start_aa": "Thr", "end_pos": 2505, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2505", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2505, "start_aa": "Thr", "end_pos": 2505, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2505", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2509, "start_aa": "Thr", "end_pos": 2509, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2509", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2515, "start_aa": "Ser", "end_pos": 2515, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2515", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2515, "start_aa": "Ser", "end_pos": 2515, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2515", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2516, "start_aa": "Thr", "end_pos": 2516, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2516", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "EFEDSTLKPNR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2526, "start_aa": "Glu", "end_pos": 2536, "end_aa": "Arg", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2530, "start_aa": "Ser", "end_pos": 2530, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2530", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "ST", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2530, "start_aa": "Ser", "end_pos": 2531, "end_aa": "Thr", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2531, "start_aa": "Thr", "end_pos": 2531, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2531", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2540, "start_aa": "Thr", "end_pos": 2540, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2540", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2540, "start_aa": "Thr", "end_pos": 2540, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2540", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2559, "start_aa": "Thr", "end_pos": 2559, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2559", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2559, "start_aa": "Thr", "end_pos": 2559, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2559", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57317CE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2559, "start_aa": "Thr", "end_pos": 2559, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2559", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2559, "start_aa": "Thr", "end_pos": 2559, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2559", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2571, "start_aa": "Thr", "end_pos": 2571, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2571", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2572, "start_aa": "Ser", "end_pos": 2572, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2572", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2583, "start_aa": "Thr", "end_pos": 2583, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2583", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 2628, "start_aa": "Asn", "end_pos": 2628, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2628", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2656, "start_aa": "Thr", "end_pos": 2656, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2656", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2661, "start_aa": "Ser", "end_pos": 2661, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2661", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2661, "start_aa": "Ser", "end_pos": 2661, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2661", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2661, "start_aa": "Ser", "end_pos": 2661, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2661", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2671, "start_aa": "Thr", "end_pos": 2671, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2671", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2672, "start_aa": "Thr", "end_pos": 2672, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2672", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2691, "start_aa": "Thr", "end_pos": 2691, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2691", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2691, "start_aa": "Thr", "end_pos": 2691, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2691", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2691, "start_aa": "Thr", "end_pos": 2691, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2691", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2699, "start_aa": "Ser", "end_pos": 2699, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2699", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2699, "start_aa": "Ser", "end_pos": 2699, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2699", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2701, "start_aa": "Thr", "end_pos": 2701, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2701", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2701, "start_aa": "Thr", "end_pos": 2701, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2701", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2701, "start_aa": "Thr", "end_pos": 2701, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2701", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "predicted", "site_seq": "S", "relation": "attached", "comment": "O-linked (Xyl...) (chondroitin sulfate) serine", "start_pos": 2722, "start_aa": "Ser", "end_pos": 2722, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2722", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2723, "start_aa": "Ser", "end_pos": 2723, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2723", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (Xyl...) (chondroitin sulfate) serine", "start_pos": 2723, "start_aa": "Ser", "end_pos": 2723, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2723", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" }, { "id": "36213313", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36213313" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2724, "start_aa": "Thr", "end_pos": 2724, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2724", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2724, "start_aa": "Thr", "end_pos": 2724, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2724", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2740, "start_aa": "Thr", "end_pos": 2740, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2740", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2760, "start_aa": "Ser", "end_pos": 2760, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2760", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2767, "start_aa": "Ser", "end_pos": 2767, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2767", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (Xyl...) (chondroitin sulfate) serine", "start_pos": 2767, "start_aa": "Ser", "end_pos": 2767, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2767", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" }, { "id": "32337544", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32337544" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2781, "start_aa": "Ser", "end_pos": 2781, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2781", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2784, "start_aa": "Thr", "end_pos": 2784, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2784", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2784, "start_aa": "Thr", "end_pos": 2784, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2784", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2785, "start_aa": "Thr", "end_pos": 2785, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2785", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2791, "start_aa": "Ser", "end_pos": 2791, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2791", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2793, "start_aa": "Thr", "end_pos": 2793, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2793", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2811, "start_aa": "Thr", "end_pos": 2811, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2811", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2826, "start_aa": "Ser", "end_pos": 2826, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2826", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2826, "start_aa": "Ser", "end_pos": 2826, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2826", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2827, "start_aa": "Ser", "end_pos": 2827, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2827", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2827, "start_aa": "Ser", "end_pos": 2827, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2827", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2827, "start_aa": "Ser", "end_pos": 2827, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2827", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2830, "start_aa": "Thr", "end_pos": 2830, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2830", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2830, "start_aa": "Thr", "end_pos": 2830, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2830", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G27391WQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2847, "start_aa": "Ser", "end_pos": 2847, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2847", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2847, "start_aa": "Ser", "end_pos": 2847, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2847", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2847, "start_aa": "Ser", "end_pos": 2847, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2847", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2847, "start_aa": "Ser", "end_pos": 2847, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2847", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2856, "start_aa": "Ser", "end_pos": 2856, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2856", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2856, "start_aa": "Ser", "end_pos": 2856, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2856", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2856, "start_aa": "Ser", "end_pos": 2856, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2856", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2856, "start_aa": "Ser", "end_pos": 2856, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2856", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G27391WQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2857, "start_aa": "Ser", "end_pos": 2857, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2857", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2857, "start_aa": "Ser", "end_pos": 2857, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2857", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2857, "start_aa": "Ser", "end_pos": 2857, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2857", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2860, "start_aa": "Ser", "end_pos": 2860, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2860", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2875, "start_aa": "Thr", "end_pos": 2875, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2875", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2879, "start_aa": "Ser", "end_pos": 2879, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2879", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2879, "start_aa": "Ser", "end_pos": 2879, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2879", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2879, "start_aa": "Ser", "end_pos": 2879, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2879", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57317CE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2879, "start_aa": "Ser", "end_pos": 2879, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2879", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2887, "start_aa": "Thr", "end_pos": 2887, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2887", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2893, "start_aa": "Ser", "end_pos": 2893, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2893", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 2934, "start_aa": "Asn", "end_pos": 2934, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2934", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2936, "start_aa": "Thr", "end_pos": 2936, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2936", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2936, "start_aa": "Thr", "end_pos": 2936, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2936", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (Xyl...) (chondroitin sulfate) serine", "start_pos": 2941, "start_aa": "Ser", "end_pos": 2941, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2941", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" }, { "id": "36213313", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36213313" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 2950, "start_aa": "Thr", "end_pos": 2950, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2950", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57317CE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2958, "start_aa": "Thr", "end_pos": 2958, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2958", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57317CE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2977, "start_aa": "Ser", "end_pos": 2977, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2977", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2978, "start_aa": "Thr", "end_pos": 2978, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2978", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2981, "start_aa": "Ser", "end_pos": 2981, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2981", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2983, "start_aa": "Thr", "end_pos": 2983, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2983", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2983, "start_aa": "Thr", "end_pos": 2983, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2983", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2983, "start_aa": "Thr", "end_pos": 2983, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2983", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 2983, "start_aa": "Thr", "end_pos": 2983, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr2983", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2999, "start_aa": "Ser", "end_pos": 2999, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2999", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57317CE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2999, "start_aa": "Ser", "end_pos": 2999, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2999", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 2999, "start_aa": "Ser", "end_pos": 2999, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2999", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 3003, "start_aa": "Thr", "end_pos": 3003, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3003", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 3003, "start_aa": "Thr", "end_pos": 3003, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3003", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 3003, "start_aa": "Thr", "end_pos": 3003, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3003", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57317CE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 3003, "start_aa": "Thr", "end_pos": 3003, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3003", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 3003, "start_aa": "Thr", "end_pos": 3003, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3003", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G73004SD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 3003, "start_aa": "Thr", "end_pos": 3003, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3003", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G88713AC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 3003, "start_aa": "Thr", "end_pos": 3003, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3003", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 3005, "start_aa": "Ser", "end_pos": 3005, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser3005", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 3005, "start_aa": "Ser", "end_pos": 3005, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser3005", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57317CE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 3005, "start_aa": "Ser", "end_pos": 3005, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser3005", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G73004SD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 3005, "start_aa": "Ser", "end_pos": 3005, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser3005", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G88713AC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 3005, "start_aa": "Ser", "end_pos": 3005, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser3005", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 3006, "start_aa": "Ser", "end_pos": 3006, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser3006", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 3014, "start_aa": "Thr", "end_pos": 3014, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3014", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 3014, "start_aa": "Thr", "end_pos": 3014, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3014", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 3024, "start_aa": "Ser", "end_pos": 3024, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser3024", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G81006GJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 3024, "start_aa": "Ser", "end_pos": 3024, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser3024", "evidence": [ { "id": "1890", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1890" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 3025, "start_aa": "Thr", "end_pos": 3025, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3025", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 3025, "start_aa": "Thr", "end_pos": 3025, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3025", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 3025, "start_aa": "Thr", "end_pos": 3025, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3025", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 3029, "start_aa": "Ser", "end_pos": 3029, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser3029", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 3029, "start_aa": "Ser", "end_pos": 3029, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser3029", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 3045, "start_aa": "Thr", "end_pos": 3045, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3045", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 3067, "start_aa": "Asn", "end_pos": 3067, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3067", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 3083, "start_aa": "Thr", "end_pos": 3083, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3083", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 3083, "start_aa": "Thr", "end_pos": 3083, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3083", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 3141, "start_aa": "Thr", "end_pos": 3141, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr3141", "evidence": [ { "id": "P13611", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P13611" }, { "id": "28411811", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28411811" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "P13611", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P13611" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "1890", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1890" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G43089EG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "1890", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1890" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G46524LG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "1890", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1890" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G51640FO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "1890", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1890" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "1890", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1890" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "1890", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1890" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "1890", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1890" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3354, "start_aa": "Asn", "end_pos": 3354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3354", "evidence": [ { "id": "1890", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1890" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3354, "start_aa": "Asn", "end_pos": 3354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3354", "evidence": [ { "id": "1890", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1890" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G33791AF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3369, "start_aa": "Asn", "end_pos": 3369, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3369", "evidence": [ { "id": "1890", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1890" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G57888GL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3369, "start_aa": "Asn", "end_pos": 3369, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3369", "evidence": [ { "id": "1890", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1890" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 3369, "start_aa": "Asn", "end_pos": 3369, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3369", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" } ] }, { "glytoucan_ac": "G37881RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 3379, "start_aa": "Asn", "end_pos": 3379, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3379", "evidence": [ { "id": "1890", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1890" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 3379, "start_aa": "Asn", "end_pos": 3379, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3379", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 362, "start_aa": "Thr", "end_pos": 362, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr362", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 364, "start_aa": "Ser", "end_pos": 364, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser364", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 393, "start_aa": "Thr", "end_pos": 393, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr393", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 440, "start_aa": "Ser", "end_pos": 440, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser440", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 442, "start_aa": "Ser", "end_pos": 442, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser442", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 464, "start_aa": "Thr", "end_pos": 464, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr464", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 471, "start_aa": "Thr", "end_pos": 471, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr471", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 471, "start_aa": "Thr", "end_pos": 471, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr471", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 500, "start_aa": "Thr", "end_pos": 500, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr500", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 510, "start_aa": "Ser", "end_pos": 510, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser510", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 516, "start_aa": "Thr", "end_pos": 516, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr516", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 518, "start_aa": "Thr", "end_pos": 518, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr518", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 51, "start_aa": "Thr", "end_pos": 51, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr51", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 522, "start_aa": "Thr", "end_pos": 522, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr522", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 544, "start_aa": "Thr", "end_pos": 544, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr544", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 544, "start_aa": "Thr", "end_pos": 544, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr544", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G73004SD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 544, "start_aa": "Thr", "end_pos": 544, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr544", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G88713AC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 544, "start_aa": "Thr", "end_pos": 544, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr544", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 545, "start_aa": "Thr", "end_pos": 545, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr545", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 551, "start_aa": "Thr", "end_pos": 551, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr551", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 563, "start_aa": "Thr", "end_pos": 563, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr563", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 563, "start_aa": "Thr", "end_pos": 563, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr563", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 566, "start_aa": "Ser", "end_pos": 566, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser566", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57317CE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 569, "start_aa": "Ser", "end_pos": 569, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser569", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 570, "start_aa": "Thr", "end_pos": 570, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr570", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 57, "start_aa": "Asn", "end_pos": 57, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn57", "evidence": [ { "id": "1890", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1890" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 57, "start_aa": "Asn", "end_pos": 57, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn57", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 586, "start_aa": "Ser", "end_pos": 586, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser586", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 589, "start_aa": "Thr", "end_pos": 589, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr589", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 615, "start_aa": "Asn", "end_pos": 615, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn615", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 627, "start_aa": "Thr", "end_pos": 627, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr627", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 627, "start_aa": "Thr", "end_pos": 627, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr627", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "ITEEFLGK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 631, "start_aa": "Ile", "end_pos": 638, "end_aa": "Lys", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 632, "start_aa": "Thr", "end_pos": 632, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr632", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 632, "start_aa": "Thr", "end_pos": 632, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr632", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 641, "start_aa": "Ser", "end_pos": 641, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser641", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 642, "start_aa": "Thr", "end_pos": 642, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr642", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 642, "start_aa": "Thr", "end_pos": 642, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr642", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 642, "start_aa": "Thr", "end_pos": 642, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr642", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 643, "start_aa": "Thr", "end_pos": 643, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr643", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 651, "start_aa": "Thr", "end_pos": 651, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr651", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (Xyl...) (chondroitin sulfate) serine", "start_pos": 659, "start_aa": "Ser", "end_pos": 659, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser659", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" }, { "id": "32337544", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32337544" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 670, "start_aa": "Thr", "end_pos": 670, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr670", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 687, "start_aa": "Thr", "end_pos": 687, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr687", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 689, "start_aa": "Thr", "end_pos": 689, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr689", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 689, "start_aa": "Thr", "end_pos": 689, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr689", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 716, "start_aa": "Thr", "end_pos": 716, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr716", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 716, "start_aa": "Thr", "end_pos": 716, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr716", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 727, "start_aa": "Ser", "end_pos": 727, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser727", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 728, "start_aa": "Thr", "end_pos": 728, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr728", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 737, "start_aa": "Thr", "end_pos": 737, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr737", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 751, "start_aa": "Thr", "end_pos": 751, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr751", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 754, "start_aa": "Thr", "end_pos": 754, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr754", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 782, "start_aa": "Asn", "end_pos": 782, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn782", "evidence": [ { "id": "1890", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1890" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 782, "start_aa": "Asn", "end_pos": 782, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn782", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 792, "start_aa": "Thr", "end_pos": 792, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr792", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 799, "start_aa": "Thr", "end_pos": 799, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr799", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 801, "start_aa": "Ser", "end_pos": 801, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser801", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 809, "start_aa": "Asn", "end_pos": 809, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn809", "evidence": [ { "id": "P13611", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 855, "start_aa": "Thr", "end_pos": 855, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr855", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 855, "start_aa": "Thr", "end_pos": 855, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr855", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 861, "start_aa": "Thr", "end_pos": 861, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr861", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Thr", "end_pos": 869, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr869", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 869, "start_aa": "Thr", "end_pos": 869, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr869", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 869, "start_aa": "Thr", "end_pos": 869, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr869", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 886, "start_aa": "Thr", "end_pos": 886, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr886", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 886, "start_aa": "Thr", "end_pos": 886, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr886", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 887, "start_aa": "Thr", "end_pos": 887, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr887", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 888, "start_aa": "Ser", "end_pos": 888, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser888", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 889, "start_aa": "Thr", "end_pos": 889, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr889", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 939, "start_aa": "Thr", "end_pos": 939, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr939", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 976, "start_aa": "Ser", "end_pos": 976, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser976", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 981, "start_aa": "Thr", "end_pos": 981, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr981", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 989, "start_aa": "Ser", "end_pos": 989, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser989", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 989, "start_aa": "Ser", "end_pos": 989, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser989", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57317CE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 989, "start_aa": "Ser", "end_pos": 989, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser989", "evidence": [ { "id": "P13611", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] } ], "phosphorylation": [ { "start_pos": 2086, "end_pos": 2086, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P13611", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13611" }, { "database": "PubMed", "id": "18491316", "url": "https://glygen.org/publication/PubMed/18491316" } ], "site_lbl": "Thr2086" }, { "start_pos": 2099, "end_pos": 2099, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P13611", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13611" }, { "database": "PubMed", "id": "18491316", "url": "https://glygen.org/publication/PubMed/18491316" } ], "site_lbl": "Ser2099" }, { "start_pos": 2112, "end_pos": 2112, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P13611", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13611" }, { "database": "PubMed", "id": "19824718", "url": "https://glygen.org/publication/PubMed/19824718" } ], "site_lbl": "Ser2112" }, { "start_pos": 2116, "end_pos": 2116, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by FAM20C", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" }, { "database": "iPTMnet", "id": "P13611", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13611" }, { "database": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" }, { "database": "PubMed", "id": "19824718", "url": "https://glygen.org/publication/PubMed/19824718" }, { "database": "PubMed", "id": "26091039", "url": "https://glygen.org/publication/PubMed/26091039" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ], "site_lbl": "Ser2116" }, { "start_pos": 2608, "end_pos": 2608, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "site_lbl": "Ser2608" }, { "start_pos": 2617, "end_pos": 2617, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "P13611", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13611" } ], "site_lbl": "Thr2617" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_predicted", "glycoprotein_reported" ], "publication": [ { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "P13611", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "Binding of the G domains of laminin alpha1 and alpha2 chains and perlecan to heparin, sulfatides, alpha-dystroglycan and several extracellular matrix proteins.", "journal": "The EMBO journal", "date": "1999", "authors": "Talts JF, Andac Z, Gohring W, Brancaccio A, Timpl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10022829", "url": "https://glygen.org/publication/PubMed/10022829" } ] }, { "title": "N-Linked glycosylation and sialylation of the acid-labile subunit. Role in complex formation with insulin-like growth factor (IGF)-binding protein-3 and the IGFs.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Janosi JB, Firth SM, Bond JJ, Baxter RC, Delhanty PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10026136", "url": "https://glygen.org/publication/PubMed/10026136" } ] }, { "title": "The insulin-like growth factor (IGF)-dependent IGF binding protein-4 protease secreted by human fibroblasts is pregnancy-associated plasma protein-A.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Lawrence JB, Oxvig C, Overgaard MT, Sottrup-Jensen L, Gleich GJ, Hays LG, Yates JR 3rd, Conover CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10077652", "url": "https://glygen.org/publication/PubMed/10077652" } ] }, { "title": "Molecular cloning and characterization of a human uronyl 2-sulfotransferase that sulfates iduronyl and glucuronyl residues in dermatan/chondroitin sulfate.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Kobayashi M, Sugumaran G, Liu J, Shworak NW, Silbert JE, Rosenberg RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022923", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022923" } ], "reference": [ { "type": "PubMed", "id": "10187838", "url": "https://glygen.org/publication/PubMed/10187838" } ] }, { "title": "The cleavage site specificity of human prostate specific antigen for insulin-like growth factor binding protein-3.", "journal": "FEBS letters", "date": "1999", "authors": "Okabe E, Kajihara J, Usami Y, Hirano K", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10218588", "url": "https://glygen.org/publication/PubMed/10218588" } ] }, { "title": "Agrin in Alzheimer's disease: altered solubility and abnormal distribution within microvasculature and brain parenchyma.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Donahue JE, Berzin TM, Rafii MS, Glass DJ, Yancopoulos GD, Fallon JR, Stopa EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10339611", "url": "https://glygen.org/publication/PubMed/10339611" } ] }, { "title": "Versican/PG-M isoforms in vascular smooth muscle cells.", "journal": "Arterioscler. Thromb. Vasc. Biol.", "date": "1999", "authors": "Lemire J M, Braun K R, Maurel P, Kaplan E D, Schwartz S M, Wight T N", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "reference": [ { "type": "PubMed", "id": "10397680", "url": "https://glygen.org/publication/PubMed/10397680" } ] }, { "title": "Cloning and expression of a proteoglycan UDP-galactose:beta-xylose beta1,4-galactosyltransferase I. A seventh member of the human beta4-galactosyltransferase gene family.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Almeida R, Levery SB, Mandel U, Kresse H, Schwientek T, Bennett EP, Clausen H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "10473568", "url": "https://glygen.org/publication/PubMed/10473568" } ] }, { "title": "Molecular basis for the progeroid variant of Ehlers-Danlos syndrome. Identification and characterization of two mutations in galactosyltransferase I gene.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Okajima T, Fukumoto S, Furukawa K, Urano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "10506123", "url": "https://glygen.org/publication/PubMed/10506123" } ] }, { "title": "Inflammation-related neutrophil proteases, cathepsin G and elastase, function as insulin-like growth factor binding protein proteases.", "journal": "Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society", "date": "1999", "authors": "Gibson TL, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10512690", "url": "https://glygen.org/publication/PubMed/10512690" } ] }, { "title": "A central domain binding site in insulin-like growth factor binding protein-5 for the acid-labile subunit.", "journal": "Endocrinology", "date": "2000", "authors": "Twigg SM, Kiefer MC, Zapf J, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10614670", "url": "https://glygen.org/publication/PubMed/10614670" } ] }, { "title": "Agrin binds to beta-amyloid (Abeta), accelerates abeta fibril formation, and is localized to Abeta deposits in Alzheimer's disease brain.", "journal": "Molecular and cellular neurosciences", "date": "2000", "authors": "Cotman SL, Halfter W, Cole GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "10673326", "url": "https://glygen.org/publication/PubMed/10673326" } ] }, { "title": "Insulin-like growth factor binding protein (IGFBP)-3-bound IGF-I and IGFBP-3-bound IGF-II in growth hormone deficiency.", "journal": "Hormone research", "date": "1999", "authors": "Belgorosky A, Rivarola MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10681634", "url": "https://glygen.org/publication/PubMed/10681634" } ] }, { "title": "Molecular cloning and expression of a novel chondroitin 6-O-sulfotransferase.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Kitagawa H, Fujita M, Ito N, Sugahara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022870" } ], "reference": [ { "type": "PubMed", "id": "10781596", "url": "https://glygen.org/publication/PubMed/10781596" } ] }, { "title": "Molecular cloning and expression of two distinct human chondroitin 4-O-sulfotransferases that belong to the HNK-1 sulfotransferase gene family.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Hiraoka N, Nakagawa H, Ong E, Akama TO, Fukuda MN, Fukuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022870" } ], "reference": [ { "type": "PubMed", "id": "10781601", "url": "https://glygen.org/publication/PubMed/10781601" } ] }, { "title": "Binding characteristics of pro-insulin-like growth factor-II from cancer patients: binary and ternary complex formation with IGF binding proteins-1 to -6.", "journal": "The Journal of endocrinology", "date": "2000", "authors": "Bond JJ, Meka S, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10810289", "url": "https://glygen.org/publication/PubMed/10810289" } ] }, { "title": "Structure/function of the human Ga1beta1,3-glucuronosyltransferase. Dimerization and functional activity are mediated by two crucial cysteine residues.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Ouzzine M, Gulberti S, Netter P, Magdalou J, Fournel-Gigleux S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "10842173", "url": "https://glygen.org/publication/PubMed/10842173" } ] }, { "title": "Evidence that the interaction between insulin-like growth factor (IGF)-II and IGF binding protein (IGFBP)-4 is essential for the action of the IGF-II-dependent IGFBP-4 protease.", "journal": "Archives of biochemistry and biophysics", "date": "2000", "authors": "Qin X, Byun D, Lau KH, Baylink DJ, Mohan S", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10898936", "url": "https://glygen.org/publication/PubMed/10898936" } ] }, { "title": "Effects of IGFBP-2 overexpression in vitro and in vivo.", "journal": "Pediatric nephrology (Berlin, Germany)", "date": "2000", "authors": "Wolf E, Lahm H, Wu M, Wanke R, Hoeflich A", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10912521", "url": "https://glygen.org/publication/PubMed/10912521" } ] }, { "title": "O-glycosylation of insulin-like growth factor (IGF) binding protein-6 maintains high IGF-II binding affinity by decreasing binding to glycosaminoglycans and susceptibility to proteolysis.", "journal": "European journal of biochemistry", "date": "2000", "authors": "Marinaro JA, Neumann GM, Russo VC, Leeding KS, Bach LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10951195", "url": "https://glygen.org/publication/PubMed/10951195" } ] }, { "title": "Biosynthesis of decorin and glypican.", "journal": "Matrix biology : journal of the International Society for Matrix Biology", "date": "2000", "authors": "Fransson LA, Belting M, Jonsson M, Mani K, Moses J, Oldberg A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022870" } ], "reference": [ { "type": "PubMed", "id": "10963998", "url": "https://glygen.org/publication/PubMed/10963998" } ] }, { "title": "Prostate carcinoma (PC-3) cell proliferation is stimulated by the 22-25-kDa proteolytic fragment (1-160) and inhibited by the 16-kDa fragment (1-95) of recombinant human insulin-like growth factor binding protein-3.", "journal": "Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society", "date": "1998", "authors": "Angelloz-Nicoud P, Lalou C, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "10990447", "url": "https://glygen.org/publication/PubMed/10990447" } ] }, { "title": "Molecular cloning, expression, and chromosomal mapping of human chondroitin 4-sulfotransferase, whose expression pattern in human tissues is different from that of chondroitin 6-sulfotransferase.", "journal": "Journal of biochemistry", "date": "2000", "authors": "Okuda T, Mita S, Yamauchi S, Matsubara T, Yagi F, Yamamori D, Fukuta M, Kuroiwa A, Matsuda Y, Habuchi O", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022870" } ], "reference": [ { "type": "PubMed", "id": "11056388", "url": "https://glygen.org/publication/PubMed/11056388" } ] }, { "title": "Mutations in cartilage oligomeric matrix protein causing pseudoachondroplasia and multiple epiphyseal dysplasia affect binding of calcium and collagen I, II, and IX.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Thur J, Rosenberg K, Nitsche DP, Pihlajamaa T, Ala-Kokko L, Heinegard D, Paulsson M, Maurer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "11084047", "url": "https://glygen.org/publication/PubMed/11084047" } ] }, { "title": "Molecular cloning and expression of human UDP-d-Xylose:proteoglycan core protein beta-d-xylosyltransferase and its first isoform XT-II.", "journal": "Journal of molecular biology", "date": "2000", "authors": "Gotting C, Kuhn J, Zahn R, Brinkmann T, Kleesiek K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "11099377", "url": "https://glygen.org/publication/PubMed/11099377" } ] }, { "title": "Molecular cloning and expression of an N-acetylgalactosamine-4-O-sulfotransferase that transfers sulfate to terminal and non-terminal beta 1,4-linked N-acetylgalactosamine.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Kang HG, Evers MR, Xia G, Baenziger JU, Schachner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022870" } ], "reference": [ { "type": "PubMed", "id": "11139592", "url": "https://glygen.org/publication/PubMed/11139592" } ] }, { "title": "Pregnancy-associated plasma protein-A accounts for the insulin-like growth factor (IGF)-binding protein-4 (IGFBP-4) proteolytic activity in human pregnancy serum and enhances the mitogenic activity of IGF by degrading IGFBP-4 in vitro.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2001", "authors": "Byun D, Mohan S, Yoo M, Sexton C, Baylink DJ, Qin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11158056", "url": "https://glygen.org/publication/PubMed/11158056" } ] }, { "title": "Ligand-binding characteristics of recombinant amino- and carboxyl-terminal fragments of human insulin-like growth factor-binding protein-3.", "journal": "The Journal of endocrinology", "date": "2001", "authors": "Galanis M, Firth SM, Bond J, Nathanielsz A, Kortt AA, Hudson PJ, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11250653", "url": "https://glygen.org/publication/PubMed/11250653" } ] }, { "title": "Biglycan and decorin bind close to the n-terminal region of the collagen VI triple helix.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Wiberg C, Hedbom E, Khairullina A, Lamande SR, Oldberg A, Timpl R, Morgelin M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "11259413", "url": "https://glygen.org/publication/PubMed/11259413" } ] }, { "title": "Pregnancy-associated plasma protein-A2 (PAPP-A2), a novel insulin-like growth factor-binding protein-5 proteinase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Overgaard MT, Boldt HB, Laursen LS, Sottrup-Jensen L, Conover CA, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11264294", "url": "https://glygen.org/publication/PubMed/11264294" } ] }, { "title": "Mutagenesis of basic amino acids in the carboxyl-terminal region of insulin-like growth factor binding protein-5 affects acid-labile subunit binding.", "journal": "Endocrinology", "date": "2001", "authors": "Firth SM, Clemmons DR, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11316783", "url": "https://glygen.org/publication/PubMed/11316783" } ] }, { "title": "The glucuronyl C5-epimerase activity is the limiting factor in the dermatan sulfate biosynthesis.", "journal": "Archives of biochemistry and biophysics", "date": "2001", "authors": "Tiedemann K, Larsson T, Heinegard D, Malmstrom A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022923", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022923" } ], "reference": [ { "type": "PubMed", "id": "11414686", "url": "https://glygen.org/publication/PubMed/11414686" } ] }, { "title": "Molecular cloning and characterization of a dermatan-specific N-acetylgalactosamine 4-O-sulfotransferase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Evers MR, Xia G, Kang HG, Schachner M, Baenziger JU", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022923", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022923" } ], "reference": [ { "type": "PubMed", "id": "11470797", "url": "https://glygen.org/publication/PubMed/11470797" } ] }, { "title": "Molecular cloning and expression of a human chondroitin synthase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Kitagawa H, Uyama T, Sugahara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022870" } ], "reference": [ { "type": "PubMed", "id": "11514575", "url": "https://glygen.org/publication/PubMed/11514575" } ] }, { "title": "Pregnancy-associated plasma protein-A (PAPP-A) cleaves insulin-like growth factor binding protein (IGFBP)-5 independent of IGF: implications for the mechanism of IGFBP-4 proteolysis by PAPP-A.", "journal": "FEBS letters", "date": "2001", "authors": "Laursen LS, Overgaard MT, Soe R, Boldt HB, Sottrup-Jensen L, Giudice LC, Conover CA, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11522292", "url": "https://glygen.org/publication/PubMed/11522292" } ] }, { "title": "Biosynthesis of the linkage region of glycosaminoglycans: cloning and activity of galactosyltransferase II, the sixth member of the beta 1,3-galactosyltransferase family (beta 3GalT6).", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Bai X, Zhou D, Brown JR, Crawford BE, Hennet T, Esko JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "11551958", "url": "https://glygen.org/publication/PubMed/11551958" } ] }, { "title": "Insulin-like growth factor-binding protein-5 inhibits growth and induces differentiation of mouse osteosarcoma cells.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Schneider MR, Zhou R, Hoeflich A, Krebs O, Schmidt J, Mohan S, Wolf E, Lahm H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11606061", "url": "https://glygen.org/publication/PubMed/11606061" } ] }, { "title": "IGFBP-3 binding to endothelial cells inhibits plasmin and thrombin proteolysis.", "journal": "American journal of physiology. Endocrinology and metabolism", "date": "2002", "authors": "Booth BA, Boes M, Dake BL, Knudtson KL, Bar RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11739083", "url": "https://glygen.org/publication/PubMed/11739083" } ] }, { "title": "Insulin-like growth factor-binding protein 2 in tumorigenesis: protector or promoter?", "journal": "Cancer research", "date": "2001", "authors": "Hoeflich A, Reisinger R, Lahm H, Kiess W, Blum WF, Kolb HJ, Weber MM, Wolf E", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11751371", "url": "https://glygen.org/publication/PubMed/11751371" } ] }, { "title": "Molecular cloning and expression of human chondroitin N-acetylgalactosaminyltransferase: the key enzyme for chain initiation and elongation of chondroitin/dermatan sulfate on the protein linkage region tetrasaccharide shared by heparin/heparan sulfate.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Uyama T, Kitagawa H, Tamura Ji J, Sugahara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022870" } ], "reference": [ { "type": "PubMed", "id": "11788602", "url": "https://glygen.org/publication/PubMed/11788602" } ] }, { "title": "Molecular distribution of IGF binding protein-5 in human serum.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2002", "authors": "Baxter RC, Meka S, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "11788658", "url": "https://glygen.org/publication/PubMed/11788658" } ] }, { "title": "Molecular cloning and characterization of chondroitin-4-O-sulfotransferase-3. A novel member of the HNK-1 family of sulfotransferases.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Kang HG, Evers MR, Xia G, Baenziger JU, Schachner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022870" } ], "reference": [ { "type": "PubMed", "id": "12080076", "url": "https://glygen.org/publication/PubMed/12080076" } ] }, { "title": "Molecular cloning and characterization of a novel chondroitin sulfate glucuronyltransferase that transfers glucuronic acid to N-acetylgalactosamine.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Gotoh M, Yada T, Sato T, Akashima T, Iwasaki H, Mochizuki H, Inaba N, Togayachi A, Kudo T, Watanabe H, Kimata K, Narimatsu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022870" } ], "reference": [ { "type": "PubMed", "id": "12145278", "url": "https://glygen.org/publication/PubMed/12145278" } ] }, { "title": "Enzymatic synthesis of chondroitin with a novel chondroitin sulfate N-acetylgalactosaminyltransferase that transfers N-acetylgalactosamine to glucuronic acid in initiation and elongation of chondroitin sulfate synthesis.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Gotoh M, Sato T, Akashima T, Iwasaki H, Kameyama A, Mochizuki H, Yada T, Inaba N, Zhang Y, Kikuchi N, Kwon YD, Togayachi A, Kudo T, Nishihara S, Watanabe H, Kimata K, Narimatsu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022870" } ], "reference": [ { "type": "PubMed", "id": "12163485", "url": "https://glygen.org/publication/PubMed/12163485" } ] }, { "title": "Matrix-matrix interaction of cartilage oligomeric matrix protein and fibronectin.", "journal": "Matrix biology : journal of the International Society for Matrix Biology", "date": "2002", "authors": "Di Cesare PE, Chen FS, Moergelin M, Carlson CS, Leslie MP, Perris R, Fang C", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "12225811", "url": "https://glygen.org/publication/PubMed/12225811" } ] }, { "title": "Substrate specificity of the metalloproteinase pregnancy-associated plasma protein-A (PAPP-A) assessed by mutagenesis and analysis of synthetic peptides: substrate residues distant from the scissile bond are critical for proteolysis.", "journal": "The Biochemical journal", "date": "2002", "authors": "Laursen LS, Overgaard MT, Nielsen CG, Boldt HB, Hopmann KH, Conover CA, Sottrup-Jensen L, Giudice LC, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12241545", "url": "https://glygen.org/publication/PubMed/12241545" } ] }, { "title": "IGF-binding proteins are multifunctional and act via IGF-dependent and -independent mechanisms.", "journal": "The Journal of endocrinology", "date": "2002", "authors": "Mohan S, Baylink DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12379487", "url": "https://glygen.org/publication/PubMed/12379487" } ] }, { "title": "Cellular actions of the insulin-like growth factor binding proteins.", "journal": "Endocrine reviews", "date": "2002", "authors": "Firth SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12466191", "url": "https://glygen.org/publication/PubMed/12466191" } ] }, { "title": "Biosynthesis of chondroitin/dermatan sulfate.", "journal": "IUBMB life", "date": "2002", "authors": "Silbert JE, Sugumaran G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022923", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022923" } ], "reference": [ { "type": "PubMed", "id": "12512856", "url": "https://glygen.org/publication/PubMed/12512856" } ] }, { "title": "Cloning, characterization, and chromosome mapping of the human GlcAT-S gene.", "journal": "Journal of human genetics", "date": "2002", "authors": "Marcos I, Galan JJ, Borrego S, Antinolo G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "12522689", "url": "https://glygen.org/publication/PubMed/12522689" } ] }, { "title": "A novel CpG-associated brain-expressed candidate gene for chromosome 18q-linked bipolar disorder.", "journal": "Molecular psychiatry", "date": "2003", "authors": "Goossens D, Van Gestel S, Claes S, De Rijk P, Souery D, Massat I, Van den Bossche D, Backhovens H, Mendlewicz J, Van Broeckhoven C, Del-Favero J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022923", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022923" } ], "reference": [ { "type": "PubMed", "id": "12556911", "url": "https://glygen.org/publication/PubMed/12556911" } ] }, { "title": "Chondroitin sulfate synthase-2. Molecular cloning and characterization of a novel human glycosyltransferase homologous to chondroitin sulfate glucuronyltransferase, which has dual enzymatic activities.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Yada T, Gotoh M, Sato T, Shionyu M, Go M, Kaseyama H, Iwasaki H, Kikuchi N, Kwon YD, Togayachi A, Kudo T, Watanabe H, Narimatsu H, Kimata K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022870" } ], "reference": [ { "type": "PubMed", "id": "12761225", "url": "https://glygen.org/publication/PubMed/12761225" } ] }, { "title": "Amino- and carboxyl-terminal fragments of insulin-like growth factor (IGF) binding protein-3 cooperate to bind IGFs with high affinity and inhibit IGF receptor interactions.", "journal": "Endocrinology", "date": "2003", "authors": "Payet LD, Wang XH, Baxter RC, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12810533", "url": "https://glygen.org/publication/PubMed/12810533" } ] }, { "title": "A unique nonreducing terminal modification of chondroitin sulfate by N-acetylgalactosamine 4-sulfate 6-o-sulfotransferase.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Ohtake S, Kimata K, Habuchi O", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022870" } ], "reference": [ { "type": "PubMed", "id": "12874280", "url": "https://glygen.org/publication/PubMed/12874280" } ] }, { "title": "Crystal structure of a covalent intermediate of endogenous human arylsulfatase A.", "journal": "Journal of inorganic biochemistry", "date": "2003", "authors": "Chruszcz M, Laidler P, Monkiewicz M, Ortlund E, Lebioda L, Lewinski K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024101", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024101" } ], "reference": [ { "type": "PubMed", "id": "12888274", "url": "https://glygen.org/publication/PubMed/12888274" } ] }, { "title": "IGF-binding protein-4: biochemical characteristics and functional consequences.", "journal": "The Journal of endocrinology", "date": "2003", "authors": "Zhou R, Diehl D, Hoeflich A, Lahm H, Wolf E", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "12904166", "url": "https://glygen.org/publication/PubMed/12904166" } ] }, { "title": "Chondroitin sulfate synthase-3. Molecular cloning and characterization.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Yada T, Sato T, Kaseyama H, Gotoh M, Iwasaki H, Kikuchi N, Kwon YD, Togayachi A, Kudo T, Watanabe H, Narimatsu H, Kimata K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022870" } ], "reference": [ { "type": "PubMed", "id": "12907687", "url": "https://glygen.org/publication/PubMed/12907687" } ] }, { "title": "Structural determinants for binary and ternary complex formation between insulin-like growth factor-I (IGF-I) and IGF binding protein-3.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Baxter RC, Bayne ML, Cascieri MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "1370451", "url": "https://glygen.org/publication/PubMed/1370451" } ] }, { "title": "Mapping of binding sites for heparin, plasminogen activator inhibitor-1, and plasminogen to vitronectin's heparin-binding region reveals a novel vitronectin-dependent feedback mechanism for the control of plasmin formation.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Kost C, Stuber W, Ehrlich HJ, Pannekoek H, Preissner KT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "1376317", "url": "https://glygen.org/publication/PubMed/1376317" } ] }, { "title": "Prostate-specific antigen (PSA) is an insulin-like growth factor binding protein-3 protease found in seminal plasma.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1992", "authors": "Cohen P, Graves HC, Peehl DM, Kamarei M, Giudice LC, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "1383255", "url": "https://glygen.org/publication/PubMed/1383255" } ] }, { "title": "Isolation of a large aggregating proteoglycan from human brain.", "journal": "J. Biol. Chem.", "date": "1992", "authors": "Perides G, Rahemtulla F, Lane WS, Asher RA, Bignami A", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "reference": [ { "type": "PubMed", "id": "1429726", "url": "https://glygen.org/publication/PubMed/1429726" } ] }, { "title": "Neurite outgrowth by the alternatively spliced region of human tenascin-C is mediated by neuronal alpha7beta1 integrin.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2004", "authors": "Mercado ML, Nur-e-Kamal A, Liu HY, Gross SR, Movahed R, Meiners S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "14715956", "url": "https://glygen.org/publication/PubMed/14715956" } ] }, { "title": "Mapping of the versican proteoglycan gene (CSPG2) to the long arm of human chromosome 5 (5q12-5q14).", "journal": "Genomics", "date": "1992", "authors": "Iozzo R V, Naso M F, Cannizzaro L A, Wasmuth J J, McPherson J D", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "reference": [ { "type": "PubMed", "id": "1478664", "url": "https://glygen.org/publication/PubMed/1478664" } ] }, { "title": "Structural basis for acceptor substrate recognition of a human glucuronyltransferase, GlcAT-P, an enzyme critical in the biosynthesis of the carbohydrate epitope HNK-1.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kakuda S, Shiba T, Ishiguro M, Tagawa H, Oka S, Kajihara Y, Kawasaki T, Wakatsuki S, Kato R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "14993226", "url": "https://glygen.org/publication/PubMed/14993226" } ] }, { "title": "Interactions between the cartilage oligomeric matrix protein and matrilins. Implications for matrix assembly and the pathogenesis of chondrodysplasias.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Mann HH, Ozbek S, Engel J, Paulsson M, Wagener R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "15075323", "url": "https://glygen.org/publication/PubMed/15075323" } ] }, { "title": "The role of the acid-labile subunit in regulating insulin-like growth factor transport across human umbilical vein endothelial cell monolayers.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2004", "authors": "Payet LD, Firth SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15126567", "url": "https://glygen.org/publication/PubMed/15126567" } ] }, { "title": "A novel missense mutation in the galactosyltransferase-I (B4GALT7) gene in a family exhibiting facioskeletal anomalies and Ehlers-Danlos syndrome resembling the progeroid type.", "journal": "American journal of medical genetics. Part A", "date": "2004", "authors": "Faiyaz-Ul-Haque M, Zaidi SH, Al-Ali M, Al-Mureikhi MS, Kennedy S, Al-Thani G, Tsui LC, Teebi AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3560783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3560783" } ], "reference": [ { "type": "PubMed", "id": "15211654", "url": "https://glygen.org/publication/PubMed/15211654" } ] }, { "title": "Loss of chondroitin 6-O-sulfotransferase-1 function results in severe human chondrodysplasia with progressive spinal involvement.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Thiele H, Sakano M, Kitagawa H, Sugahara K, Rajab A, Hohne W, Ritter H, Leschik G, Nurnberg P, Mundlos S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3595172", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3595172" } ], "reference": [ { "type": "PubMed", "id": "15215498", "url": "https://glygen.org/publication/PubMed/15215498" } ] }, { "title": "Analysis of the DXD motifs in human xylosyltransferase I required for enzyme activity.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Gotting C, Muller S, Schottler M, Schon S, Prante C, Brinkmann T, Kuhn J, Kleesiek K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "15294915", "url": "https://glygen.org/publication/PubMed/15294915" } ] }, { "title": "Structural basis for interactions between tenascins and lectican C-type lectin domains: evidence for a crosslinking role for tenascins.", "journal": "Structure (London, England : 1993)", "date": "2004", "authors": "Lundell A, Olin AI, Morgelin M, al-Karadaghi S, Aspberg A, Logan DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "15296743", "url": "https://glygen.org/publication/PubMed/15296743" } ] }, { "title": "C-terminal domain of insulin-like growth factor (IGF) binding protein-6: structure and interaction with IGF-II.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2004", "authors": "Headey SJ, Keizer DW, Yao S, Brasier G, Kantharidis P, Bach LA, Norton RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15308688", "url": "https://glygen.org/publication/PubMed/15308688" } ] }, { "title": "Binding of the proteoglycan decorin to collagen type VI.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Bidanset DJ, Guidry C, Rosenberg LC, Choi HU, Timpl R, Hook M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "1544908", "url": "https://glygen.org/publication/PubMed/1544908" } ] }, { "title": "Human xylosyltransferase I: functional and biochemical characterization of cysteine residues required for enzymic activity.", "journal": "The Biochemical journal", "date": "2005", "authors": "Muller S, Schottler M, Schon S, Prante C, Brinkmann T, Kuhn J, Gotting C, Kleesiek K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "15461586", "url": "https://glygen.org/publication/PubMed/15461586" } ] }, { "title": "Characterization of insulin-like growth factor-free interaction between insulin-like growth factor binding protein 3 and acid labile subunit expressed from Xenopus oocytes.", "journal": "Journal of biochemistry and molecular biology", "date": "2004", "authors": "Choi KY, Kyung YJ, Lee CY, Lee DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15469690", "url": "https://glygen.org/publication/PubMed/15469690" } ] }, { "title": "Role of N- and C-terminal residues of insulin-like growth factor (IGF)-binding protein-3 in regulating IGF complex formation and receptor activation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Yan X, Forbes BE, McNeil KA, Baxter RC, Firth SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15485880", "url": "https://glygen.org/publication/PubMed/15485880" } ] }, { "title": "Contributions of the N- and C-terminal domains of IGF binding protein-6 to IGF binding.", "journal": "Journal of molecular endocrinology", "date": "2004", "authors": "Headey SJ, Leeding KS, Norton RS, Bach LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15525596", "url": "https://glygen.org/publication/PubMed/15525596" } ] }, { "title": "Structural basis for the regulation of insulin-like growth factors by IGF binding proteins.", "journal": "Structure (London, England : 1993)", "date": "2005", "authors": "Siwanowicz I, Popowicz GM, Wisniewska M, Huber R, Kuenkele KP, Lang K, Engh RA, Holak TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "15642270", "url": "https://glygen.org/publication/PubMed/15642270" } ] }, { "title": "Lysosomal metabolism of glycoproteins.", "journal": "Glycobiology", "date": "2005", "authors": "Winchester B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024101", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024101" } ], "reference": [ { "type": "PubMed", "id": "15647514", "url": "https://glygen.org/publication/PubMed/15647514" } ] }, { "title": "Identification of a novel splice site mutation of the CSPG2 gene in a Japanese family with Wagner syndrome.", "journal": "Invest. Ophthalmol. Vis. Sci.", "date": "2005", "authors": "Miyamoto Tatsuro, Inoue Hiroshi, Sakamoto Yukiko, Kudo Eiji, Naito Takeshi, Mikawa Takako, Mikawa Yoichi, Isashiki Yasushi, Osabe Dai, Shinohara Shuichi, Shiota Hiroshi, Itakura Mitsuo", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "reference": [ { "type": "PubMed", "id": "16043844", "url": "https://glygen.org/publication/PubMed/16043844" } ] }, { "title": "Interactions between collagen IX and biglycan measured by atomic force microscopy.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Chen CH, Yeh ML, Geyer M, Wang GJ, Huang MH, Heggeness MH, Hook M, Luo ZP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "16293224", "url": "https://glygen.org/publication/PubMed/16293224" } ] }, { "title": "Involvement of tenascin-C and PG-M/versican in flexor tenosynovial pathology of idiopathic carpal tunnel syndrome.", "journal": "Histology and histopathology", "date": "2006", "authors": "Tsujii M, Hirata H, Yoshida T, Imanaka-Yoshida K, Morita A, Uchida A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "16493581", "url": "https://glygen.org/publication/PubMed/16493581" } ] }, { "title": "Biosynthesis of dermatan sulfate: chondroitin-glucuronate C5-epimerase is identical to SART2.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Maccarana M, Olander B, Malmstrom J, Tiedemann K, Aebersold R, Lindahl U, Li JP, Malmstrom A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022923", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022923" } ], "reference": [ { "type": "PubMed", "id": "16505484", "url": "https://glygen.org/publication/PubMed/16505484" } ] }, { "title": "The role of insulin-like growth factor binding proteins.", "journal": "Neuroendocrinology", "date": "2006", "authors": "Holly J, Perks C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17047378", "url": "https://glygen.org/publication/PubMed/17047378" } ] }, { "title": "XT-II, the second isoform of human peptide-O-xylosyltransferase, displays enzymatic activity.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Voglmeir J, Voglauer R, Wilson IB", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "17194707", "url": "https://glygen.org/publication/PubMed/17194707" } ] }, { "title": "Quantitative analysis of insulin-like growth factor-modulated proteolysis of insulin-like growth factor binding protein-4 and -5 by pregnancy-associated plasma protein-A.", "journal": "Biochemistry", "date": "2007", "authors": "Gyrup C, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17249697", "url": "https://glygen.org/publication/PubMed/17249697" } ] }, { "title": "Regulation of insulin-like growth factor (IGF) bioactivity by sequential proteolytic cleavage of IGF binding protein-4 and -5.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2007", "authors": "Laursen LS, Kjaer-Sorensen K, Andersen MH, Oxvig C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17312271", "url": "https://glygen.org/publication/PubMed/17312271" } ] }, { "title": "Interaction of cartilage oligomeric matrix protein/thrombospondin 5 with aggrecan.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Chen FH, Herndon ME, Patel N, Hecht JT, Tuan RS, Lawler J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "17588949", "url": "https://glygen.org/publication/PubMed/17588949" } ] }, { "title": "Cooperativity of the N- and C-terminal domains of insulin-like growth factor (IGF) binding protein 2 in IGF binding.", "journal": "Biochemistry", "date": "2007", "authors": "Kuang Z, Yao S, McNeil KA, Thompson JA, Bach LA, Forbes BE, Wallace JC, Norton RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "17985932", "url": "https://glygen.org/publication/PubMed/17985932" } ] }, { "title": "Identification of chondroitin sulfate glucuronyltransferase as chondroitin synthase-3 involved in chondroitin polymerization: chondroitin polymerization is achieved by multiple enzyme complexes consisting of chondroitin synthase family members.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Izumikawa T, Koike T, Shiozawa S, Sugahara K, Tamura J, Kitagawa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022870" } ], "reference": [ { "type": "PubMed", "id": "18316376", "url": "https://glygen.org/publication/PubMed/18316376" } ] }, { "title": "Phosphoproteome analysis of the human Chang liver cells using SCX and a complementary mass spectrometric strategy.", "journal": "Proteomics", "date": "2008", "authors": "Sui S, Wang J, Yang B, Song L, Zhang J, Chen M, Liu J, Lu Z, Cai Y, Chen S, Bi W, Zhu Y, He F, Qian X", "evidence": [ { "database": "iPTMnet", "id": "P13611-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13611-1" } ], "reference": [ { "type": "PubMed", "id": "18491316", "url": "https://glygen.org/publication/PubMed/18491316" } ] }, { "title": "Congenital joint dislocations caused by carbohydrate sulfotransferase 3 deficiency in recessive Larsen syndrome and humero-spinal dysostosis.", "journal": "American journal of human genetics", "date": "2008", "authors": "Hermanns P, Unger S, Rossi A, Perez-Aytes A, Cortina H, Bonafe L, Boccone L, Setzu V, Dutoit M, Sangiorgi L, Pecora F, Reicherter K, Nishimura G, Spranger J, Zabel B, Superti-Furga A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3595172", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3595172" } ], "reference": [ { "type": "PubMed", "id": "18513679", "url": "https://glygen.org/publication/PubMed/18513679" } ] }, { "title": "Spondyloepiphyseal dysplasia, Omani type: further definition of the phenotype.", "journal": "American journal of medical genetics. Part A", "date": "2008", "authors": "van Roij MH, Mizumoto S, Yamada S, Morgan T, Tan-Sindhunata MB, Meijers-Heijboer H, Verbeke JI, Markie D, Sugahara K, Robertson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3595172", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3595172" } ], "reference": [ { "type": "PubMed", "id": "18698629", "url": "https://glygen.org/publication/PubMed/18698629" } ] }, { "title": "Two dermatan sulfate epimerases form iduronic acid domains in dermatan sulfate.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Pacheco B, Malmstrom A, Maccarana M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022923", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022923" } ], "reference": [ { "type": "PubMed", "id": "19188366", "url": "https://glygen.org/publication/PubMed/19188366" } ] }, { "title": "Human alpha-L-iduronidase: cDNA isolation and expression.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Scott HS, Anson DS, Orsborn AM, Nelson PV, Clements PR, Morris CP, Hopwood JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024101", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024101" } ], "reference": [ { "type": "PubMed", "id": "1946389", "url": "https://glygen.org/publication/PubMed/1946389" } ] }, { "title": "Genetic variants A1826H and D2937Y in GAG-beta domain of versican influence susceptibility to intestinal-type gastric cancer.", "journal": "Journal of cancer research and clinical oncology", "date": "2010", "authors": "Ju H, Lim B, Kim M, Noh SM, Han DS, Yu HJ, Choi BY, Kim YS, Kim WH, Ihm C, Kang C", "evidence": [ { "database": "Entrez", "id": "1462", "url": "https://www.ncbi.nlm.nih.gov/gene/1462" } ], "reference": [ { "type": "PubMed", "id": "19655167", "url": "https://glygen.org/publication/PubMed/19655167" } ] }, { "title": "Dermatan 4-O-sulfotransferase 1 is pivotal in the formation of iduronic acid blocks in dermatan sulfate.", "journal": "Glycobiology", "date": "2009", "authors": "Pacheco B, Maccarana M, Malmstrom A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022923", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022923" } ], "reference": [ { "type": "PubMed", "id": "19661164", "url": "https://glygen.org/publication/PubMed/19661164" } ] }, { "title": "Phosphoproteomic analysis of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Brill LM, Xiong W, Lee KB, Ficarro SB, Crain A, Xu Y, Terskikh A, Snyder EY, Ding S", "evidence": [ { "database": "iPTMnet", "id": "P13611-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13611-1" } ], "reference": [ { "type": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" } ] }, { "title": "An initial characterization of the serum phosphoproteome.", "journal": "Journal of proteome research", "date": "2009", "authors": "Zhou W, Ross MM, Tessitore A, Ornstein D, Vanmeter A, Liotta LA, Petricoin EF 3rd", "evidence": [ { "database": "iPTMnet", "id": "P13611-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13611-1" } ], "reference": [ { "type": "PubMed", "id": "19824718", "url": "https://glygen.org/publication/PubMed/19824718" } ] }, { "title": "Loss of dermatan-4-sulfotransferase 1 function results in adducted thumb-clubfoot syndrome.", "journal": "American journal of human genetics", "date": "2009", "authors": "Dundar M, Muller T, Zhang Q, Pan J, Steinmann B, Vodopiutz J, Gruber R, Sonoda T, Krabichler B, Utermann G, Baenziger JU, Zhang L, Janecke AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3595174", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3595174" } ], "reference": [ { "type": "PubMed", "id": "20004762", "url": "https://glygen.org/publication/PubMed/20004762" } ] }, { "title": "A comprehensive catalogue of somatic mutations from a human cancer genome.", "journal": "Nature", "date": "2010", "authors": "Pleasance ED, Cheetham RK, Stephens PJ, McBride DJ, Humphray SJ, Greenman CD, Varela I, Lin ML, Ordonez GR, Bignell GR, Ye K, Alipaz J, Bauer MJ, Beare D, Butler A, Carter RJ, Chen L, Cox AJ, Edkins S, Kokko-Gonzales PI, Gormley NA, Grocock RJ, Haudenschild CD, Hims MM, James T, Jia M, Kingsbury Z, Leroy C, Marshall J, Menzies A, Mudie LJ, Ning Z, Royce T, Schulz-Trieglaff OB, Spiridou A, Stebbings LA, Szajkowski L, Teague J, Williamson D, Chin L, Ross MT, Campbell PJ, Bentley DR, Futreal PA, Stratton MR", "evidence": [ { "database": "dbSNP", "id": "rs267600718", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs267600718" } ], "reference": [ { "type": "PubMed", "id": "20016485", "url": "https://glygen.org/publication/PubMed/20016485" } ] }, { "title": "Loss-of-function mutations of CHST14 in a new type of Ehlers-Danlos syndrome.", "journal": "Human mutation", "date": "2010", "authors": "Miyake N, Kosho T, Mizumoto S, Furuichi T, Hatamochi A, Nagashima Y, Arai E, Takahashi K, Kawamura R, Wakui K, Takahashi J, Kato H, Yasui H, Ishida T, Ohashi H, Nishimura G, Shiina M, Saitsu H, Tsurusaki Y, Doi H, Fukushima Y, Ikegawa S, Yamada S, Sugahara K, Matsumoto N", "evidence": [ { "database": "Reactome", "id": "R-HSA-3595174", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3595174" } ], "reference": [ { "type": "PubMed", "id": "20533528", "url": "https://glygen.org/publication/PubMed/20533528" } ] }, { "title": "Decorin interacts with fibrillar collagen of embryonic and adult human skin.", "journal": "Journal of structural biology", "date": "1991", "authors": "Fleischmajer R, Fisher LW, MacDonald ED, Jacobs L Jr, Perlish JS, Termine JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2059554", "url": "https://glygen.org/publication/PubMed/2059554" } ] }, { "title": "Molecular characterization of beta1,4-galactosyltransferase 7 genetic mutations linked to the progeroid form of Ehlers-Danlos syndrome (EDS).", "journal": "FEBS letters", "date": "2010", "authors": "Bui C, Talhaoui I, Chabel M, Mulliert G, Coughtrie MW, Ouzzine M, Fournel-Gigleux S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3560783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3560783" } ], "reference": [ { "type": "PubMed", "id": "20691685", "url": "https://glygen.org/publication/PubMed/20691685" } ] }, { "title": "Phenotypic features of carbohydrate sulfotransferase 3 (CHST3) deficiency in 24 patients: congenital dislocations and vertebral changes as principal diagnostic features.", "journal": "American journal of medical genetics. Part A", "date": "2010", "authors": "Unger S, Lausch E, Rossi A, Megarbane A, Sillence D, Alcausin M, Aytes A, Mendoza-Londono R, Nampoothiri S, Afroze B, Hall B, Lo IF, Lam ST, Hoefele J, Rost I, Wakeling E, Mangold E, Godbole K, Vatanavicharn N, Franco LM, Chandler K, Hollander S, Velten T, Reicherter K, Spranger J, Robertson S, Bonafe L, Zabel B, Superti-Furga A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3595172", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3595172" } ], "reference": [ { "type": "PubMed", "id": "20830804", "url": "https://glygen.org/publication/PubMed/20830804" } ] }, { "title": "Loss of CHSY1, a secreted FRINGE enzyme, causes syndromic brachydactyly in humans via increased NOTCH signaling.", "journal": "American journal of human genetics", "date": "2010", "authors": "Tian J, Ling L, Shboul M, Lee H, O'Connor B, Merriman B, Nelson SF, Cool S, Ababneh OH, Al-Hadidy A, Masri A, Hamamy H, Reversade B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022870" } ], "reference": [ { "type": "PubMed", "id": "21129727", "url": "https://glygen.org/publication/PubMed/21129727" } ] }, { "title": "Temtamy preaxial brachydactyly syndrome is caused by loss-of-function mutations in chondroitin synthase 1, a potential target of BMP signaling.", "journal": "American journal of human genetics", "date": "2010", "authors": "Li Y, Laue K, Temtamy S, Aglan M, Kotan LD, Yigit G, Canan H, Pawlik B, Nurnberg G, Wakeling EL, Quarrell OW, Baessmann I, Lanktree MB, Yilmaz M, Hegele RA, Amr K, May KW, Nurnberg P, Topaloglu AK, Hammerschmidt M, Wollnik B", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022870" } ], "reference": [ { "type": "PubMed", "id": "21129728", "url": "https://glygen.org/publication/PubMed/21129728" } ] }, { "title": "Hunter syndrome: isolation of an iduronate-2-sulfatase cDNA clone and analysis of patient DNA.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990", "authors": "Wilson PJ, Morris CP, Anson DS, Occhiodoro T, Bielicki J, Clements PR, Hopwood JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024101", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024101" } ], "reference": [ { "type": "PubMed", "id": "2122463", "url": "https://glygen.org/publication/PubMed/2122463" } ] }, { "title": "Dentin matrix protein 1 (DMP1) signals via cell surface integrin.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Wu H, Teng PN, Jayaraman T, Onishi S, Li J, Bannon L, Huang H, Close J, Sfeir C", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "21642437", "url": "https://glygen.org/publication/PubMed/21642437" } ] }, { "title": "Integrated genomic analyses of ovarian carcinoma.", "journal": "Nature", "date": "2011", "authors": "Bell D, Berchuck A, Birrer M, Chien J, Cramer D, Dao F, Dhir R, DiSaia P, Gabra H, Glenn P, Godwin A, Gross J, Hartmann L, Huang M, Huntsman D, Iacocca M, Imielinski M, Kalloger S, Karlan B, Levine D, Mills G, Morrison C, Mutch D, Olvera N, Orsulic S, Park K, Petrelli N, Rabeno B, Rader J, Sikic B, Smith-McCune K, Sood A, Bowtell D, Penny R, Testa J, Chang K, Dinh H, Drummond J, Fowler G, Gunaratne P, Hawes A, Kovar C, Lewis L, Morgan M, Newsham I, Santibanez J, Reid J, Trevino L, Wu Y-, Wang M, Muzny D, Wheeler D, Gibbs R, Getz G, Lawrence M, Cibulskis K, Sivachenko A, Sougnez C, Voet D, Wilkinson J, Bloom T, Ardlie K, Fennell T, Baldwin J, Gabriel S, Lander E, Ding LL, Fulton R, Koboldt D, McLellan M, Wylie T, Walker J, O'Laughlin M, Dooling D, Fulton L, Abbott R, Dees N, Zhang Q, Kandoth C, Wendl M, Schierding W, Shen D, Harris C, Schmidt H, Kalicki J, Delehaunty K, Fronick C, Demeter R, Cook L, Wallis J, Lin L, Magrini V, Hodges J, Eldred J, Smith S, Pohl C, Vandin F, Raphael B, Weinstock G, Mardis E, Wilson R, Meyerson M, Winckler W, Getz G, Verhaak R, Carter S, Mermel C, Saksena G, Nguyen H, Onofrio R, Lawrence M, Hubbard D, Gupta S, Crenshaw A, Ramos A, Ardlie K, Chin L, Protopopov A, Zhang J, Kim T, Perna I, Xiao Y, Zhang H, Ren G, Sathiamoorthy N, Park R, Lee E, Park P, Kucherlapati R, Absher M, Waite L, Sherlock G, Brooks J, Li J, Xu J, Myers R, Laird PW, Cope L, Herman J, Shen H, Weisenberger D, Noushmehr H, Pan F, Triche T Jr, Berman B, Van Den Berg D, Buckley J, Baylin S, Spellman P, Purdom E, Neuvial P, Bengtsson H, Jakkula L, Durinck S, Han J, Dorton S, Marr H, Choi Y, Wang V, Wang N, Ngai J, Conboy J, Parvin B, Feiler H, Speed T, Gray J, Levine A, Socci N, Liang Y, Taylor B, Schultz N, Borsu L, Lash A, Brennan C, Viale A, Sander C, Ladanyi M, Hoadley K, Meng S, Du Y, Shi Y, Li L, Turman Y, Zang D, Helms E, Balu S, Zhou X, Wu J, Topal M, Hayes D, Perou C, Getz G, Voet D, Saksena G, Zhang J, Zhang H, Wu C, Shukla S, Cibulskis K, Lawrence M, Sivachenko A, Jing R, Park R, Liu Y, Park P, Noble M, Chin L, Carter H, Kim D, Karchin R, Spellman P, Purdom E, Neuvial P, Bengtsson H, Durinck S, Han J, Korkola J, Heiser L, Cho R, Hu Z, Parvin B, Speed T, Gray J, Schultz N, Cerami E, Taylor B, Olshen A, Reva B, Antipin Y, Shen R, Mankoo P, Sheridan R, Ciriello G, Chang W, Bernanke J, Borsu L, Levine D, Ladanyi M, Sander C, Haussler D, Benz C, Stuart J, Benz S, Sanborn J, Vaske C, Zhu J, Szeto C, Scott G, Yau C, Hoadley K, Du Y, Balu S, Hayes D, Perou C, Wilkerson M, Zhang N, Akbani R, Baggerly K, Yung W, Mills G, Weinstein J, Penny R, Shelton T, Grimm D, Hatfield M, Morris S, Yena P, Rhodes P, Sherman M, Paulauskis J, Millis S, Kahn A, Greene J, Sfeir R, Jensen M, Chen J, Whitmore J, Alonso S, Jordan J, Chu A, Zhang J, Barker A, Compton C, Eley G, Ferguson M, Fielding P, Gerhard D, Myles R, Schaefer C, Mills Shaw K, Vaught J, Vockley J, Good P, Guyer M, Ozenberger B, Peterson J, Thomson E", "evidence": [ { "database": "dbSNP", "id": "rs199694481", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199694481" } ], "reference": [ { "type": "PubMed", "id": "21720365", "url": "https://glygen.org/publication/PubMed/21720365" } ] }, { "title": "Faulty initiation of proteoglycan synthesis causes cardiac and joint defects.", "journal": "American journal of human genetics", "date": "2011", "authors": "Baasanjav S, Al-Gazali L, Hashiguchi T, Mizumoto S, Fischer B, Horn D, Seelow D, Ali BR, Aziz SA, Langer R, Saleh AA, Becker C, Nurnberg G, Cantagrel V, Gleeson JG, Gomez D, Michel JB, Stricker S, Lindner TH, Nurnberg P, Sugahara K, Mundlos S, Hoffmann K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3560801", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3560801" } ], "reference": [ { "type": "PubMed", "id": "21763480", "url": "https://glygen.org/publication/PubMed/21763480" } ] }, { "title": "Collagen I and III and their decorin modified surfaces studied by atomic force microscopy and the elucidation of their affinity toward positive apolipoprotein B-100 residue by quartz crystal microbalance.", "journal": "The Analyst", "date": "2011", "authors": "Witos J, Saint-Guirons J, Meinander K, D'Ulivo L, Riekkola ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "21789315", "url": "https://glygen.org/publication/PubMed/21789315" } ] }, { "title": "Dentin phosphoprotein (DPP) activates integrin-mediated anchorage-dependent signals in undifferentiated mesenchymal cells.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Eapen A, Ramachandran A, George A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "22134916", "url": "https://glygen.org/publication/PubMed/22134916" } ] }, { "title": "Exome sequencing identifies recurrent SPOP, FOXA1 and MED12 mutations in prostate cancer.", "journal": "Nature genetics", "date": "2012", "authors": "Barbieri CE, Baca SC, Lawrence MS, Demichelis F, Blattner M, Theurillat JP, White TA, Stojanov P, Van Allen E, Stransky N, Nickerson E, Chae SS, Boysen G, Auclair D, Onofrio RC, Park K, Kitabayashi N, MacDonald TY, Sheikh K, Vuong T, Guiducci C, Cibulskis K, Sivachenko A, Carter SL, Saksena G, Voet D, Hussain WM, Ramos AH, Winckler W, Redman MC, Ardlie K, Tewari AK, Mosquera JM, Rupp N, Wild PJ, Moch H, Morrissey C, Nelson PS, Kantoff PW, Gabriel SB, Golub TR, Meyerson M, Lander ES, Getz G, Rubin MA, Garraway LA", "evidence": [ { "database": "dbSNP", "id": "rs756880346", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756880346" } ], "reference": [ { "type": "PubMed", "id": "22610119", "url": "https://glygen.org/publication/PubMed/22610119" } ] }, { "title": "Novel VCAN mutations and evidence for unbalanced alternative splicing in the pathogenesis of Wagner syndrome.", "journal": "Eur. J. Hum. Genet.", "date": "2013", "authors": "Kloeckener-Gruissem Barbara, Neidhardt John, Magyar Istv\u00e1n, Plauchu Henri, Zech Jean-Christophe, Morl\u00e9 Laurette, Palmer-Smith Sheila M, Macdonald Moira J, Nas V\u00e9ronique, Fry Andrew E, Berger Wolfgang", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "reference": [ { "type": "PubMed", "id": "22739342", "url": "https://glygen.org/publication/PubMed/22739342" } ] }, { "title": "Comprehensive molecular characterization of human colon and rectal cancer.", "journal": "Nature", "date": "2012", "authors": "Muzny DM, Bainbridge MN, Chang K, Dinh HH, Drummond JA, Fowler G, Kovar CL, Lewis LR, Morgan MB, Newsham IF, Reid JG, Santibanez J, Shinbrot E, Trevino LR, Wu YQ, Wang M, Gunaratne P, Donehower LA, Creighton CJ, Wheeler DA, Gibbs RA, Lawrence MS, Voet D, Jing R, Cibulskis K, Sivachenko A, Stojanov P, McKenna A, Lander ES, Gabriel S, Getz G, Ding L, Fulton RS, Koboldt DC, Wylie T, Walker J, Dooling DJ, Fulton L, Delehaunty KD, Fronick CC, Demeter R, Mardis ER, Wilson RK, Chu A, Chun HJ, Mungall AJ, Pleasance E, Robertson A, Stoll D, Balasundaram M, Birol I, Butterfield YS, Chuah E, Coope RJ, Dhalla N, Guin R, Hirst C, Hirst M, Holt RA, Lee D, Li HI, Mayo M, Moore RA, Schein JE, Slobodan JR, Tam A, Thiessen N, Varhol R, Zeng T, Zhao Y, Jones SJ, Marra MA, Bass AJ, Ramos AH, Saksena G, Cherniack AD, Schumacher SE, Tabak B, Carter SL, Pho NH, Nguyen H, Onofrio RC, Crenshaw A, Ardlie K, Beroukhim R, Winckler W, Getz G, Meyerson M, Protopopov A, Zhang J, Hadjipanayis A, Lee E, Xi R, Yang L, Ren X, Zhang H, Sathiamoorthy N, Shukla S, Chen PC, Haseley P, Xiao Y, Lee S, Seidman J, Chin L, Park PJ, Kucherlapati R, Auman JT, Hoadley KA, Du Y, Wilkerson MD, Shi Y, Liquori C, Meng S, Li L, Turman YJ, Topal MD, Tan D, Waring S, Buda E, Walsh J, Jones CD, Mieczkowski PA, Singh D, Wu J, Gulabani A, Dolina P, Bodenheimer T, Hoyle AP, Simons JV, Soloway M, Mose LE, Jefferys SR, Balu S, O'Connor BD, Prins JF, Chiang DY, Hayes D, Perou CM, Hinoue T, Weisenberger DJ, Maglinte DT, Pan F, Berman BP, Van Den Berg DJ, Shen H, Triche T Jr, Baylin SB, Laird PW, Getz G, Noble M, Voet D, Saksena G, Gehlenborg N, DiCara D, Zhang J, Zhang H, Wu CJ, Liu SY, Shukla S, Lawrence MS, Zhou L, Sivachenko A, Lin P, Stojanov P, Jing R, Park RW, Nazaire MD, Robinson J, Thorvaldsdottir H, Mesirov J, Park PJ, Chin L, Thorsson V, Reynolds SM, Bernard B, Kreisberg R, Lin J, Iype L, Bressler R, Erkkila T, Gundapuneni M, Liu Y, Norberg A, Robinson T, Yang D, Zhang W, Shmulevich I, de Ronde JJ, Schultz N, Cerami E, Ciriello G, Goldberg AP, Gross B, Jacobsen A, Gao J, Kaczkowski B, Sinha R, Aksoy B, Antipin Y, Reva B, Shen R, Taylor BS, Chan TA, Ladanyi M, Sander C, Akbani R, Zhang N, Broom BM, Casasent T, Unruh A, Wakefield C, Hamilton SR, Cason R, Baggerly KA, Weinstein JN, Haussler D, Benz CC, Stuart JM, Benz SC, Sanborn J, Vaske CJ, Zhu J, Szeto C, Scott GK, Yau C, Ng S, Goldstein T, Ellrott K, Collisson E, Cozen AE, Zerbino D, Wilks C, Craft B, Spellman P, Penny R, Shelton T, Hatfield M, Morris S, Yena P, Shelton C, Sherman M, Paulauskis J, Gastier-Foster JM, Bowen J, Ramirez NC, Black A, Pyatt R, Wise L, White P, Bertagnolli M, Brown J, Chan TA, Chu GC, Czerwinski C, Denstman F, Dhir R, Dorner A, Fuchs CS, Guillem JG, Iacocca M, Juhl H, Kaufman A, Kohl B 3rd, Van Le X, Mariano MC, Medina EN, Meyers M, Nash GM, Paty PB, Petrelli N, Rabeno B, Richards WG, Solit D, Swanson P, Temple L, Tepper JE, Thorp R, Vakiani E, Weiser MR, Willis JE, Witkin G, Zeng Z, Zinner MJ, Zornig C, Jensen MA, Sfeir R, Kahn AB, Chu AL, Kothiyal P, Wang Z, Snyder EE, Pontius J, Pihl TD, Ayala B, Backus M, Walton J, Whitmore J, Baboud J, Berton DL, Nicholls MC, Srinivasan D, Raman R, Girshik S, Kigonya PA, Alonso S, Sanbhadti RN, Barletta SP, Greene JM, Pot DA, Shaw KR, Dillon LA, Buetow K, Davidsen T, Demchok JA, Eley G, Ferguson M, Fielding P, Schaefer C, Sheth M, Yang L, Guyer MS, Ozenberger BA, Palchik JD, Peterson J, Sofia HJ, Thomson E", "evidence": [ { "database": "dbSNP", "id": "rs149651541", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149651541" } ], "reference": [ { "type": "PubMed", "id": "22810696", "url": "https://glygen.org/publication/PubMed/22810696" } ] }, { "title": "Recurrent R-spondin fusions in colon cancer.", "journal": "Nature", "date": "2012", "authors": "Seshagiri S, Stawiski EW, Durinck S, Modrusan Z, Storm EE, Conboy CB, Chaudhuri S, Guan Y, Janakiraman V, Jaiswal BS, Guillory J, Ha C, Dijkgraaf GJ, Stinson J, Gnad F, Huntley MA, Degenhardt JD, Haverty PM, Bourgon R, Wang W, Koeppen H, Gentleman R, Starr TK, Zhang Z, Largaespada DA, Wu TD, de Sauvage FJ", "evidence": [ { "database": "dbSNP", "id": "rs765589028", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765589028" } ], "reference": [ { "type": "PubMed", "id": "22895193", "url": "https://glygen.org/publication/PubMed/22895193" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "P13611", "url": "" }, { "database": "GlyGen", "id": "GLY_000268", "url": "https://data.glygen.org/GLY_000268" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "Immunoelectron microscopy of osteonectin and type I collagen in osteoblasts and bone matrix.", "journal": "Calcified tissue international", "date": "1990", "authors": "Romanowski R, Jundt G, Termine JD, von der Mark K, Schulz A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2364322", "url": "https://glygen.org/publication/PubMed/2364322" } ] }, { "title": "Mutations in B3GALT6, which encodes a glycosaminoglycan linker region enzyme, cause a spectrum of skeletal and connective tissue disorders.", "journal": "American journal of human genetics", "date": "2013", "authors": "Nakajima M, Mizumoto S, Miyake N, Kogawa R, Iida A, Ito H, Kitoh H, Hirayama A, Mitsubuchi H, Miyazaki O, Kosaki R, Horikawa R, Lai A, Mendoza-Londono R, Dupuis L, Chitayat D, Howard A, Leal GF, Cavalcanti D, Tsurusaki Y, Saitsu H, Watanabe S, Lausch E, Unger S, Bonafe L, Ohashi H, Superti-Furga A, Matsumoto N, Sugahara K, Nishimura G, Ikegawa S", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420332", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420332" } ], "reference": [ { "type": "PubMed", "id": "23664117", "url": "https://glygen.org/publication/PubMed/23664117" } ] }, { "title": "Defective initiation of glycosaminoglycan synthesis due to B3GALT6 mutations causes a pleiotropic Ehlers-Danlos-syndrome-like connective tissue disorder.", "journal": "American journal of human genetics", "date": "2013", "authors": "Malfait F, Kariminejad A, Van Damme T, Gauche C, Syx D, Merhi-Soussi F, Gulberti S, Symoens S, Vanhauwaert S, Willaert A, Bozorgmehr B, Kariminejad MH, Ebrahimiadib N, Hausser I, Huysseune A, Fournel-Gigleux S, De Paepe A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4420332", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420332" } ], "reference": [ { "type": "PubMed", "id": "23664118", "url": "https://glygen.org/publication/PubMed/23664118" } ] }, { "title": "A 125/115-kDa cell surface receptor specific for vitronectin interacts with the arginine-glycine-aspartic acid adhesion sequence derived from fibronectin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1985", "authors": "Pytela R, Pierschbacher MD, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2412224", "url": "https://glygen.org/publication/PubMed/2412224" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "Platelet membrane glycoprotein IIb/IIIa: member of a family of Arg-Gly-Asp--specific adhesion receptors.", "journal": "Science (New York, N.Y.)", "date": "1986", "authors": "Pytela R, Pierschbacher MD, Ginsberg MH, Plow EF, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2420006", "url": "https://glygen.org/publication/PubMed/2420006" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" }, { "database": "iPTMnet", "id": "P13611", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13611" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Interaction of vitronectin with collagen.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Gebb C, Hayman EG, Engvall E, Ruoslahti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "2430969", "url": "https://glygen.org/publication/PubMed/2430969" } ] }, { "title": "Ehlers-Danlos syndrome associated with glycosaminoglycan abnormalities.", "journal": "Advances in experimental medicine and biology", "date": "2014", "authors": "Miyake N, Kosho T, Matsumoto N", "evidence": [ { "database": "Reactome", "id": "R-HSA-3560783", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3560783" } ], "reference": [ { "type": "PubMed", "id": "24443026", "url": "https://glygen.org/publication/PubMed/24443026" } ] }, { "title": "Isolation and partial characterization of a glial hyaluronate-binding protein.", "journal": "J. Biol. Chem.", "date": "1989", "authors": "Perides G, Lane W S, Andrews D, Dahl D, Bignami A", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "reference": [ { "type": "PubMed", "id": "2466833", "url": "https://glygen.org/publication/PubMed/2466833" } ] }, { "title": "Structural similarity of hyaluronate binding proteins in brain and cartilage.", "journal": "Brain Res. Bull.", "date": "1989", "authors": "Bignami A, Lane W S, Andrews D, Dahl D", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "reference": [ { "type": "PubMed", "id": "2469524", "url": "https://glygen.org/publication/PubMed/2469524" } ] }, { "title": "Structure of the Mr 140,000 growth hormone-dependent insulin-like growth factor binding protein complex: determination by reconstitution and affinity-labeling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Baxter RC, Martin JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "2476804", "url": "https://glygen.org/publication/PubMed/2476804" } ] }, { "title": "Cloning, sequence analysis and expression of a cDNA encoding a novel insulin-like growth factor binding protein (IGFBP-2).", "journal": "The EMBO journal", "date": "1989", "authors": "Binkert C, Landwehr J, Mary JL, Schwander J, Heinrich G", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "2479552", "url": "https://glygen.org/publication/PubMed/2479552" } ] }, { "title": "Identification of chondroitin sulfate linkage region glycopeptides reveals prohormones as a novel class of proteoglycans.", "journal": "Molecular & cellular proteomics : MCP", "date": "2015-01", "authors": "Noborn Fredrik, Gomez Toledo Alejandro, Sihlbom Carina, Lengqvist Johan, Fries Erik, Kjell\u00e9n Lena, Nilsson Jonas, Larson G\u00f6ran", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" }, { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "reference": [ { "type": "PubMed", "id": "25326458", "url": "https://glygen.org/publication/PubMed/25326458" } ] }, { "title": "Probing the O-glycoproteome of gastric cancer cell lines for biomarker discovery.", "journal": "Molecular & cellular proteomics : MCP", "date": "2015", "authors": "Campos D, Freitas D, Gomes J, Magalhaes A, Steentoft C, Gomes C, Vester-Christensen MB, Ferreira JA, Afonso LP, Santos LL, Pinto de Sousa J, Mandel U, Clausen H, Vakhrushev SY, Reis CA", "evidence": [ { "database": "GlyGen", "id": "GLY_000268", "url": "https://data.glygen.org/GLY_000268" } ], "reference": [ { "type": "PubMed", "id": "25813380", "url": "https://glygen.org/publication/PubMed/25813380" } ] }, { "title": "Multiple domains of the large fibroblast proteoglycan, versican.", "journal": "EMBO J.", "date": "1989", "authors": "Zimmermann D R, Ruoslahti E", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "reference": [ { "type": "PubMed", "id": "2583089", "url": "https://glygen.org/publication/PubMed/2583089" } ] }, { "title": "A Single Kinase Generates the Majority of the Secreted Phosphoproteome.", "journal": "Cell", "date": "2015", "authors": "Tagliabracci VS, Wiley SE, Guo X, Kinch LN, Durrant E, Wen J, Xiao J, Cui J, Nguyen KB, Engel JL, Coon JJ, Grishin N, Pinna LA, Pagliarini DJ, Dixon JE", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" }, { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" }, { "database": "iPTMnet", "id": "P13611", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13611" } ], "reference": [ { "type": "PubMed", "id": "26091039", "url": "https://glygen.org/publication/PubMed/26091039" } ] }, { "title": "A fibroblast chondroitin sulfate proteoglycan core protein contains lectin-like and growth factor-like sequences.", "journal": "J. Biol. Chem.", "date": "1987", "authors": "Krusius T, Gehlsen K R, Ruoslahti E", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "reference": [ { "type": "PubMed", "id": "2820964", "url": "https://glygen.org/publication/PubMed/2820964" } ] }, { "title": "A novel strategy for global mapping of O-GlcNAc proteins and peptides using selective enzymatic deglycosylation, HILIC enrichment and mass spectrometry identification.", "journal": "Talanta", "date": "2017", "authors": "Shen B, Zhang W, Shi Z, Tian F, Deng Y, Sun C, Wang G, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P13611", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P13611" } ], "reference": [ { "type": "PubMed", "id": "28411811", "url": "https://glygen.org/publication/PubMed/28411811" } ] }, { "title": "Quantitative proteomics identifies altered O-GlcNAcylation of structural, synaptic and memory-associated proteins in Alzheimer's disease.", "journal": "The Journal of pathology", "date": "2017", "authors": "Wang S, Yang F, Petyuk VA, Shukla AK, Monroe ME, Gritsenko MA, Rodland KD, Smith RD, Qian WJ, Gong CX, Liu T", "evidence": [ { "database": "O-GlcNAc Database", "id": "P13611", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P13611" }, { "database": "O-GlcNAc Atlas", "id": "P13611", "url": "https://oglcnac.org/atlas/detail/P13611" } ], "reference": [ { "type": "PubMed", "id": "28657654", "url": "https://glygen.org/publication/PubMed/28657654" } ] }, { "title": "Large-scale intact glycopeptide identification by Mascot database search.", "journal": "Scientific reports", "date": "2018", "authors": "Bollineni RC, Koehler CJ, Gislefoss RE, Anonsen JH, Thiede B", "evidence": [ { "database": "GlyConnect", "id": "1890", "url": "https://glyconnect.expasy.org/browser/proteins/1890" } ], "reference": [ { "type": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "title": "Oligosaccharide structure and amino acid sequence of the major glycopeptides of mature human beta-hexosaminidase.", "journal": "Biochemistry", "date": "1988", "authors": "O'Dowd BF, Cumming DA, Gravel RA, Mahuran D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024101", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024101" } ], "reference": [ { "type": "PubMed", "id": "2971395", "url": "https://glygen.org/publication/PubMed/2971395" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "GlyConnect", "id": "1890", "url": "https://glyconnect.expasy.org/browser/proteins/1890" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Extracellular matrix component expression in human pluripotent stem cell-derived retinal organoids recapitulates retinogenesis in vivo and reveals an important role for IMPG1 and CD44 in the development of photoreceptors and interphotoreceptor matrix.", "journal": "Acta Biomater.", "date": "2018", "authors": "Felemban M, Dorgau B, Hunt NC, Hallam D, Zerti D, Bauer R, Ding Y, Collin J, Steel D, Krasnogor N, Al-Aama J, Lindsay S, Mellough C, Lako M", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "reference": [ { "type": "PubMed", "id": "29777959", "url": "https://glygen.org/publication/PubMed/29777959" } ] }, { "title": "Distinct urinary glycoprotein signatures in prostate cancer patients.", "journal": "Oncotarget", "date": "2018", "authors": "Kawahara R, Ortega F, Rosa-Fernandes L, Guimaraes V, Quina D, Nahas W, Schwammle V, Srougi M, Leite KRM, Thaysen-Andersen M, Larsen MR, Palmisano G", "evidence": [ { "database": "GlyConnect", "id": "1890", "url": "https://glyconnect.expasy.org/browser/proteins/1890" } ], "reference": [ { "type": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).", "journal": "Molecular systems biology", "date": "2018", "authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P13611", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30459171", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "title": "Demonstration of an endo-beta-galactosidase and an endo-beta-xylosidase that degrade the proteoglycan linkage region.", "journal": "Biochimica et biophysica acta", "date": "1988", "authors": "Takagaki K, Nakamura T, Endo M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024101", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024101" } ], "reference": [ { "type": "PubMed", "id": "3134052", "url": "https://glygen.org/publication/PubMed/3134052" } ] }, { "title": "An affinity chromatography and glycoproteomics workflow to profile the chondroitin sulfate proteoglycans that interact with malarial VAR2CSA in the placenta and in cancer.", "journal": "Glycobiology", "date": "2020-12-09", "authors": "Toledo Alejandro G\u00f3mez, Pihl Jessica, Spliid Charlotte B, Persson Andrea, Nilsson Jonas, Pereira Marina Ayres, Gustavsson Tobias, Choudhary Swati, Oo Htoo Zarni, Black Peter C, Daugaard Mads, Esko Jeffrey D, Larson G\u00f6ran, Salanti Ali, Clausen Thomas Mandel", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" }, { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "reference": [ { "type": "PubMed", "id": "32337544", "url": "https://glygen.org/publication/PubMed/32337544" } ] }, { "title": "Mass spectrometric analysis of chondroitin sulfate-linked peptides.", "journal": "Journal of proteins and proteomics", "date": "2022", "authors": "Ramarajan Madan Gopal, Saraswat Mayank, Budhraja Rohit, Garapati Kishore, Raymond Kimiyo, Pandey Akhilesh", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611#ptm_processing" }, { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "reference": [ { "type": "PubMed", "id": "36213313", "url": "https://glygen.org/publication/PubMed/36213313" } ] }, { "title": "V3: an enigmatic isoform of the proteoglycan versican.", "journal": "American journal of physiology. Cell physiology", "date": "2023-08-01", "authors": "Wight Thomas N, Day Anthony J, Kang Inkyung, Harten Ingrid A, Kaber Gernot, Briggs David C, Braun Kathleen R, Lemire Joan M, Kinsella Michael G, Hinek Aleksander, Merrilees Mervyn J", "evidence": [ { "database": "RefSeq", "id": "NP_001119808", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001119808" } ], "reference": [ { "type": "PubMed", "id": "37399500", "url": "https://glygen.org/publication/PubMed/37399500" } ] }, { "title": "Identification of mutation gene prognostic biomarker in multiple myeloma through gene panel exome sequencing and transcriptome analysis in Chinese population.", "journal": "Computers in biology and medicine", "date": "2023-09", "authors": "Xie Chunbao, Zhong Ling, Luo Jiangrong, Luo Ji, Wu Yingmiao, Zheng Shuai, Jiang Lingxi, Zhang Jianbo, Shi Yi", "evidence": [ { "database": "RefSeq", "id": "NP_001119808", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001119808" } ], "reference": [ { "type": "PubMed", "id": "37406588", "url": "https://glygen.org/publication/PubMed/37406588" } ] }, { "title": "TGF-\u03b21 dominates stromal fibroblast-mediated EMT via the FAP/VCAN axis in bladder cancer cells.", "journal": "Journal of translational medicine", "date": "2023-07-17", "authors": "Ping Qinrong, Wang Chunhui, Cheng Xin, Zhong Yiming, Yan Ruping, Yang Meng, Shi Yunqiang, Li Xiangmeng, Li Xiao, Huang Wenwen, Wang Liqiong, Bi Xiaofang, Hu Libing, Yang Yang, Wang Yingbao, Gong Rui, Tan Jun, Li Rui, Li Hui, Li Jian, Wang Wenju, Li Ruhong", "evidence": [ { "database": "RefSeq", "id": "NP_001119808", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001119808" } ], "reference": [ { "type": "PubMed", "id": "37461061", "url": "https://glygen.org/publication/PubMed/37461061" } ] }, { "title": "Cartilage proteoglycan binding region and link protein. Radioimmunoassays and the detection of masked determinants in aggregates.", "journal": "The Biochemical journal", "date": "1983", "authors": "Ratcliffe A, Hardingham T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "6193777", "url": "https://glygen.org/publication/PubMed/6193777" } ] }, { "title": "Specific inhibition of type I and type II collagen fibrillogenesis by the small proteoglycan of tendon.", "journal": "The Biochemical journal", "date": "1984", "authors": "Vogel KG, Paulsson M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "6439184", "url": "https://glygen.org/publication/PubMed/6439184" } ] }, { "title": "Arylsulphatase B, an exo-sulphatase for chondroitin 4-sulphate tetrasaccharide.", "journal": "Hoppe-Seyler's Zeitschrift fur physiologische Chemie", "date": "1978", "authors": "Gorham SD, Cantz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024101", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024101" } ], "reference": [ { "type": "PubMed", "id": "738706", "url": "https://glygen.org/publication/PubMed/738706" } ] }, { "title": "Binding of tenascin-C to soluble fibronectin and matrix fibrils.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Chung CY, Zardi L, Erickson HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7499434", "url": "https://glygen.org/publication/PubMed/7499434" } ] }, { "title": "Heparin, heparan sulfate, and dermatan sulfate regulate formation of the insulin-like growth factor-I and insulin-like growth factor-binding protein complexes.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Arai T, Parker A, Busby W Jr, Clemmons DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7519608", "url": "https://glygen.org/publication/PubMed/7519608" } ] }, { "title": "Matrix metalloproteinases degrade insulin-like growth factor-binding protein-3 in dermal fibroblast cultures.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Fowlkes JL, Enghild JJ, Suzuki K, Nagase H", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7523391", "url": "https://glygen.org/publication/PubMed/7523391" } ] }, { "title": "Recombinant human insulin-like growth factor (IGF)-binding protein-6 inhibits IGF-II-induced differentiation of L6A1 myoblasts.", "journal": "Endocrinology", "date": "1994", "authors": "Bach LA, Hsieh S, Brown AL, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525263", "url": "https://glygen.org/publication/PubMed/7525263" } ] }, { "title": "Identification of insulin-like growth factor-binding protein-3 (IGFBP-3) fragments and IGFBP-5 proteolytic activity in human seminal plasma: a comparison of normal and vasectomized patients.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1994", "authors": "Lee KO, Oh Y, Giudice LC, Cohen P, Peehl DM, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525634", "url": "https://glygen.org/publication/PubMed/7525634" } ] }, { "title": "Biological effects of prostate specific antigen as an insulin-like growth factor binding protein-3 protease.", "journal": "The Journal of endocrinology", "date": "1994", "authors": "Cohen P, Peehl DM, Graves HC, Rosenfeld RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7525824", "url": "https://glygen.org/publication/PubMed/7525824" } ] }, { "title": "Tenascin-R (J1 160/180 inhibits fibronectin-mediated cell adhesion--functional relatedness to tenascin-C.", "journal": "Journal of cell science", "date": "1994", "authors": "Pesheva P, Probstmeier R, Skubitz AP, McCarthy JB, Furcht LT, Schachner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7527058", "url": "https://glygen.org/publication/PubMed/7527058" } ] }, { "title": "Interactions between insulin-like growth factor-I (IGF-I) and the system of plasminogen activators and their inhibitors in the control of IGF-binding protein-3 production and proteolysis in human osteosarcoma cells.", "journal": "Endocrinology", "date": "1994", "authors": "Lalou C, Silve C, Rosato R, Segovia B, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7527330", "url": "https://glygen.org/publication/PubMed/7527330" } ] }, { "title": "Characterization of the complete genomic structure of the human versican gene and functional analysis of its promoter.", "journal": "J. Biol. Chem.", "date": "1994", "authors": "Naso MF, Zimmermann DR, Iozzo RV", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "reference": [ { "type": "PubMed", "id": "7528742", "url": "https://glygen.org/publication/PubMed/7528742" } ] }, { "title": "Biochemical analysis of prostate specific antigen-proteolyzed insulin-like growth factor binding protein-3.", "journal": "Growth regulation", "date": "1994", "authors": "Fielder PJ, Rosenfeld RG, Graves HC, Grandbois K, Maack CA, Sawamura S, Ogawa Y, Sommer A, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7538844", "url": "https://glygen.org/publication/PubMed/7538844" } ] }, { "title": "Alpha v beta 1 is a receptor for vitronectin and fibrinogen, and acts with alpha 5 beta 1 to mediate spreading on fibronectin.", "journal": "Journal of cell science", "date": "1995", "authors": "Marshall JF, Rutherford DC, McCartney AC, Mitjans F, Goodman SL, Hart IR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7542669", "url": "https://glygen.org/publication/PubMed/7542669" } ] }, { "title": "Serum levels of insulin-like growth factor (IGF)-binding protein-3 (IGFBP-3) in healthy infants, children, and adolescents: the relation to IGF-I, IGF-II, IGFBP-1, IGFBP-2, age, sex, body mass index, and pubertal maturation.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1995", "authors": "Juul A, Dalgaard P, Blum WF, Bang P, Hall K, Michaelsen KF, Muller J, Skakkebaek NE", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7543116", "url": "https://glygen.org/publication/PubMed/7543116" } ] }, { "title": "The human integrin alpha 8 beta 1 functions as a receptor for tenascin, fibronectin, and vitronectin.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Schnapp LM, Hatch N, Ramos DM, Klimanskaya IV, Sheppard D, Pytela R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7559467", "url": "https://glygen.org/publication/PubMed/7559467" } ] }, { "title": "Autocrine regulation of cell proliferation by the insulin-like growth factor (IGF) and IGF binding protein-3 protease system in a human prostate carcinoma cell line (PC-3).", "journal": "Endocrinology", "date": "1995", "authors": "Angelloz-Nicoud P, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7588299", "url": "https://glygen.org/publication/PubMed/7588299" } ] }, { "title": "A novel amino acid modification in sulfatases that is defective in multiple sulfatase deficiency.", "journal": "Cell", "date": "1995", "authors": "Schmidt B, Selmer T, Ingendoh A, von Figura K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024101", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024101" } ], "reference": [ { "type": "PubMed", "id": "7628016", "url": "https://glygen.org/publication/PubMed/7628016" } ] }, { "title": "Binding of mutants of human insulin-like growth factor II to insulin-like growth factor binding proteins 1-6.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Bach LA, Hsieh S, Sakano K, Fujiwara H, Perdue JF, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7683646", "url": "https://glygen.org/publication/PubMed/7683646" } ] }, { "title": "The alpha v beta 5 integrin receptor regulates receptor-mediated endocytosis of vitronectin.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Panetti TS, McKeown-Longo PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7685013", "url": "https://glygen.org/publication/PubMed/7685013" } ] }, { "title": "Glucose does not influence the insulin-like growth factor (JGF) binding to carrier proteins (IGFBPs): analysis of rat and human serum by western ligand blotting.", "journal": "Experientia", "date": "1993", "authors": "Cianfarani S, Frost VJ, Savage MO, Holly JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "7689487", "url": "https://glygen.org/publication/PubMed/7689487" } ] }, { "title": "Endothelial cell attachment and spreading on human tenascin is mediated by alpha 2 beta 1 and alpha v beta 3 integrins.", "journal": "Journal of cell science", "date": "1993", "authors": "Sriramarao P, Mendler M, Bourdon MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7693733", "url": "https://glygen.org/publication/PubMed/7693733" } ] }, { "title": "A novel glycosaminoglycan attachment domain identified in two alternative splice variants of human versican.", "journal": "J. Biol. Chem.", "date": "1994", "authors": "Dours-Zimmermann M T, Zimmermann D R", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "reference": [ { "type": "PubMed", "id": "7806529", "url": "https://glygen.org/publication/PubMed/7806529" } ] }, { "title": "Interaction of biglycan with type I collagen.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Schonherr E, Witsch-Prehm P, Harrach B, Robenek H, Rauterberg J, Kresse H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "7852349", "url": "https://glygen.org/publication/PubMed/7852349" } ] }, { "title": "Expression of PG-M(V3), an alternatively spliced form of PG-M without a chondroitin sulfate attachment in region in mouse and human tissues.", "journal": "J. Biol. Chem.", "date": "1995", "authors": "Zako M, Shinomura T, Ujita M, Ito K, Kimata K", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "reference": [ { "type": "PubMed", "id": "7876137", "url": "https://glygen.org/publication/PubMed/7876137" } ] }, { "title": "Identification of the proteoglycan versican in aorta and smooth muscle cells by DNA sequence analysis, in situ hybridization and immunohistochemistry.", "journal": "Matrix Biol.", "date": "1994", "authors": "Yao L Y, Moody C, Sch\u00f6nherr E, Wight T N, Sandell L J", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "reference": [ { "type": "PubMed", "id": "7921538", "url": "https://glygen.org/publication/PubMed/7921538" } ] }, { "title": "The expression of functional link protein in a baculovirus system: analysis of mutants lacking the A, B and B' domains.", "journal": "The Biochemical journal", "date": "1994", "authors": "Grover J, Roughley PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8002934", "url": "https://glygen.org/publication/PubMed/8002934" } ] }, { "title": "Identification of mutations in the alpha-L-iduronidase gene (IDUA) that cause Hurler and Scheie syndromes.", "journal": "American journal of human genetics", "date": "1993", "authors": "Scott HS, Litjens T, Nelson PV, Thompson PR, Brooks DA, Hopwood JJ, Morris CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024101", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024101" } ], "reference": [ { "type": "PubMed", "id": "8213840", "url": "https://glygen.org/publication/PubMed/8213840" } ] }, { "title": "Interaction of heparin cofactor II with biglycan and decorin.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Whinna HC, Choi HU, Rosenberg LC, Church FC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8440685", "url": "https://glygen.org/publication/PubMed/8440685" } ] }, { "title": "Differential expression of versican isoforms in brain tumors.", "journal": "J. Neuropathol. Exp. Neurol.", "date": "1996", "authors": "Paulus W, Baur I, Dours-Zimmermann M T, Zimmermann D R", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "reference": [ { "type": "PubMed", "id": "8627343", "url": "https://glygen.org/publication/PubMed/8627343" } ] }, { "title": "Measurement of insulin-like growth factor (IGF)-II binding to purified IGF binding proteins 1-6: comparison of charcoal adsorption and high performance size exclusion chromatography.", "journal": "Biochimica et biophysica acta", "date": "1996", "authors": "Bach LA, Rechler MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8781553", "url": "https://glygen.org/publication/PubMed/8781553" } ] }, { "title": "Differential effects of the integrins alpha9beta1, alphavbeta3, and alphavbeta6 on cell proliferative responses to tenascin. Roles of the beta subunit extracellular and cytoplasmic domains.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Yokosaki Y, Monis H, Chen J, Sheppard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8798654", "url": "https://glygen.org/publication/PubMed/8798654" } ] }, { "title": "Insulin-like growth factor binding protein (IGFBP) proteases: functional regulators of cell growth.", "journal": "Progress in growth factor research", "date": "1995", "authors": "Rajah R, Katz L, Nunn S, Solberg P, Beers T, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8817670", "url": "https://glygen.org/publication/PubMed/8817670" } ] }, { "title": "Recombinant human insulin-like growth factor (IGF) binding protein-3 stimulates prostate carcinoma cell proliferation via an IGF-dependent mechanism. Role of serine proteases.", "journal": "Growth regulation", "date": "1996", "authors": "Angelloz-Nicoud P, Harel L, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8894645", "url": "https://glygen.org/publication/PubMed/8894645" } ] }, { "title": "Interaction of cartilage matrix protein with aggrecan. Increased covalent cross-linking with tissue maturation.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Hauser N, Paulsson M, Heinegard D, Morgelin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "8943283", "url": "https://glygen.org/publication/PubMed/8943283" } ] }, { "title": "Isolation and characterization of proteolytic fragments of insulin-like growth factor-binding protein-3.", "journal": "Hormone research", "date": "1996", "authors": "Lalou C, Lassarre C, Binoux M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "8964575", "url": "https://glygen.org/publication/PubMed/8964575" } ] }, { "title": "Purification, cloning, and expression of human plasma hyaluronidase.", "journal": "Biochemical and biophysical research communications", "date": "1997", "authors": "Frost GI, Csoka AB, Wong T, Stern R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024101", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024101" } ], "reference": [ { "type": "PubMed", "id": "9223416", "url": "https://glygen.org/publication/PubMed/9223416" } ] }, { "title": "Localization of a binding site for the proteoglycan decorin on collagen XIV (undulin).", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Ehnis T, Dieterich W, Bauer M, Kresse H, Schuppan D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9252349", "url": "https://glygen.org/publication/PubMed/9252349" } ] }, { "title": "The C-type lectin domains of lecticans, a family of aggregating chondroitin sulfate proteoglycans, bind tenascin-R by protein-protein interactions independent of carbohydrate moiety.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Aspberg A, Miura R, Bourdoulous S, Shimonaka M, Heinegard D, Schachner M, Ruoslahti E, Yamaguchi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9294172", "url": "https://glygen.org/publication/PubMed/9294172" } ] }, { "title": "Mapping of a defined neurocan binding site to distinct domains of tenascin-C.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Rauch U, Clement A, Retzler C, Frohlich L, Fassler R, Gohring W, Faissner A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9341124", "url": "https://glygen.org/publication/PubMed/9341124" } ] }, { "title": "Identification of hyaluronan-binding domains of aggrecan.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Watanabe H, Cheung SC, Itano N, Kimata K, Yamada Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9346959", "url": "https://glygen.org/publication/PubMed/9346959" } ] }, { "title": "Insulin-like growth factor (IGF)-binding protein 5 forms an alternative ternary complex with IGFs and the acid-labile subunit.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Twigg SM, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9497324", "url": "https://glygen.org/publication/PubMed/9497324" } ] }, { "title": "Molecular cloning and expression of glucuronyltransferase I involved in the biosynthesis of the glycosaminoglycan-protein linkage region of proteoglycans.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Kitagawa H, Tone Y, Tamura J, Neumann KW, Ogawa T, Oka S, Kawasaki T, Sugahara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "9506957", "url": "https://glygen.org/publication/PubMed/9506957" } ] }, { "title": "Crystal structure of human arylsulfatase A: the aldehyde function and the metal ion at the active site suggest a novel mechanism for sulfate ester hydrolysis.", "journal": "Biochemistry", "date": "1998", "authors": "Lukatela G, Krauss N, Theis K, Selmer T, Gieselmann V, von Figura K, Saenger W", "evidence": [ { "database": "Reactome", "id": "R-HSA-2024101", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024101" } ], "reference": [ { "type": "PubMed", "id": "9521684", "url": "https://glygen.org/publication/PubMed/9521684" } ] }, { "title": "Cartilage oligomeric matrix protein shows high affinity zinc-dependent interaction with triple helical collagen.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Rosenberg K, Olsson H, Morgelin M, Heinegard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9685393", "url": "https://glygen.org/publication/PubMed/9685393" } ] }, { "title": "Identification of novel high molecular weight insulin-like growth factor-binding protein-3 association proteins in human serum.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1998", "authors": "Collett-Solberg PF, Nunn SE, Gibson TB, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9709957", "url": "https://glygen.org/publication/PubMed/9709957" } ] }, { "title": "The insulin-like growth factor (IGF)binding protein 1 binding epitope on IGF-I probed by heteronuclear NMR spectroscopy and mutational analysis.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Jansson M, Andersson G, Uhlen M, Nilsson B, Kordel J", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9733769", "url": "https://glygen.org/publication/PubMed/9733769" } ] }, { "title": "Insulin-like growth factor-binding protein 5 complexes with the acid-labile subunit. Role of the carboxyl-terminal domain.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Twigg SM, Kiefer MC, Zapf J, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9786878", "url": "https://glygen.org/publication/PubMed/9786878" } ] }, { "title": "A new multiple congenital anomaly, mental retardation syndrome with preaxial brachydactyly, hyperphalangism, deafness and orodental anomalies.", "journal": "Clinical dysmorphology", "date": "1998", "authors": "Temtamy SA, Meguid NA, Ismail SI, Ramzy MI", "evidence": [ { "database": "Reactome", "id": "R-HSA-3595177", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3595177" } ], "reference": [ { "type": "PubMed", "id": "9823490", "url": "https://glygen.org/publication/PubMed/9823490" } ] }, { "title": "Functional expression and genomic structure of human chondroitin 6-sulfotransferase.", "journal": "FEBS letters", "date": "1998", "authors": "Tsutsumi K, Shimakawa H, Kitagawa H, Sugahara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022870", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022870" } ], "reference": [ { "type": "PubMed", "id": "9883891", "url": "https://glygen.org/publication/PubMed/9883891" } ] }, { "title": "A beta-1,3-N-acetylglucosaminyltransferase with poly-N-acetyllactosamine synthase activity is structurally related to beta-1,3-galactosyltransferases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Zhou D, Dinter A, Gutierrez Gallego R, Kamerling JP, Vliegenthart JF, Berger EG, Hennet T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1971475", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475" } ], "reference": [ { "type": "PubMed", "id": "9892646", "url": "https://glygen.org/publication/PubMed/9892646" } ] }, { "title": "Elevated levels of the IGF-binding protein protease MMP-1 in asthmatic airway smooth muscle.", "journal": "American journal of respiratory cell and molecular biology", "date": "1999", "authors": "Rajah R, Nachajon RV, Collins MH, Hakonarson H, Grunstein MM, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381426", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426" } ], "reference": [ { "type": "PubMed", "id": "9922210", "url": "https://glygen.org/publication/PubMed/9922210" } ] }, { "title": "Tenascin-C inhibits beta1 integrin-dependent cell adhesion and neurite outgrowth on fibronectin by a disialoganglioside-mediated signaling mechanism.", "journal": "Glycobiology", "date": "1999", "authors": "Probstmeier R, Pesheva P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3000178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178" } ], "reference": [ { "type": "PubMed", "id": "9949188", "url": "https://glygen.org/publication/PubMed/9949188" } ] } ], "pathway": [ { "id": "hsa:1462", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1462", "resource": "KEGG Pathway" }, { "id": "R-HSA-1971475", "name": "A tetrasaccharide linker sequence is required for GAG synthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1971475", "resource": "Reactome", "description": "A tetrasaccharide linker sequence is required for GAG synthesis" }, { "id": "R-HSA-2022870", "name": "Chondroitin sulfate biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022870", "resource": "Reactome", "description": "Chondroitin sulfate biosynthesis" }, { "id": "R-HSA-2022923", "name": "Dermatan sulfate biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022923", "resource": "Reactome", "description": "Dermatan sulfate biosynthesis" }, { "id": "R-HSA-2024101", "name": "CS/DS degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2024101", "resource": "Reactome", "description": "CS/DS degradation" }, { "id": "R-HSA-3000178", "name": "ECM proteoglycans", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3000178", "resource": "Reactome", "description": "ECM proteoglycans" }, { "id": "R-HSA-3560783", "name": "Defective B4GALT7 causes EDS, progeroid type", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3560783", "resource": "Reactome", "description": "Defective B4GALT7 causes EDS, progeroid type" }, { "id": "R-HSA-3560801", "name": "Defective B3GAT3 causes JDSSDHD", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3560801", "resource": "Reactome", "description": "Defective B3GAT3 causes JDSSDHD" }, { "id": "R-HSA-3595172", "name": "Defective CHST3 causes SEDCJD", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3595172", "resource": "Reactome", "description": "Defective CHST3 causes SEDCJD" }, { "id": "R-HSA-3595174", "name": "Defective CHST14 causes EDS, musculocontractural type", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3595174", "resource": "Reactome", "description": "Defective CHST14 causes EDS, musculocontractural type" }, { "id": "R-HSA-3595177", "name": "Defective CHSY1 causes TPBS", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3595177", "resource": "Reactome", "description": "Defective CHSY1 causes TPBS" }, { "id": "R-HSA-381426", "name": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381426", "resource": "Reactome", "description": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)" }, { "id": "R-HSA-4420332", "name": "Defective B3GALT6 causes EDSP2 and SEMDJL1", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4420332", "resource": "Reactome", "description": "Defective B3GALT6 causes EDSP2 and SEMDJL1" }, { "id": "R-HSA-8957275", "name": "Post-translational protein phosphorylation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8957275", "resource": "Reactome", "description": "Post-translational protein phosphorylation" } ], "orthologs": [ { "uniprot_canonical_ac": "Q62059-1", "protein_name": "Versican core protein", "gene_name": "Vcan", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MLINMKGILWMCSTLLLTHALHQAKMETSPPVKGSLSGKVVLPCHFSTLPTLPPNYNTSEFLRIKWSKMEVDKNGKDIKETTVLVAQNGNIKIGQDYKGRVSVPTHPDDVGDASLTMVKLRASDAAVYRCDVMYGIEDTQDTMSLAVDGVVFHYRAATSRYTLNFAAAQQACLDIGAVIASPEQLFAAYEDGFEQCDAGWLSDQTVRYPIRAPREGCYGDMMGKEGVRTYGFRSPQETYDVYCYVDHLDGDVFHITAPSKFTFEEAEAECTSRDARLATVGELQAAWRNGFDQCDYGWLSDASVRHPVTVARAQCGGGLLGVRTLYRFENQTCFPLPDSRFDAYCFKPKQNISEATTIEMNILAETSSPSLSKEPHMVPDRATPVIPLATELPIFTTHFPPAGNIVNSEQKSVVYSQAITGRLATESPTTTRNTINSWDLNDSLASGSGPLGMPDISEIKEEELRSTTVISQHATGSQAVITEDTQTHESVSQIEQIEVGPLVTSMEITNHISLKELPEKNKTPYESTEVTLEHTTEMPTVSASPELATTSHYGFTLREDDREDRTLTVRSDQSTRVFSQIPEVITVSKTSEDTTYSQLGDLESISTSTITMLGTDRSLIDKEKEPKTNGKVTEDEFGQSQPTTTFPSQHLTEVELLPYSGDTTSVEGISTVIYPSLQTDVTQGRERTETPRPELKKDPYTVDEIPEKVTKDPFIGKTEEVFSGMPLSTSSSESSVERTESVSPALTIEKLTGKPTEARDVEEMTTLTRLETDVTKSDKDVTRVHLTHSTLNVEVVTVSKWPGDEDNSTSKPLPSTEHAGFTKLPPVPLSTIGINGKDKEIPSFTDGGGEYTLFPDGTPKPLEKVSEEDLASGELTVTFHTSTSIGSAEKSASGEPTTGDRFLPTTSTEDQVINATAEGSALGEDTEASKPLFTGPPFVHTSDVEELAFVNYSSTQEPTTYVDISHTSPLSIIPKTEWSVLETSVPLEDEILGKSDQDILEQTHLEATMSPGALRTTGVSQGETQEEPQTPGSPFPTFSSTAVMAKETTAFEEGEGSTYTPSEGRLMTGSERVPGLETTPVGTSYPPGAITDQEVEMDTMVTLMSTIRPTVVSSTESEVIYEAEGSSPTEFASTLRPFQTHVTQLMEETTEEGKKASLDYTDLGSGLFEPRATELPKFPSTPSDISVFTAIDSLHRTPPLSPSSSFTEEQRVFEEESSEKTTGDILPGESVTQHPVTTLIDIVAMKTESDIDHMTSKPPVTQPTRPSVVERKTTSKTQELSTSTPAAGTKFHPDINVYIIEVRENKTGRLSDMIVSGHPIDSESKEEEPCSEETDPLHDLFAEILPELPDSFEIDIYHSEEDEDGEEDCVNATDVTTTPSVQYINGKQLVTTVPKDPEAAEARRGQYESVAPSQNFPDSSATDTHQFILAETESSTTMQFKKSKEGTELLEITWKPETYPETPDHVSSGEPDVFPTLSSHDGKTTRWSESITESSPNLENPVHKQPKPVPLFPEESSGEGAIEQASQETILSRATEVALGKETDQSPTLSTSSILSSSVSVNVLEEEPLTLTGISQTDESMSTIESWVEITPSQTVKFSESSSAPIIEGSGEVEENKNKIFNMVTDLPQRDPTDTLSPLDMSKIMITNHHIYIPATIAPLDSKLPSPDARPTTVWNSNSTSEWVSDKSFEGRKKKENEDEEGAVNAAHQGEVRAATERSDHLLLTPELESSNVDASSDLATWEGFILETTPTESEKEMANSTPVFRETIGVANVEAQPFEHSSSSHPRVQEELTTLSGNPPSLFTDLGSGDASTGMELITASLFTLDLESETKVKKELPSTPSPSVEISSSFEPTGLTPSTVLDIEIAGVMSQTSQKTLISEISGKPTSQSGVRDLYTGFPMGEDFSGDFSEYPTVSYPTMKEETVGMGGSDDERVRDTQTSSSIPTTSDNIYPVPDSKGPDSTVASTTAFPWEEVMSSAEGSGEQLASVRSSVGPVLPLAVDIFSGTESPYFDEEFEEVAAVTEANERPTVLPTAASGNTVDLTENGYIEVNSTMSLDFPQTMEPSKLWSKPEVNLDKQEIGRETVTKEKAQGQKTFESLHSSFAPEQTILETQSLIETEFQTSDYSMLTTLKTYITNKEVEEEGMSIAHMSTPGPGIKDLESYTTHPEAPGKSHSFSATALVTESGAARSVLMDSSTQEEESIKLFQKGVKLTNKESNADLSFSGLGSGGALPPLPTTSVNLTDMKQIISTLYAETSHMESLGTSILGDKMEDHERMEDVSSNEVRMLISKIGSISQDSTEALDTTLSHTGTEEPTTSTLPFVKLMDLERSPKQDPSGGKRKPKTHRPQTMSGLISNENSSASEAEEGATSPTAFLPQTYSVEMTKHFAPSESQPSDLFNVNSGEGSGEVDTLDLVYTSGTTQASSQGDSMLASHGFLEKHPEVSKTEAGATDVSPTASAMFLHHSEYKSSLYPTSTLPSTEPYKSPSEGIEDGLQDNIQFEGSTLKPSRRKTTESIIIDLDKEDSKDLGLTITESAIVKSLPELTSDKNIIIDIDHTKPVYEYIPGIQTDLDPEIKLESHGSSEESLQVQEKYEGAVTLSPTEESFEGSGDALLAGYTQAIYNESVTPNDGKQAEDISFSFATGIPVSSTETELHTFFPTASTLHIPSKLTTASPEIDKPNIEAISLDDIFESSTLSDGQAIADQSEVISTLGHLEKTQEEYEEKKYGGPSFQPEFFSGVGEVLTDPPAYVSIGSTYLIAQTLTELPNVVRPSDSTHYTEATPEVSSLAELSPQIPSSPFPVYVDNGVSKFPEVPHTSAQPVSTVTSSQKSIESPFKEVHANIEETIKPLGGNVHRTEPPSMSRDPALDVSEDESKHKLLEELETSPTKPETSQDFPNKAKDHIPGETVGMLAGIRTTESEPVITADDMELGGATQQPHSASAAFRVETGMVPQPIQQEPERPTFPSLEINHETHTSLFGESILATSEKQVSQKILDNSNQATVSSTLDLHTAHALSPFSILDNSNETAFLIGISEESVEGTAVYLPGPDLCKTNPCLNGGTCYPTETSYVCTCAPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSALQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAMPKITCMNPSAYQRTYSKKYLKNSSSAKDNSINTSKHEHRWSRRQETRR", "length": 3357 }, "evidence": [ { "id": "45920837", "url": "http://www.informatics.jax.org/homology/45920837", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9ERB4-1", "protein_name": "Versican core protein", "gene_name": "Vcan", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MLINMNGILWMCSTLLLTHALHKAKMEENPPVKGSLSGKVILPCHFSTLPTLPPDYNTSEFLRIKWSKIEVDKNGKDIKETTVLVAQDGNIKIGQDYKGRVSVPTHPDDVGDASLTMVKLRASDAGVYRCDVMYGIEDTQNTMSLAVDGVVFHYRAATSRYTLNFESAQQACLDIGAVIATPEQLFAAYEDGFEQCDAGWLSDQTVRYPIRAPREGCYGDMMGKEGVRTYGFRSPQETYDVYCYVDHLDGDVFHITAPSKFTFEEAEAECANRDARLATVGELHAAWRNGFDQCDYGWLSDASVRHPVTVARAQCGGGLLGVRTLYRFENQTCFPLPDSRFDAYCFKRSPLSIIPKTEWSVSETSVPLEDEVLGKSDQDTLEQTHLEATMSPEALSTIEVTQGETQEEPQTPGIPFPALSSTAVMTKETTAFEEEGEGSTYTLSEDRLMTDSEIVPSLETTPVGTSYPGGAMTQQEVEMDTMVTQMSSIRPTVVLSTEPEVSYEAEGSSPMEFASTLKPFGTQVTQLVEETTEEGKKTPLDYTDLGSGLFEQPRVTELPDFSMTPSDISVFTAIDSLHRTTPLRPPSPFTEEPHIFEKEPSEKTTGDIILPRESVTQHPLTTLMDIIAKKTESDIDHEYHMTSKPPVMQPTRPSVVERKTTSKPQELSTSPPPAGTKFHPDINVYIIEVRENKTGRMSDMVVNGHPIDSESKEEEPCSEETDPLHDLFAEILPELPDSFEIDIYHSEEDEDGEEDCVNATDVTTTPSVQYITGKPHVTTVPKNPEAAEARRGLYESVAPSQNFSNTSATDTHQFIPAETELSTTMQFTKSKEATELLEITWKPETYPETPEHFSSGEPDVFPTLPSHDGKTTKWSEFITESNPNTENPEHKQPKPIPLFPEEFSGEGAIDQASQQTIFSRATEVALGKETDQSPTISTSSIRSGSVSVHALEEDPIALTGISQTDESMSTVESWVEMTPSQTVEFSGSSSAPTIEGSGEVEEYTNKIFNTVTDLPQREPTDTLIPLDMSNIMITDHHIYTPATTAPLDSQLPSTDARPTQFGIQTTTSEWVSSTSFEGRKTEEDKERDTNAAHTGEVQPATERSDRLLLTSELESSNVAASSPLDTWEGFVPETTSTVSEKEMANTTPVFTETSDVANLETQSFEHSSSSQPRVQEELTTLSGKPPLIFMDLGSGDASTDMEFITASSFTLDLESDTKVKKELPSTLSPSVETSSSSEPIGLAPSTVLDIEIVEVMNQTSKKTLISELSGKPTSQAEVRDLYPGLGEDFSGDSSEYPTVSSTTMKEETVGMGGSENERVKDTQTLSSIPPTSDNINPVPDSKGFGSTVASTTAFPWEEFMTSAEGSGEELSSVRSSVSLVLPLGVDILPTTESPYFDQEFEEAAAVTEAGKQSALPIAVSGNTVDLTENRDIEVNSTMSVDLPQTMEPAKLWSKPEVNPEKQEIGSETVTQDKAQGQKSFESLHSSLAPEQTTLESQSLIETEVQTSYYSMLTTMKTYNTNEEVEEEGTSIAHMSTPGPGIKGLESYPTHPEATGKSYSFSASALVTESGPARSVVMDSSTQEEESIKLFQKDMILTHKESNSDLSFSGLGSGEALPPLPTTSVSLTDMGKINSTLYPETSHMESLGTSILGDNHERMKNVSNEVRTLISETGSISQDSTEAPNTTLSDTRTEESTTSPLPFMKLMDTEHSPKQTLRWEEEIQTHRPQTMTGQMTNDNSSVSEAEAAATSAPAFLPETYSVEMTKAFATSPSQTSDLFDANSGEGSGEVDGLDLVYTSRTTQASSQGDSMFASHGFIEKHPEVSRTETGATDGSPTASAMFLHQSEYNESSLYPTSTLPSTVTYESPSEGIADGLQDHIRFEVSTLKPSRRKATESVIIDLDKEDSKDLGLAITESAIVEILPELTSDRNIIIDIDHTKPVYEYIPGIQTDLDSDIPLGSHGSSEESLEVQEKYEATINLSPTEEAFDGSGDALPAGHTQAIYNESVTPSDGKQPEDISFSFATGIPVSSTETELNTFFPTVSTLHIPSKLTTASPEIDKPNIEAISLDDIFESSTLSDGQAIADQSEVISTLGHLEKTQEEYEEKKYGGPSFQPEFFSGVGEVFTDAPAYVSIGRTYSVAQPLTEFPNVVGQSDSTHYTEATSAVSSVTELSPQTPSSPSPVYIDSGVSEFTEVPHKSAQPAPTAASSQKLIEGSFKKVRANIEATIKSLGENDHGTESPSMSPSPALDISEDDSKPKLLEDLETSPTKTETSQDSPNKANDQIPGKTAGILAGIKTTESGPVVTAADDMELGDATQRPHSASAPAAFRVETSMVPQPIPQEPERPTFPSLEINHETHTSLFEESILATSEKQVSQRILDYSNQATVSTLDLNTEHSIPPFSILDNSNETAFLIGISEETVEGTAVYLPGPDLCKTNPCLNGGTCYPTETSYVCTCAPGYSGDQCELDFDECHSNPCRNGATCVDGLNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSALQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAMPKITCMNPSAYQRTYSKKYLKNSSSVKDNSINTSKHEHRWSRRWQETRR", "length": 2738 }, "evidence": [ { "id": "45920837", "url": "http://www.informatics.jax.org/homology/45920837", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 12, "go_terms": [ { "name": "interphotoreceptor matrix", "id": "GO:0033165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033165", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "pmid": "" }, { "name": "endoplasmic reticulum lumen", "id": "GO:0005788", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005788", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "pmid": "" }, { "name": "Golgi lumen", "id": "GO:0005796", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005796", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "pmid": "" }, { "name": "extracellular matrix", "id": "GO:0031012", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031012", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "pmid": "" }, { "name": "synapse", "id": "GO:0045202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045202", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "pmid": "" }, { "name": "lysosomal lumen", "id": "GO:0043202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043202", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "pmid": "" }, { "name": "photoreceptor outer segment", "id": "GO:0001750", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001750", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "pmid": "" }, { "name": "collagen-containing extracellular matrix", "id": "GO:0062023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062023", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "pmid": "" }, { "name": "perineuronal net", "id": "GO:0072534", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072534", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "cell adhesion", "id": "GO:0007155", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007155", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "pmid": "" }, { "name": "central nervous system development", "id": "GO:0007417", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007417", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "pmid": "" }, { "name": "skeletal system development", "id": "GO:0001501", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001501", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "pmid": "" }, { "name": "osteoblast differentiation", "id": "GO:0001649", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001649", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "pmid": "" }, { "name": "positive regulation of neuroblast proliferation", "id": "GO:0002052", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002052", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "pmid": "" }, { "name": "cell recognition", "id": "GO:0008037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008037", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "pmid": "" }, { "name": "glial cell migration", "id": "GO:0008347", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008347", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "pmid": "" }, { "name": "glial cell differentiation", "id": "GO:0010001", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010001", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "pmid": "" }, { "name": "carbohydrate binding", "id": "GO:0030246", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030246", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "pmid": "" }, { "name": "glycosaminoglycan binding", "id": "GO:0005539", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005539", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "pmid": "" }, { "name": "hyaluronic acid binding", "id": "GO:0005540", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005540", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "pmid": "" }, { "name": "extracellular matrix structural constituent conferring compression resistance", "id": "GO:0030021", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030021", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "versican core protein O-glycosylated 1 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-1001 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Ser-1001, MOD:00002~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055082", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055082" } ] }, { "name": "versican core protein O-glycosylated 2 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-1001 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-1001, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055083", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055083" } ] }, { "name": "versican core protein O-glycosylated 3 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-1256 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-1256, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055084", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055084" } ] }, { "name": "versican core protein O-glycosylated 4 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-1256 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Ser-1256, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055085", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055085" } ] }, { "name": "versican core protein O-glycosylated 5 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-1308 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P13611-1, Ser-1308, MOD:00002~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055086", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055086" } ] }, { "name": "versican core protein O-glycosylated 6 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-1315 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Ser-1315, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055087", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055087" } ] }, { "name": "versican core protein O-glycosylated 7 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-1447 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-1447, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055088", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055088" } ] }, { "name": "versican core protein O-glycosylated 8 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-1490 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Ser-1490, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055089", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055089" } ] }, { "name": "versican core protein O-glycosylated 9 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-1742 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G57317CE. Example: UniProtKB:P13611-1, Ser-1742, MOD:00002~GNO:G57317CE. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055090", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055090" } ] }, { "name": "versican core protein O-glycosylated 10 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-1747 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-1747, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055091", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055091" } ] }, { "name": "versican core protein O-glycosylated 11 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-1747 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Ser-1747, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055092", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055092" } ] }, { "name": "versican core protein O-glycosylated 12 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-1758 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-1758, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055093", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055093" } ] }, { "name": "versican core protein O-glycosylated 13 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-1810 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-1810, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055094", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055094" } ] }, { "name": "versican core protein O-glycosylated 14 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-1810 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Ser-1810, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055095", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055095" } ] }, { "name": "versican core protein O-glycosylated 15 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-1810 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P13611-1, Ser-1810, MOD:00002~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055096", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055096" } ] }, { "name": "versican core protein O-glycosylated 16 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-1811 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-1811, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055097", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055097" } ] }, { "name": "versican core protein O-glycosylated 17 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-1853 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Ser-1853, MOD:00002~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055098", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055098" } ] }, { "name": "versican core protein O-glycosylated 18 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-1853 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-1853, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055099", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055099" } ] }, { "name": "versican core protein O-glycosylated 19 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-1942 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-1942, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055100", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055100" } ] }, { "name": "versican core protein O-glycosylated 20 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-1942 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P13611-1, Ser-1942, MOD:00002~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055101", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055101" } ] }, { "name": "versican core protein O-glycosylated 21 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2020 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-2020, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055102", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055102" } ] }, { "name": "versican core protein O-glycosylated 22 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2021 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Ser-2021, MOD:00002~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055103", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055103" } ] }, { "name": "versican core protein O-glycosylated 23 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2021 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-2021, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055104", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055104" } ] }, { "name": "versican core protein O-glycosylated 24 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2034 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Ser-2034, MOD:00002~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055105", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055105" } ] }, { "name": "versican core protein O-glycosylated 25 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2039 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-2039, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055106", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055106" } ] }, { "name": "versican core protein O-glycosylated 26 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2215 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-2215, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055107", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055107" } ] }, { "name": "versican core protein O-glycosylated 27 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2215 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Ser-2215, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055108", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055108" } ] }, { "name": "versican core protein O-glycosylated 28 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2294 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-2294, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055109", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055109" } ] }, { "name": "versican core protein O-glycosylated 29 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2456 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Ser-2456, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055110", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055110" } ] }, { "name": "versican core protein O-glycosylated 30 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2456 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P13611-1, Ser-2456, MOD:00002~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055111", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055111" } ] }, { "name": "versican core protein O-glycosylated 31 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2515 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-2515, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055112", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055112" } ] }, { "name": "versican core protein O-glycosylated 32 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2572 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-2572, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055113", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055113" } ] }, { "name": "versican core protein O-glycosylated 33 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2661 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Ser-2661, MOD:00002~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055114", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055114" } ] }, { "name": "versican core protein O-glycosylated 34 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2661 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-2661, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055115", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055115" } ] }, { "name": "versican core protein O-glycosylated 35 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2699 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Ser-2699, MOD:00002~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055116", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055116" } ] }, { "name": "versican core protein O-glycosylated 36 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2723 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Ser-2723, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055117", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055117" } ] }, { "name": "versican core protein O-glycosylated 37 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2760 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-2760, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055118", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055118" } ] }, { "name": "versican core protein O-glycosylated 38 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2767 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-2767, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055119", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055119" } ] }, { "name": "versican core protein O-glycosylated 39 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2791 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Ser-2791, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055120", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055120" } ] }, { "name": "versican core protein O-glycosylated 40 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2826 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-2826, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055121", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055121" } ] }, { "name": "versican core protein O-glycosylated 41 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2826 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Ser-2826, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055122", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055122" } ] }, { "name": "versican core protein O-glycosylated 42 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2827 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Ser-2827, MOD:00002~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055123", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055123" } ] }, { "name": "versican core protein O-glycosylated 43 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2827 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-2827, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055124", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055124" } ] }, { "name": "versican core protein O-glycosylated 44 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2827 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Ser-2827, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055125", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055125" } ] }, { "name": "versican core protein O-glycosylated 45 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2847 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G27391WQ. Example: UniProtKB:P13611-1, Ser-2847, MOD:00002~GNO:G27391WQ. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055126", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055126" } ] }, { "name": "versican core protein O-glycosylated 46 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2847 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-2847, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055127", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055127" } ] }, { "name": "versican core protein O-glycosylated 47 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2847 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Ser-2847, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055128", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055128" } ] }, { "name": "versican core protein O-glycosylated 48 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2847 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P13611-1, Ser-2847, MOD:00002~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055129", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055129" } ] }, { "name": "versican core protein O-glycosylated 49 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2856 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Ser-2856, MOD:00002~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055130", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055130" } ] }, { "name": "versican core protein O-glycosylated 50 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2856 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-2856, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055131", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055131" } ] }, { "name": "versican core protein O-glycosylated 51 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2856 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Ser-2856, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055132", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055132" } ] }, { "name": "versican core protein O-glycosylated 52 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2856 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P13611-1, Ser-2856, MOD:00002~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055133", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055133" } ] }, { "name": "versican core protein O-glycosylated 53 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2857 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G27391WQ. Example: UniProtKB:P13611-1, Ser-2857, MOD:00002~GNO:G27391WQ. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055134", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055134" } ] }, { "name": "versican core protein O-glycosylated 54 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2857 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Ser-2857, MOD:00002~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055135", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055135" } ] }, { "name": "versican core protein O-glycosylated 55 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2857 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-2857, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055136", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055136" } ] }, { "name": "versican core protein O-glycosylated 56 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2860 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-2860, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055137", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055137" } ] }, { "name": "versican core protein O-glycosylated 57 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2879 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Ser-2879, MOD:00002~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055138", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055138" } ] }, { "name": "versican core protein O-glycosylated 58 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2879 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-2879, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055139", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055139" } ] }, { "name": "versican core protein O-glycosylated 59 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2879 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Ser-2879, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055140", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055140" } ] }, { "name": "versican core protein O-glycosylated 60 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2879 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G57317CE. Example: UniProtKB:P13611-1, Ser-2879, MOD:00002~GNO:G57317CE. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055141", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055141" } ] }, { "name": "versican core protein O-glycosylated 61 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2893 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-2893, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055142", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055142" } ] }, { "name": "versican core protein O-glycosylated 62 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2977 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G57317CE. Example: UniProtKB:P13611-1, Ser-2977, MOD:00002~GNO:G57317CE. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055143", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055143" } ] }, { "name": "versican core protein O-glycosylated 63 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2981 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-2981, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055144", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055144" } ] }, { "name": "versican core protein O-glycosylated 64 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2999 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-2999, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055145", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055145" } ] }, { "name": "versican core protein O-glycosylated 65 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2999 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G57317CE. Example: UniProtKB:P13611-1, Ser-2999, MOD:00002~GNO:G57317CE. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055146", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055146" } ] }, { "name": "versican core protein O-glycosylated 66 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-2999 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P13611-1, Ser-2999, MOD:00002~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055147", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055147" } ] }, { "name": "versican core protein O-glycosylated 67 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-3005 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-3005, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055148", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055148" } ] }, { "name": "versican core protein O-glycosylated 68 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-3005 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Ser-3005, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055149", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055149" } ] }, { "name": "versican core protein O-glycosylated 69 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-3005 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G57317CE. Example: UniProtKB:P13611-1, Ser-3005, MOD:00002~GNO:G57317CE. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055150", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055150" } ] }, { "name": "versican core protein O-glycosylated 70 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-3005 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G73004SD. Example: UniProtKB:P13611-1, Ser-3005, MOD:00002~GNO:G73004SD. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055151", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055151" } ] }, { "name": "versican core protein O-glycosylated 71 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-3005 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G88713AC. Example: UniProtKB:P13611-1, Ser-3005, MOD:00002~GNO:G88713AC. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055152", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055152" } ] }, { "name": "versican core protein O-glycosylated 72 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-3006 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Ser-3006, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055153", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055153" } ] }, { "name": "versican core protein O-glycosylated 73 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-3029 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-3029, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055154", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055154" } ] }, { "name": "versican core protein O-glycosylated 74 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-364 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-364, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055155", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055155" } ] }, { "name": "versican core protein O-glycosylated 75 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-440 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-440, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055156", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055156" } ] }, { "name": "versican core protein O-glycosylated 76 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-442 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-442, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055157", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055157" } ] }, { "name": "versican core protein O-glycosylated 77 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-566 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Ser-566, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055158", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055158" } ] }, { "name": "versican core protein O-glycosylated 78 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-569 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G57317CE. Example: UniProtKB:P13611-1, Ser-569, MOD:00002~GNO:G57317CE. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055159", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055159" } ] }, { "name": "versican core protein O-glycosylated 79 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-586 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-586, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055160", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055160" } ] }, { "name": "versican core protein O-glycosylated 80 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-727 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Ser-727, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055161", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055161" } ] }, { "name": "versican core protein O-glycosylated 81 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-989 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Ser-989, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055162", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055162" } ] }, { "name": "versican core protein O-glycosylated 82 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-989 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Ser-989, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055163", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055163" } ] }, { "name": "versican core protein O-glycosylated 83 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Ser-989 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G57317CE. Example: UniProtKB:P13611-1, Ser-989, MOD:00002~GNO:G57317CE. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055164", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055164" } ] }, { "name": "versican core protein O-glycosylated 84 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1015 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1015, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055165", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055165" } ] }, { "name": "versican core protein O-glycosylated 85 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1023 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-1023, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055166", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055166" } ] }, { "name": "versican core protein O-glycosylated 86 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1027 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1027, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055167", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055167" } ] }, { "name": "versican core protein O-glycosylated 87 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1030 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1030, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055168", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055168" } ] }, { "name": "versican core protein O-glycosylated 88 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1030 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-1030, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055169", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055169" } ] }, { "name": "versican core protein O-glycosylated 89 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1031 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1031, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055170", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055170" } ] }, { "name": "versican core protein O-glycosylated 90 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1041 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1041, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055171", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055171" } ] }, { "name": "versican core protein O-glycosylated 91 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1052 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1052, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055172", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055172" } ] }, { "name": "versican core protein O-glycosylated 92 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1074 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1074, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055173", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055173" } ] }, { "name": "versican core protein O-glycosylated 93 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1261 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Thr-1261, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055174", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055174" } ] }, { "name": "versican core protein O-glycosylated 94 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1261 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1261, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055175", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055175" } ] }, { "name": "versican core protein O-glycosylated 95 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1262 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1262, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055176", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055176" } ] }, { "name": "versican core protein O-glycosylated 96 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1271 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1271, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055177", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055177" } ] }, { "name": "versican core protein O-glycosylated 97 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1291 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Thr-1291, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055178", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055178" } ] }, { "name": "versican core protein O-glycosylated 98 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1291 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1291, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055179", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055179" } ] }, { "name": "versican core protein O-glycosylated 99 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1291 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-1291, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055180", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055180" } ] }, { "name": "versican core protein O-glycosylated 100 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1295 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1295, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055181", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055181" } ] }, { "name": "versican core protein O-glycosylated 101 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1309 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Thr-1309, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055182", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055182" } ] }, { "name": "versican core protein O-glycosylated 102 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1309 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1309, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055183", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055183" } ] }, { "name": "versican core protein O-glycosylated 103 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1316 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1316, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055184", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055184" } ] }, { "name": "versican core protein O-glycosylated 104 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1403 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-1403, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055185", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055185" } ] }, { "name": "versican core protein O-glycosylated 105 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1404 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-1404, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055186", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055186" } ] }, { "name": "versican core protein O-glycosylated 106 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1418 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-1418, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055187", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055187" } ] }, { "name": "versican core protein O-glycosylated 107 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1451 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Thr-1451, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055188", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055188" } ] }, { "name": "versican core protein O-glycosylated 108 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1451 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1451, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055189", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055189" } ] }, { "name": "versican core protein O-glycosylated 109 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1473 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G57317CE. Example: UniProtKB:P13611-1, Thr-1473, MOD:00005~GNO:G57317CE. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055190", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055190" } ] }, { "name": "versican core protein O-glycosylated 110 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1474 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-1474, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055191", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055191" } ] }, { "name": "versican core protein O-glycosylated 111 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1480 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1480, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055192", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055192" } ] }, { "name": "versican core protein O-glycosylated 112 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1503 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1503, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055193", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055193" } ] }, { "name": "versican core protein O-glycosylated 113 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1503 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-1503, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055194", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055194" } ] }, { "name": "versican core protein O-glycosylated 114 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1537 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1537, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055195", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055195" } ] }, { "name": "versican core protein O-glycosylated 115 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1537 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-1537, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055196", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055196" } ] }, { "name": "versican core protein O-glycosylated 116 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1566 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1566, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055197", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055197" } ] }, { "name": "versican core protein O-glycosylated 117 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1569 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1569, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055198", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055198" } ] }, { "name": "versican core protein O-glycosylated 118 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1602 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Thr-1602, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055199", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055199" } ] }, { "name": "versican core protein O-glycosylated 119 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1602 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1602, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055200", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055200" } ] }, { "name": "versican core protein O-glycosylated 120 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1615 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1615, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055201", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055201" } ] }, { "name": "versican core protein O-glycosylated 121 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1654 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1654, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055202", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055202" } ] }, { "name": "versican core protein O-glycosylated 122 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1665 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1665, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055203", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055203" } ] }, { "name": "versican core protein O-glycosylated 123 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1687 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G73004SD. Example: UniProtKB:P13611-1, Thr-1687, MOD:00005~GNO:G73004SD. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055204", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055204" } ] }, { "name": "versican core protein O-glycosylated 124 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1688 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1688, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055205", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055205" } ] }, { "name": "versican core protein O-glycosylated 125 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1734 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1734, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055206", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055206" } ] }, { "name": "versican core protein O-glycosylated 126 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1734 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-1734, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055207", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055207" } ] }, { "name": "versican core protein O-glycosylated 127 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1734 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P13611-1, Thr-1734, MOD:00005~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055208", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055208" } ] }, { "name": "versican core protein O-glycosylated 128 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1734 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G88713AC. Example: UniProtKB:P13611-1, Thr-1734, MOD:00005~GNO:G88713AC. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055209", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055209" } ] }, { "name": "versican core protein O-glycosylated 129 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1806 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-1806, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055210", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055210" } ] }, { "name": "versican core protein O-glycosylated 130 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1806 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G57317CE. Example: UniProtKB:P13611-1, Thr-1806, MOD:00005~GNO:G57317CE. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055211", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055211" } ] }, { "name": "versican core protein O-glycosylated 131 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1806 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G73004SD. Example: UniProtKB:P13611-1, Thr-1806, MOD:00005~GNO:G73004SD. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055212", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055212" } ] }, { "name": "versican core protein O-glycosylated 132 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1807 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1807, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055213", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055213" } ] }, { "name": "versican core protein O-glycosylated 133 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1847 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G57317CE. Example: UniProtKB:P13611-1, Thr-1847, MOD:00005~GNO:G57317CE. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055214", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055214" } ] }, { "name": "versican core protein O-glycosylated 134 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1848 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-1848, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055215", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055215" } ] }, { "name": "versican core protein O-glycosylated 135 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1880 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1880, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055216", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055216" } ] }, { "name": "versican core protein O-glycosylated 136 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1926 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1926, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055217", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055217" } ] }, { "name": "versican core protein O-glycosylated 137 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1943 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Thr-1943, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055218", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055218" } ] }, { "name": "versican core protein O-glycosylated 138 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1943 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1943, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055219", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055219" } ] }, { "name": "versican core protein O-glycosylated 139 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1973 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-1973, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055220", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055220" } ] }, { "name": "versican core protein O-glycosylated 140 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-1996 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-1996, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055221", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055221" } ] }, { "name": "versican core protein O-glycosylated 141 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2017 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G57317CE. Example: UniProtKB:P13611-1, Thr-2017, MOD:00005~GNO:G57317CE. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055222", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055222" } ] }, { "name": "versican core protein O-glycosylated 142 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2036 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Thr-2036, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055223", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055223" } ] }, { "name": "versican core protein O-glycosylated 143 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2036 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2036, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055224", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055224" } ] }, { "name": "versican core protein O-glycosylated 144 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2036 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-2036, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055225", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055225" } ] }, { "name": "versican core protein O-glycosylated 145 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2036 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G57317CE. Example: UniProtKB:P13611-1, Thr-2036, MOD:00005~GNO:G57317CE. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055226", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055226" } ] }, { "name": "versican core protein O-glycosylated 146 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2050 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Thr-2050, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055227", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055227" } ] }, { "name": "versican core protein O-glycosylated 147 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2050 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2050, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055228", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055228" } ] }, { "name": "versican core protein O-glycosylated 148 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2069 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2069, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055229", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055229" } ] }, { "name": "versican core protein O-glycosylated 149 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2083 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Thr-2083, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055230", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055230" } ] }, { "name": "versican core protein O-glycosylated 150 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2083 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2083, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055231", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055231" } ] }, { "name": "versican core protein O-glycosylated 151 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2083 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-2083, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055232", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055232" } ] }, { "name": "versican core protein O-glycosylated 152 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2083 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G57317CE. Example: UniProtKB:P13611-1, Thr-2083, MOD:00005~GNO:G57317CE. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055233", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055233" } ] }, { "name": "versican core protein O-glycosylated 153 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2083 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G88713AC. Example: UniProtKB:P13611-1, Thr-2083, MOD:00005~GNO:G88713AC. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055234", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055234" } ] }, { "name": "versican core protein O-glycosylated 154 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2086 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2086, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055235", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055235" } ] }, { "name": "versican core protein O-glycosylated 155 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2135 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2135, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055236", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055236" } ] }, { "name": "versican core protein O-glycosylated 156 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2135 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-2135, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055237", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055237" } ] }, { "name": "versican core protein O-glycosylated 157 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2135 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G57317CE. Example: UniProtKB:P13611-1, Thr-2135, MOD:00005~GNO:G57317CE. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055238", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055238" } ] }, { "name": "versican core protein O-glycosylated 158 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2135 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G73004SD. Example: UniProtKB:P13611-1, Thr-2135, MOD:00005~GNO:G73004SD. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055239", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055239" } ] }, { "name": "versican core protein O-glycosylated 159 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2135 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G88713AC. Example: UniProtKB:P13611-1, Thr-2135, MOD:00005~GNO:G88713AC. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055240", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055240" } ] }, { "name": "versican core protein O-glycosylated 160 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2144 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2144, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055241", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055241" } ] }, { "name": "versican core protein O-glycosylated 161 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2144 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P13611-1, Thr-2144, MOD:00005~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055242", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055242" } ] }, { "name": "versican core protein O-glycosylated 162 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2152 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2152, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055243", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055243" } ] }, { "name": "versican core protein O-glycosylated 163 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2152 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-2152, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055244", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055244" } ] }, { "name": "versican core protein O-glycosylated 164 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2152 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G73004SD. Example: UniProtKB:P13611-1, Thr-2152, MOD:00005~GNO:G73004SD. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055245", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055245" } ] }, { "name": "versican core protein O-glycosylated 165 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2153 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2153, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055246", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055246" } ] }, { "name": "versican core protein O-glycosylated 166 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2194 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P13611-1, Thr-2194, MOD:00005~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055247", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055247" } ] }, { "name": "versican core protein O-glycosylated 167 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2213 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Thr-2213, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055248", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055248" } ] }, { "name": "versican core protein O-glycosylated 168 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2213 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2213, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055249", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055249" } ] }, { "name": "versican core protein O-glycosylated 169 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2213 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-2213, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055250", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055250" } ] }, { "name": "versican core protein O-glycosylated 170 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2213 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P13611-1, Thr-2213, MOD:00005~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055251", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055251" } ] }, { "name": "versican core protein O-glycosylated 171 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2328 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G57317CE. Example: UniProtKB:P13611-1, Thr-2328, MOD:00005~GNO:G57317CE. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055252", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055252" } ] }, { "name": "versican core protein O-glycosylated 172 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2330 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2330, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055253", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055253" } ] }, { "name": "versican core protein O-glycosylated 173 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2330 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-2330, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055254", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055254" } ] }, { "name": "versican core protein O-glycosylated 174 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2330 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G57317CE. Example: UniProtKB:P13611-1, Thr-2330, MOD:00005~GNO:G57317CE. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055255", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055255" } ] }, { "name": "versican core protein O-glycosylated 175 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2330 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P13611-1, Thr-2330, MOD:00005~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055256", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055256" } ] }, { "name": "versican core protein O-glycosylated 176 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2330 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G73004SD. Example: UniProtKB:P13611-1, Thr-2330, MOD:00005~GNO:G73004SD. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055257", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055257" } ] }, { "name": "versican core protein O-glycosylated 177 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2331 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2331, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055258", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055258" } ] }, { "name": "versican core protein O-glycosylated 178 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2331 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-2331, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055259", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055259" } ] }, { "name": "versican core protein O-glycosylated 179 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2345 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2345, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055260", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055260" } ] }, { "name": "versican core protein O-glycosylated 180 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2394 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-2394, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055261", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055261" } ] }, { "name": "versican core protein O-glycosylated 181 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2394 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G57317CE. Example: UniProtKB:P13611-1, Thr-2394, MOD:00005~GNO:G57317CE. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055262", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055262" } ] }, { "name": "versican core protein O-glycosylated 182 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2394 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G73004SD. Example: UniProtKB:P13611-1, Thr-2394, MOD:00005~GNO:G73004SD. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055263", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055263" } ] }, { "name": "versican core protein O-glycosylated 183 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2394 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G88713AC. Example: UniProtKB:P13611-1, Thr-2394, MOD:00005~GNO:G88713AC. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055264", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055264" } ] }, { "name": "versican core protein O-glycosylated 184 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2395 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G27391WQ. Example: UniProtKB:P13611-1, Thr-2395, MOD:00005~GNO:G27391WQ. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055265", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055265" } ] }, { "name": "versican core protein O-glycosylated 185 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2395 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Thr-2395, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055266", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055266" } ] }, { "name": "versican core protein O-glycosylated 186 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2395 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2395, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055267", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055267" } ] }, { "name": "versican core protein O-glycosylated 187 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2395 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-2395, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055268", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055268" } ] }, { "name": "versican core protein O-glycosylated 188 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2395 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P13611-1, Thr-2395, MOD:00005~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055269", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055269" } ] }, { "name": "versican core protein O-glycosylated 189 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2396 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Thr-2396, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055270", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055270" } ] }, { "name": "versican core protein O-glycosylated 190 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2396 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2396, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055271", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055271" } ] }, { "name": "versican core protein O-glycosylated 191 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2457 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2457, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055272", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055272" } ] }, { "name": "versican core protein O-glycosylated 192 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2457 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-2457, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055273", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055273" } ] }, { "name": "versican core protein O-glycosylated 193 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2503 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2503, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055274", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055274" } ] }, { "name": "versican core protein O-glycosylated 194 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2505 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Thr-2505, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055275", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055275" } ] }, { "name": "versican core protein O-glycosylated 195 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2505 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2505, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055276", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055276" } ] }, { "name": "versican core protein O-glycosylated 196 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2540 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2540, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055277", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055277" } ] }, { "name": "versican core protein O-glycosylated 197 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2559 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2559, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055278", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055278" } ] }, { "name": "versican core protein O-glycosylated 198 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2559 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-2559, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055279", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055279" } ] }, { "name": "versican core protein O-glycosylated 199 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2559 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G57317CE. Example: UniProtKB:P13611-1, Thr-2559, MOD:00005~GNO:G57317CE. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055280", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055280" } ] }, { "name": "versican core protein O-glycosylated 200 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2559 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P13611-1, Thr-2559, MOD:00005~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055281", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055281" } ] }, { "name": "versican core protein O-glycosylated 201 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2571 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-2571, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055282", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055282" } ] }, { "name": "versican core protein O-glycosylated 202 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2583 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2583, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055283", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055283" } ] }, { "name": "versican core protein O-glycosylated 203 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2671 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-2671, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055284", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055284" } ] }, { "name": "versican core protein O-glycosylated 204 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2672 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2672, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055285", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055285" } ] }, { "name": "versican core protein O-glycosylated 205 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2691 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Thr-2691, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055286", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055286" } ] }, { "name": "versican core protein O-glycosylated 206 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2691 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2691, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055287", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055287" } ] }, { "name": "versican core protein O-glycosylated 207 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2691 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P13611-1, Thr-2691, MOD:00005~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055288", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055288" } ] }, { "name": "versican core protein O-glycosylated 208 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2701 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Thr-2701, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055289", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055289" } ] }, { "name": "versican core protein O-glycosylated 209 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2701 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2701, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055290", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055290" } ] }, { "name": "versican core protein O-glycosylated 210 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2724 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Thr-2724, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055291", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055291" } ] }, { "name": "versican core protein O-glycosylated 211 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2724 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2724, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055292", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055292" } ] }, { "name": "versican core protein O-glycosylated 212 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2740 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2740, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055293", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055293" } ] }, { "name": "versican core protein O-glycosylated 213 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2784 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-2784, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055294", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055294" } ] }, { "name": "versican core protein O-glycosylated 214 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2793 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2793, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055295", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055295" } ] }, { "name": "versican core protein O-glycosylated 215 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2811 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2811, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055296", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055296" } ] }, { "name": "versican core protein O-glycosylated 216 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2830 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2830, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055297", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055297" } ] }, { "name": "versican core protein O-glycosylated 217 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2830 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P13611-1, Thr-2830, MOD:00005~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055298", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055298" } ] }, { "name": "versican core protein O-glycosylated 218 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2875 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2875, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055299", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055299" } ] }, { "name": "versican core protein O-glycosylated 219 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2887 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2887, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055300", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055300" } ] }, { "name": "versican core protein O-glycosylated 220 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2936 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Thr-2936, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055301", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055301" } ] }, { "name": "versican core protein O-glycosylated 221 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2936 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2936, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055302", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055302" } ] }, { "name": "versican core protein O-glycosylated 222 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2958 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G57317CE. Example: UniProtKB:P13611-1, Thr-2958, MOD:00005~GNO:G57317CE. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055303", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055303" } ] }, { "name": "versican core protein O-glycosylated 223 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2978 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-2978, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055304", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055304" } ] }, { "name": "versican core protein O-glycosylated 224 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2983 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Thr-2983, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055305", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055305" } ] }, { "name": "versican core protein O-glycosylated 225 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2983 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-2983, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055306", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055306" } ] }, { "name": "versican core protein O-glycosylated 226 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2983 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-2983, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055307", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055307" } ] }, { "name": "versican core protein O-glycosylated 227 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-2983 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P13611-1, Thr-2983, MOD:00005~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055308", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055308" } ] }, { "name": "versican core protein O-glycosylated 228 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-3003 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Thr-3003, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055309", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055309" } ] }, { "name": "versican core protein O-glycosylated 229 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-3003 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-3003, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055310", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055310" } ] }, { "name": "versican core protein O-glycosylated 230 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-3003 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-3003, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055311", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055311" } ] }, { "name": "versican core protein O-glycosylated 231 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-3003 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G57317CE. Example: UniProtKB:P13611-1, Thr-3003, MOD:00005~GNO:G57317CE. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055312", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055312" } ] }, { "name": "versican core protein O-glycosylated 232 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-3003 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P13611-1, Thr-3003, MOD:00005~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055313", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055313" } ] }, { "name": "versican core protein O-glycosylated 233 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-3003 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G73004SD. Example: UniProtKB:P13611-1, Thr-3003, MOD:00005~GNO:G73004SD. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055314", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055314" } ] }, { "name": "versican core protein O-glycosylated 234 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-3003 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G88713AC. Example: UniProtKB:P13611-1, Thr-3003, MOD:00005~GNO:G88713AC. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055315", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055315" } ] }, { "name": "versican core protein O-glycosylated 235 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-3014 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Thr-3014, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055316", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055316" } ] }, { "name": "versican core protein O-glycosylated 236 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-3014 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-3014, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055317", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055317" } ] }, { "name": "versican core protein O-glycosylated 237 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-3025 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Thr-3025, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055318", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055318" } ] }, { "name": "versican core protein O-glycosylated 238 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-3025 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-3025, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055319", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055319" } ] }, { "name": "versican core protein O-glycosylated 239 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-3045 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-3045, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055320", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055320" } ] }, { "name": "versican core protein O-glycosylated 240 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-3083 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Thr-3083, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055321", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055321" } ] }, { "name": "versican core protein O-glycosylated 241 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-3083 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-3083, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055322", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055322" } ] }, { "name": "versican core protein O-glycosylated 242 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-362 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-362, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055323", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055323" } ] }, { "name": "versican core protein O-glycosylated 243 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-393 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-393, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055324", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055324" } ] }, { "name": "versican core protein O-glycosylated 244 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-464 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-464, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055325", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055325" } ] }, { "name": "versican core protein O-glycosylated 245 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-471 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Thr-471, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055326", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055326" } ] }, { "name": "versican core protein O-glycosylated 246 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-471 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-471, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055327", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055327" } ] }, { "name": "versican core protein O-glycosylated 247 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-500 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-500, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055328", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055328" } ] }, { "name": "versican core protein O-glycosylated 248 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-51 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-51, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055329", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055329" } ] }, { "name": "versican core protein O-glycosylated 249 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-544 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-544, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055330", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055330" } ] }, { "name": "versican core protein O-glycosylated 250 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-544 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-544, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055331", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055331" } ] }, { "name": "versican core protein O-glycosylated 251 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-544 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G73004SD. Example: UniProtKB:P13611-1, Thr-544, MOD:00005~GNO:G73004SD. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055332", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055332" } ] }, { "name": "versican core protein O-glycosylated 252 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-544 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G88713AC. Example: UniProtKB:P13611-1, Thr-544, MOD:00005~GNO:G88713AC. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055333", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055333" } ] }, { "name": "versican core protein O-glycosylated 253 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-545 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-545, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055334", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055334" } ] }, { "name": "versican core protein O-glycosylated 254 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-551 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-551, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055335", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055335" } ] }, { "name": "versican core protein O-glycosylated 255 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-563 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-563, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055336", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055336" } ] }, { "name": "versican core protein O-glycosylated 256 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-563 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-563, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055337", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055337" } ] }, { "name": "versican core protein O-glycosylated 257 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-570 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-570, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055338", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055338" } ] }, { "name": "versican core protein O-glycosylated 258 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-589 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-589, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055339", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055339" } ] }, { "name": "versican core protein O-glycosylated 259 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-627 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-627, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055340", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055340" } ] }, { "name": "versican core protein O-glycosylated 260 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-632 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-632, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055341", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055341" } ] }, { "name": "versican core protein O-glycosylated 261 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-642 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-642, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055342", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055342" } ] }, { "name": "versican core protein O-glycosylated 262 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-642 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P13611-1, Thr-642, MOD:00005~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055343", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055343" } ] }, { "name": "versican core protein O-glycosylated 263 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-651 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-651, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055344", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055344" } ] }, { "name": "versican core protein O-glycosylated 264 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-670 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-670, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055345", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055345" } ] }, { "name": "versican core protein O-glycosylated 265 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-689 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-689, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055346", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055346" } ] }, { "name": "versican core protein O-glycosylated 266 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-716 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-716, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055347", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055347" } ] }, { "name": "versican core protein O-glycosylated 267 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-728 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-728, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055348", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055348" } ] }, { "name": "versican core protein O-glycosylated 268 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-737 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-737, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055349", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055349" } ] }, { "name": "versican core protein O-glycosylated 269 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-855 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Thr-855, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055350", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055350" } ] }, { "name": "versican core protein O-glycosylated 270 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-855 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-855, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055351", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055351" } ] }, { "name": "versican core protein O-glycosylated 271 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-861 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P13611-1, Thr-861, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055352", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055352" } ] }, { "name": "versican core protein O-glycosylated 272 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-869 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P13611-1, Thr-869, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055353", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055353" } ] }, { "name": "versican core protein O-glycosylated 273 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-869 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-869, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055354", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055354" } ] }, { "name": "versican core protein O-glycosylated 274 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-886 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-886, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055355", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055355" } ] }, { "name": "versican core protein O-glycosylated 275 (human)", "definition": "A versican core protein (human) that has been O-glycosylated at the residue equivalent to Thr-939 of the amino acid sequence represented by UniProtKB:P13611-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P13611-1, Thr-939, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000055356", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000055356" } ] } ], "site_annotation": [ { "start_pos": 1332, "end_pos": 1334, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1398, "end_pos": 1400, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1442, "end_pos": 1444, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1468, "end_pos": 1470, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1663, "end_pos": 1665, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1898, "end_pos": 1900, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2179, "end_pos": 2181, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2272, "end_pos": 2274, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2280, "end_pos": 2282, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2360, "end_pos": 2362, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2385, "end_pos": 2387, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2392, "end_pos": 2394, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2496, "end_pos": 2498, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2628, "end_pos": 2630, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2934, "end_pos": 2936, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3067, "end_pos": 3069, "annotation": "n_glycosylation_sequon" }, { "start_pos": 330, "end_pos": 332, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3369, "end_pos": 3371, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3379, "end_pos": 3381, "annotation": "n_glycosylation_sequon" }, { "start_pos": 57, "end_pos": 59, "annotation": "n_glycosylation_sequon" }, { "start_pos": 615, "end_pos": 617, "annotation": "n_glycosylation_sequon" }, { "start_pos": 782, "end_pos": 784, "annotation": "n_glycosylation_sequon" }, { "start_pos": 809, "end_pos": 811, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated by FAM20C in the extracellular medium.", "evidence": [ { "database": "UniProtKB", "id": "P13611", "url": "https://www.uniprot.org/uniprot/P13611" }, { "database": "PubMed", "id": "26091039", "url": "https://glygen.org/publication/PubMed/26091039" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 57, 330, 615, 782, 809, 1332, 1398, 1442, 1468, 1663, 1898, 2179, 2272, 2280, 2360, 2385, 2392, 2496, 2628, 2934, 3067, 3354, 3369, 3379 ], "o_linked_sites": [ 51, 362, 364, 393, 440, 442, 464, 471, 500, 510, 516, 518, 522, 544, 545, 551, 563, 566, 569, 570, 586, 589, 627, 631, 632, 641, 642, 643, 651, 659, 670, 687, 689, 716, 727, 728, 737, 751, 754, 792, 799, 801, 855, 861, 869, 886, 887, 888, 889, 939, 976, 981, 989, 1001, 1015, 1023, 1027, 1030, 1031, 1039, 1041, 1052, 1074, 1092, 1093, 1098, 1101, 1103, 1110, 1116, 1121, 1123, 1131, 1133, 1191, 1212, 1219, 1220, 1221, 1256, 1261, 1262, 1271, 1291, 1295, 1308, 1309, 1315, 1316, 1403, 1404, 1415, 1418, 1419, 1447, 1451, 1473, 1474, 1480, 1490, 1503, 1537, 1548, 1566, 1569, 1602, 1615, 1631, 1654, 1665, 1687, 1688, 1716, 1719, 1731, 1734, 1742, 1743, 1744, 1747, 1758, 1763, 1765, 1769, 1772, 1775, 1777, 1778, 1780, 1806, 1807, 1810, 1811, 1847, 1848, 1853, 1880, 1909, 1917, 1925, 1926, 1935, 1940, 1942, 1943, 1945, 1959, 1973, 1996, 2017, 2020, 2021, 2034, 2036, 2039, 2050, 2058, 2059, 2063, 2069, 2083, 2085, 2086, 2091, 2135, 2144, 2152, 2153, 2159, 2160, 2194, 2200, 2203, 2213, 2215, 2247, 2254, 2294, 2328, 2330, 2331, 2345, 2394, 2395, 2396, 2406, 2416, 2417, 2422, 2448, 2455, 2456, 2457, 2458, 2473, 2503, 2505, 2509, 2515, 2516, 2526, 2530, 2531, 2540, 2559, 2571, 2572, 2583, 2656, 2661, 2671, 2672, 2691, 2699, 2701, 2722, 2723, 2724, 2740, 2760, 2767, 2781, 2784, 2785, 2791, 2793, 2811, 2826, 2827, 2830, 2847, 2856, 2857, 2860, 2875, 2879, 2887, 2893, 2936, 2941, 2950, 2958, 2977, 2978, 2981, 2983, 2999, 3003, 3005, 3006, 3014, 3024, 3025, 3029, 3045, 3083, 3141 ], "snv_sites": [ 57, 59, 112, 203, 332, 355, 360, 376, 393, 438, 442, 462, 464, 471, 500, 516, 522, 538, 544, 551, 563, 566, 567, 569, 589, 590, 632, 641, 642, 643, 649, 651, 668, 670, 687, 689, 727, 737, 751, 754, 784, 792, 799, 809, 811, 855, 861, 869, 886, 887, 889, 939, 956, 989, 1001, 1008, 1015, 1023, 1027, 1030, 1031, 1052, 1069, 1074, 1092, 1093, 1116, 1121, 1123, 1129, 1140, 1146, 1189, 1212, 1220, 1221, 1256, 1261, 1262, 1271, 1291, 1308, 1309, 1315, 1332, 1334, 1398, 1403, 1404, 1418, 1419, 1442, 1444, 1445, 1449, 1473, 1480, 1537, 1548, 1577, 1602, 1615, 1616, 1631, 1633, 1654, 1688, 1710, 1716, 1719, 1731, 1734, 1743, 1744, 1747, 1758, 1763, 1778, 1806, 1810, 1811, 1847, 1848, 1880, 1917, 1933, 1935, 1943, 1945, 1973, 1996, 2017, 2020, 2021, 2034, 2036, 2039, 2058, 2063, 2069, 2091, 2112, 2133, 2135, 2144, 2153, 2159, 2160, 2181, 2194, 2200, 2203, 2213, 2254, 2274, 2280, 2282, 2304, 2337, 2345, 2353, 2360, 2362, 2384, 2385, 2394, 2395, 2396, 2416, 2417, 2448, 2455, 2456, 2458, 2462, 2473, 2496, 2498, 2503, 2515, 2516, 2530, 2540, 2571, 2572, 2610, 2615, 2628, 2652, 2656, 2661, 2671, 2691, 2699, 2701, 2723, 2733, 2760, 2781, 2785, 2791, 2793, 2809, 2811, 2826, 2827, 2830, 2847, 2856, 2860, 2875, 2879, 2934, 2958, 2977, 2981, 3003, 3006, 3023, 3024, 3025, 3029, 3045, 3069, 3083, 3102, 3255, 3355, 3368, 3369, 3371, 3378, 3379, 3381 ], "glycation_sites": [], "phosphorylation_sites": [ 2086, 2099, 2112, 2116, 2608, 2617 ], "sequon_annotation_sites": [ { "start_pos": 1332, "end_pos": 1334 }, { "start_pos": 1398, "end_pos": 1400 }, { "start_pos": 1442, "end_pos": 1444 }, { "start_pos": 1468, "end_pos": 1470 }, { "start_pos": 1663, "end_pos": 1665 }, { "start_pos": 1898, "end_pos": 1900 }, { "start_pos": 2179, "end_pos": 2181 }, { "start_pos": 2272, "end_pos": 2274 }, { "start_pos": 2280, "end_pos": 2282 }, { "start_pos": 2360, "end_pos": 2362 }, { "start_pos": 2385, "end_pos": 2387 }, { "start_pos": 2392, "end_pos": 2394 }, { "start_pos": 2496, "end_pos": 2498 }, { "start_pos": 2628, "end_pos": 2630 }, { "start_pos": 2934, "end_pos": 2936 }, { "start_pos": 3067, "end_pos": 3069 }, { "start_pos": 330, "end_pos": 332 }, { "start_pos": 3369, "end_pos": 3371 }, { "start_pos": 3379, "end_pos": 3381 }, { "start_pos": 57, "end_pos": 59 }, { "start_pos": 615, "end_pos": 617 }, { "start_pos": 782, "end_pos": 784 }, { "start_pos": 809, "end_pos": 811 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 448 }, { "field": "total_sites", "count": 276 }, { "field": "n_linked_glycans", "count": 13 }, { "field": "n_linked_glycan_sites", "count": 32 }, { "field": "o_linked_glycans", "count": 11 }, { "field": "o_linked_glycan_sites", "count": 255 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 20 }, { "field": "total_sites", "count": 20 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 8 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 12 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 412 }, { "field": "total_sites", "count": 251 }, { "field": "n_linked_glycans", "count": 13 }, { "field": "n_linked_glycan_sites", "count": 9 }, { "field": "o_linked_glycans", "count": 11 }, { "field": "o_linked_glycan_sites", "count": 242 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 16 }, { "field": "total_sites", "count": 16 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 15 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 320 }, { "field": "total_sites", "count": 234 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 64 }, { "field": "total_sites", "count": 57 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 256 }, { "field": "total_sites", "count": 200 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 204 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }