{ "uniprot_canonical_ac": "P13232-1", "uniprot_ac": "P13232", "uniprot_id": "IL7_HUMAN", "mass": { "chemical_mass": 20187.0, "monoisotopic_mass": 20187.0 }, "refseq": { "ac": "NP_000871", "name": "interleukin-7 isoform 1 precursor", "summary": "The protein encoded by this gene is a cytokine important for B and T cell development. This cytokine and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. IL7 is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCRB) during early T cell development. This cytokine can be produced locally by intestinal epithelial and epithelial goblet cells, and may serve as a regulatory factor for intestinal mucosal lymphocytes. IL7 plays an essential role in lymphoid cell survival, and in the maintenance of naive and memory T cells. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional splice variants have been described but their presence in normal tissues has not been confirmed. Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) infection can be a potent inducer of proinflammatory cytokines and chemokines which may defend against the infection, but may also mediate destructive lung injury. Elevated serum IL7 levels, together with several other circulating cytokines and chemokines, has been found to be associated with the severity of Coronavirus Disease 19 (COVID-19). [provided by RefSeq, Jul 2020].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000871" }, "gene_names": [ { "name": "IL7", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P13232", "id": "P13232" }, { "name": "IL-7", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000871", "id": "NP_000871" }, { "name": "IL7", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000871", "id": "NP_000871" } ], "protein_names": [ { "name": "Interleukin-7", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P13232" }, { "name": "IL-7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13232" }, { "name": "interleukin-7 isoform 1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000871", "id": "NP_000871" } ], "function": [ { "annotation": "Hematopoietic cytokine that plays an essential role in the development, expansion, and survival of naive and memory T-cells and B-cells thereby regulating the number of mature lymphocytes and maintaining lymphoid homeostasis.", "evidence": [ { "database": "UniProtKB", "id": "A0A0A0MTG5", "url": "https://www.uniprot.org/uniprot/A0A0A0MTG5#function" }, { "database": "UniProtKB", "id": "PIRNR001942", "url": "https://www.uniprot.org/uniprot/PIRNR001942#function" }, { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232#function" }, { "database": "PubMed", "id": "8128231", "url": "https://glygen.org/publication/PubMed/8128231" }, { "database": "PubMed", "id": "25870237", "url": "https://glygen.org/publication/PubMed/25870237" }, { "database": "PubMed", "id": "7527823", "url": "https://glygen.org/publication/PubMed/7527823" }, { "database": "PubMed", "id": "18523275", "url": "https://glygen.org/publication/PubMed/18523275" }, { "database": "PubMed", "id": "20974963", "url": "https://glygen.org/publication/PubMed/20974963" } ] }, { "annotation": "IL-7 germline variant: setting the stage for immune-related adverse events.", "evidence": [ { "database": "RefSeq", "id": "NP_000871", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000871" }, { "database": "PubMed", "id": "36748568", "url": "https://glygen.org/publication/PubMed/36748568" } ] }, { "annotation": "IL-7 receptor signaling drives human B-cell progenitor differentiation and expansion.", "evidence": [ { "database": "RefSeq", "id": "NP_000871", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000871" }, { "database": "PubMed", "id": "37369082", "url": "https://glygen.org/publication/PubMed/37369082" } ] }, { "annotation": "IL7 genetic variation and toxicity to immune checkpoint blockade in patients with melanoma.", "evidence": [ { "database": "RefSeq", "id": "NP_000871", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000871" }, { "database": "PubMed", "id": "36526722", "url": "https://glygen.org/publication/PubMed/36526722" } ] }, { "annotation": "Tear levels of IL-7, IL-1alpha, and IL-1beta may differentiate between IgG4-related disease and Sjogren's syndrome.", "evidence": [ { "database": "RefSeq", "id": "NP_000871", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000871" }, { "database": "PubMed", "id": "36627528", "url": "https://glygen.org/publication/PubMed/36627528" } ] }, { "annotation": "The Therapeutic Values of IL-7/IL-7R and the Recombinant Derivatives in Glioma: A Narrative Review. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_000871", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000871" }, { "database": "PubMed", "id": "37566474", "url": "https://glygen.org/publication/PubMed/37566474" } ] }, { "annotation": "The protein encoded by this gene is a cytokine important for B and T cell development. This cytokine and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. IL7 is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCRB) during early T cell development. This cytokine can be produced locally by intestinal epithelial and epithelial goblet cells, and may serve as a regulatory factor for intestinal mucosal lymphocytes. IL7 plays an essential role in lymphoid cell survival, and in the maintenance of naive and memory T cells. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional splice variants have been described but their presence in normal tissues has not been confirmed. Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) infection can be a potent inducer of proinflammatory cytokines and chemokines which may defend against the infection, but may also mediate destructive lung injury. Elevated serum IL7 levels, together with several other circulating cytokines and chemokines, has been found to be associated with the severity of Coronavirus Disease 19 (COVID-19). [provided by RefSeq, Jul 2020].", "evidence": [ { "database": "RefSeq", "id": "NP_000871", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000871" } ] } ], "disease": [ { "disease_id": "MONDO:0032667", "recommended_name": { "id": "MONDO:0032667", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032667", "name": "epidermodysplasia verruciformis, susceptibility to, 5", "description": "" }, "synonyms": [ { "id": "MONDO:0032667", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032667", "name": "EPIDERMODYSPLASIA VERRUCIFORMIS, SUSCEPTIBILITY TO, 5", "description": "" }, { "id": "MONDO:0032667", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032667", "name": "EV5", "description": "" }, { "id": "MIM:618309", "resource": "MIM", "url": "https://www.omim.org/entry/618309", "name": "Epidermodysplasia verruciformis 5", "description": "Epidermodysplasia verruciformis 5" } ], "evidence": [ { "id": "618309", "database": "MIM", "url": "https://www.omim.org/entry/618309" } ] } ], "snv": [ { "evidence": [ { "id": "rs765509762", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765509762" }, { "id": "rs765509762", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765509762" }, { "id": "rs765509762", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765509762" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 118, "end_pos": 118, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->NCA).", "chr_id": "8", "chr_pos": "78738512", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T118", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs762037062", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762037062" }, { "id": "rs762037062", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762037062" }, { "id": "rs762037062", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs762037062#frequency_tab" }, { "id": "rs762037062", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762037062" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 118, "end_pos": 118, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->NCI).", "chr_id": "8", "chr_pos": "78738511", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T118", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P13232", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13232" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 143, "end_pos": 143, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NKS->NKY).", "chr_id": "8", "chr_pos": "78733819", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S143", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs745728021", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745728021" }, { "id": "rs745728021", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745728021" }, { "id": "rs745728021", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745728021" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 153, "end_pos": 153, "sequence_org": "L", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDL->NDS).", "chr_id": "8", "chr_pos": "78733789", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "L153", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs755465083", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755465083" }, { "id": "rs755465083", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755465083" }, { "id": "rs755465083", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755465083" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 170, "end_pos": 170, "sequence_org": "I", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NKI->NKS).", "chr_id": "8", "chr_pos": "78733738", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I170", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "62.49", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000104432", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104432" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "68.21", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000104432", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104432" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "69.15", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000104432", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104432" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000104432", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104432" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "70.84", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000104432", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104432" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "80.65", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000104432", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104432" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000104432", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104432" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "70.14", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000104432", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104432" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "68.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000104432", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104432" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "53.66", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000104432", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104432" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "78.13", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000104432", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104432" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "68.58", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000104432", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104432" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "68.16", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000104432", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104432" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P13232", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13232" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P13232", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13232" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P13232", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13232" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P13232", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13232" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P13232", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13232" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P13232", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13232" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P13232", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13232" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P13232", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13232" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P13232", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13232" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P13232", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13232" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P13232", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13232" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P13232", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13232" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "common_name": "Human" } ], "gene": [ { "name": "IL7", "url": "https://www.uniprot.org/uniprot/P13232", "locus": { "chromosome": "8", "start_pos": 78675743, "end_pos": 78805523, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000104432", "url": "https://www.ensembl.org/id/ENSG00000104432" } ] } } ], "crossref": [ { "id": "ENSG00000104432", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104432", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P13232", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P13232", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "IL7", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=IL7", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "3574", "url": "https://www.ncbi.nlm.nih.gov/gene/3574", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "6023", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=6023", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P13232", "url": "https://www.ebi.ac.uk/intact/interactors/id:P13232*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001181", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001181", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018049", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018049", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038325", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038325", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:3574", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3574", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "146660", "url": "http://www.omim.org/entry/146660", "database": "MIM", "categories": [ "Other" ] }, { "id": "618309", "url": "http://www.omim.org/entry/618309", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P13232", "url": "https://www.nextprot.org/entry/NX_P13232", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "NMSAEYR", "url": "https://omabrowser.org/oma/group/NMSAEYR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4630779at2759", "url": "http://www.orthodb.org/?query=4630779at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "3DI2", "url": "https://www.rcsb.org/structure/3DI2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3DI3", "url": "https://www.rcsb.org/structure/3DI3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01415", "url": "http://pfam.xfam.org/family/PF01415", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P13232", "url": "https://pharos.nih.gov/targets/P13232", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P13232", "url": "http://purl.obolibrary.org/obo/PR_P13232", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000871", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000871", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0A0MTG5", "url": "https://www.uniprot.org/uniprot/A0A0A0MTG5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0A0MTG5-1", "url": "https://www.uniprot.org/uniprot/A0A0A0MTG5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13232-1", "url": "https://www.uniprot.org/uniprot/P13232-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13232-2", "url": "https://www.uniprot.org/uniprot/P13232-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13232-3", "url": "https://www.uniprot.org/uniprot/P13232-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5FBX5", "url": "https://www.uniprot.org/uniprot/Q5FBX5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5FBX5-1", "url": "https://www.uniprot.org/uniprot/Q5FBX5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5FBY3", "url": "https://www.uniprot.org/uniprot/Q5FBY3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5FBY3-1", "url": "https://www.uniprot.org/uniprot/Q5FBY3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5FBY6", "url": "https://www.uniprot.org/uniprot/Q5FBY6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5FBY6-1", "url": "https://www.uniprot.org/uniprot/Q5FBY6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH", "length": 177, "header": "sp|P13232-1|IL7_HUMAN Isoform 1 of Interleukin-7 OS=Homo sapiens OX=9606 GN=IL7 PE=1 SV=1 CANONICAL=P13232-1" }, "isoforms": [ { "isoform_ac": "A0A0A0MTG5-1", "url": "", "sequence": { "sequence": "MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH", "length": 159, "header": "tr|A0A0A0MTG5-1|IL7_HUMAN Computationally mapped isoform of Interleukin-7 OS=Homo sapiens OX=9606 GN=IL7 PE=1 SV=1 CANONICAL=P13232-1" }, "locus": { "chromosome": "8", "start_pos": 78804922, "end_pos": 78733716, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000541183.2", "url": "https://www.ensembl.org/id/ENST00000541183.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000438922.2", "url": "https://www.ensembl.org/id/ENSP00000438922.2" } ] } }, { "isoform_ac": "P13232-1", "url": "", "sequence": { "sequence": "MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH", "length": 177, "header": "sp|P13232-1|IL7_HUMAN Isoform 1 of Interleukin-7 OS=Homo sapiens OX=9606 GN=IL7 PE=1 SV=1 CANONICAL=P13232-1" }, "locus": { "chromosome": "8", "start_pos": 78804922, "end_pos": 78733716, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000263851.9", "url": "https://www.ensembl.org/id/ENST00000263851.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000263851.4", "url": "https://www.ensembl.org/id/ENSP00000263851.4" } ] } }, { "isoform_ac": "P13232-2", "url": "", "sequence": { "sequence": "MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH", "length": 133, "header": "sp|P13232-2|IL7_HUMAN Isoform 2 of Interleukin-7 OS=Homo sapiens OX=9606 GN=IL7 PE=1 SV=1 CANONICAL=P13232-1" }, "locus": { "chromosome": "8", "start_pos": 78804922, "end_pos": 78733716, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000520269.5", "url": "https://www.ensembl.org/id/ENST00000520269.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000427750.1", "url": "https://www.ensembl.org/id/ENSP00000427750.1" } ] } }, { "isoform_ac": "P13232-3", "url": "", "sequence": { "sequence": "MKEIGSNCLNNEFNFFKRHICDANKEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH", "length": 64, "header": "sp|P13232-3|IL7_HUMAN Isoform 3 of Interleukin-7 OS=Homo sapiens OX=9606 GN=IL7 PE=1 SV=1 CANONICAL=P13232-1" }, "locus": {} }, { "isoform_ac": "Q5FBX5-1", "url": "", "sequence": { "sequence": "MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH", "length": 115, "header": "tr|Q5FBX5-1|Q5FBX5_HUMAN Computationally mapped isoform of Interleukin-7 OS=Homo sapiens OX=9606 GN=IL7 PE=1 SV=1 CANONICAL=P13232-1" }, "locus": { "chromosome": "8", "start_pos": 78804922, "end_pos": 78733716, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000379113.6", "url": "https://www.ensembl.org/id/ENST00000379113.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000368408.3", "url": "https://www.ensembl.org/id/ENSP00000368408.3" } ] } }, { "isoform_ac": "Q5FBY3-1", "url": "", "sequence": { "sequence": "MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLNQPYKKKEKRTERKQQSAMSNN", "length": 71, "header": "tr|Q5FBY3-1|Q5FBY3_HUMAN Computationally mapped isoform of Interleukin-7 OS=Homo sapiens OX=9606 GN=IL7 PE=2 SV=1 CANONICAL=P13232-1" }, "locus": { "chromosome": "8", "start_pos": 78804922, "end_pos": 78747031, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000518982.5", "url": "https://www.ensembl.org/id/ENST00000518982.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000430272.1", "url": "https://www.ensembl.org/id/ENSP00000430272.1" } ] } }, { "isoform_ac": "Q5FBY6-1", "url": "", "sequence": { "sequence": "MFHVSFRYIFGLPPLILVLLPVASSDCDIEGQHERNW", "length": 37, "header": "tr|Q5FBY6-1|Q5FBY6_HUMAN Computationally mapped isoform of IL7 nirs variant 3 OS=Homo sapiens OX=9606 GN=IL7 PE=2 SV=1 CANONICAL=P13232-1" }, "locus": { "chromosome": "8", "start_pos": 78804922, "end_pos": 78740063, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000520317.1", "url": "https://www.ensembl.org/id/ENST00000520317.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000427800.1", "url": "https://www.ensembl.org/id/ENSP00000427800.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 116, "start_aa": "Asn", "end_pos": 116, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn116", "evidence": [ { "id": "P13232", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13232#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 141, "start_aa": "Asn", "end_pos": 141, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn141", "evidence": [ { "id": "P13232", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13232#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 95, "start_aa": "Asn", "end_pos": 95, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn95", "evidence": [ { "id": "P13232", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13232#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Comparative model building of interleukin-7 using interleukin-4 as a template: a structural hypothesis that displays atypical surface chemistry in helix D important for receptor activation.", "journal": "Protein Sci.", "date": "2000", "authors": "Cosenza L, Rosenbach A, White J V, Murphy J R, Smith T", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "reference": [ { "type": "PubMed", "id": "10850801", "url": "https://glygen.org/publication/PubMed/10850801" } ] }, { "title": "Human thymic stromal lymphopoietin preferentially stimulates myeloid cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Reche PA, Soumelis V, Gorman DM, Clifford T, Liu Mr, Travis M, Zurawski SM, Johnston J, Liu YJ, Spits H, de Waal Malefyt R, Kastelein RA, Bazan JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "11418668", "url": "https://glygen.org/publication/PubMed/11418668" } ] }, { "title": "Cutting edge: Identification of a hybrid cytokine consisting of IL-7 and the beta-chain of the hepatocyte growth factor/scatter factor.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Lai L, Goldschneider I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "11564764", "url": "https://glygen.org/publication/PubMed/11564764" } ] }, { "title": "The IL-7 receptor controls the accessibility of the TCRgamma locus by Stat5 and histone acetylation.", "journal": "Immunity", "date": "2001", "authors": "Ye SK, Agata Y, Lee HC, Kurooka H, Kitamura T, Shimizu A, Honjo T, Ikuta K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "11728342", "url": "https://glygen.org/publication/PubMed/11728342" } ] }, { "title": "Pre-pro-B cell growth-stimulating factor (PPBSF) upregulates IL-7Ralpha chain expression and enables pro-B cells to respond to monomeric IL-7.", "journal": "Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research", "date": "2002", "authors": "Wei C, Lai L, Goldschneider I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "12184921", "url": "https://glygen.org/publication/PubMed/12184921" } ] }, { "title": "Expression of the Wdr9 gene and protein products during mouse development.", "journal": "Developmental dynamics : an official publication of the American Association of Anatomists", "date": "2003", "authors": "Huang H, Rambaldi I, Daniels E, Featherstone M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "12889071", "url": "https://glygen.org/publication/PubMed/12889071" } ] }, { "title": "Prevention of organ allograft rejection by a specific Janus kinase 3 inhibitor.", "journal": "Science (New York, N.Y.)", "date": "2003", "authors": "Changelian PS, Flanagan ME, Ball DJ, Kent CR, Magnuson KS, Martin WH, Rizzuti BJ, Sawyer PS, Perry BD, Brissette WH, McCurdy SP, Kudlacz EM, Conklyn MJ, Elliott EA, Koslov ER, Fisher MB, Strelevitz TJ, Yoon K, Whipple DA, Sun J, Munchhof MJ, Doty JL, Casavant JM, Blumenkopf TA, Hines M, Brown MF, Lillie BM, Subramanyam C, Shang-Poa C, Milici AJ, Beckius GE, Moyer JD, Su C, Woodworth TG, Gaweco AS, Beals CR, Littman BH, Fisher DA, Smith JF, Zagouras P, Magna HA, Saltarelli MJ, Johnson KS, Nelms LF, Des Etages SG, Hayes LS, Kawabata TT, Finco-Kent D, Baker DL, Larson M, Si MS, Paniagua R, Higgins J, Holm B, Reitz B, Zhou YJ, Morris RE, O'Shea JJ, Borie DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "14593182", "url": "https://glygen.org/publication/PubMed/14593182" } ] }, { "title": "Activation of PI3K is indispensable for interleukin 7-mediated viability, proliferation, glucose use, and growth of T cell acute lymphoblastic leukemia cells.", "journal": "The Journal of experimental medicine", "date": "2004", "authors": "Barata JT, Silva A, Brandao JG, Nadler LM, Cardoso AA, Boussiotis VA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "15353558", "url": "https://glygen.org/publication/PubMed/15353558" } ] }, { "title": "Stat5 mediates the IL-7-induced accessibility of a representative D-Distal VH gene.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Stanton ML, Brodeur PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "15749844", "url": "https://glygen.org/publication/PubMed/15749844" } ] }, { "title": "IL-7 activates the phosphatidylinositol 3-kinase/AKT pathway in normal human thymocytes but not normal human B cell precursors.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2008-06-15", "authors": "Johnson Sonja E, Shah Nisha, Bajer Anna A, LeBien Tucker W", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "reference": [ { "type": "PubMed", "id": "18523275", "url": "https://glygen.org/publication/PubMed/18523275" } ] }, { "title": "Structural and biophysical studies of the human IL-7/IL-7Ralpha complex.", "journal": "Structure", "date": "2009", "authors": "McElroy CA, Dohm JA, Walsh ST", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "reference": [ { "type": "PubMed", "id": "19141282", "url": "https://glygen.org/publication/PubMed/19141282" } ] }, { "title": "Dual mechanism of impairment of interleukin-7 (IL-7) responses in human immunodeficiency virus infection: decreased IL-7 binding and abnormal activation of the JAK/STAT5 pathway.", "journal": "Journal of virology", "date": "2010", "authors": "Juffroy O, Bugault F, Lambotte O, Landires I, Viard JP, Niel L, Fontanet A, Delfraissy JF, Theze J, Chakrabarti LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "19864382", "url": "https://glygen.org/publication/PubMed/19864382" } ] }, { "title": "Thymic stromal lymphopoietin-mediated STAT5 phosphorylation via kinases JAK1 and JAK2 reveals a key difference from IL-7-induced signaling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Rochman Y, Kashyap M, Robinson GW, Sakamoto K, Gomez-Rodriguez J, Wagner KU, Leonard WJ", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "reference": [ { "type": "PubMed", "id": "20974963", "url": "https://glygen.org/publication/PubMed/20974963" } ] }, { "title": "Discovery of CP-690,550: a potent and selective Janus kinase (JAK) inhibitor for the treatment of autoimmune diseases and organ transplant rejection.", "journal": "Journal of medicinal chemistry", "date": "2010", "authors": "Flanagan ME, Blumenkopf TA, Brissette WH, Brown MF, Casavant JM, Shang-Poa C, Doty JL, Elliott EA, Fisher MB, Hines M, Kent C, Kudlacz EM, Lillie BM, Magnuson KS, McCurdy SP, Munchhof MJ, Perry BD, Sawyer PS, Strelevitz TJ, Subramanyam C, Sun J, Whipple DA, Changelian PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "21105711", "url": "https://glygen.org/publication/PubMed/21105711" } ] }, { "title": "Histone recognition and large-scale structural analysis of the human bromodomain family.", "journal": "Cell", "date": "2012", "authors": "Filippakopoulos P, Picaud S, Mangos M, Keates T, Lambert JP, Barsyte-Lovejoy D, Felletar I, Volkmer R, Muller S, Pawson T, Gingras AC, Arrowsmith CH, Knapp S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "22464331", "url": "https://glygen.org/publication/PubMed/22464331" } ] }, { "title": "Cloning of the human and murine interleukin-7 receptors: demonstration of a soluble form and homology to a new receptor superfamily.", "journal": "Cell", "date": "1990", "authors": "Goodwin RG, Friend D, Ziegler SF, Jerzy R, Falk BA, Gimpel S, Cosman D, Dower SK, March CJ, Namen AE, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "2317865", "url": "https://glygen.org/publication/PubMed/2317865" } ] }, { "title": "Characterization of the human and murine IL-7 genes.", "journal": "J. Immunol.", "date": "1990", "authors": "Lupton SD, Gimpel S, Jerzy R, Brunton LL, Hjerrild KA, Cosman D, Goodwin RG", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "reference": [ { "type": "PubMed", "id": "2329282", "url": "https://glygen.org/publication/PubMed/2329282" } ] }, { "title": "Discovery and development of Janus kinase (JAK) inhibitors for inflammatory diseases.", "journal": "Journal of medicinal chemistry", "date": "2014", "authors": "Clark JD, Flanagan ME, Telliez JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "24417533", "url": "https://glygen.org/publication/PubMed/24417533" } ] }, { "title": "Recycled IL-7 Can Be Delivered to Neighboring T Cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2015-05-15", "authors": "Bazdar Douglas A, Kalinowska Magdalena, Panigrahi Soumya, Sieg Scott F", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "reference": [ { "type": "PubMed", "id": "25870237", "url": "https://glygen.org/publication/PubMed/25870237" } ] }, { "title": "Generalized verrucosis and HPV-3 susceptibility associated with CD4 T-cell lymphopenia caused by inherited human interleukin-7 deficiency.", "journal": "Journal of the American Academy of Dermatology", "date": "2015", "authors": "Horev L, Unger S, Molho-Pessach V, Meir T, Maly A, Stepensky P, Zamir M, Keller B, Babay S, Warnatz K, Ramot Y, Zlotogorski A", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "reference": [ { "type": "PubMed", "id": "25981006", "url": "https://glygen.org/publication/PubMed/25981006" } ] }, { "title": "Histone reader BRWD1 targets and restricts recombination to the Igk locus.", "journal": "Nature immunology", "date": "2015", "authors": "Mandal M, Hamel KM, Maienschein-Cline M, Tanaka A, Teng G, Tuteja JH, Bunker JJ, Bahroos N, Eppig JJ, Schatz DG, Clark MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "26301565", "url": "https://glygen.org/publication/PubMed/26301565" } ] }, { "title": "Human interleukin 7: molecular cloning and growth factor activity on human and murine B-lineage cells.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1989", "authors": "Goodwin R G, Lupton S, Schmierer A, Hjerrild K J, Jerzy R, Clevenger W, Gillis S, Cosman D, Namen A E", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "reference": [ { "type": "PubMed", "id": "2643102", "url": "https://glygen.org/publication/PubMed/2643102" } ] }, { "title": "LNK/SH2B3 regulates IL-7 receptor signaling in normal and malignant B-progenitors.", "journal": "The Journal of clinical investigation", "date": "2016", "authors": "Cheng Y, Chikwava K, Wu C, Zhang H, Bhagat A, Pei D, Choi JK, Tong W", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "26974155", "url": "https://glygen.org/publication/PubMed/26974155" } ] }, { "title": "Suppressor of cytokine signaling (SOCS) proteins are induced by IL-7 and target surface CD127 protein for degradation in human CD8 T cells.", "journal": "Cellular immunology", "date": "2016", "authors": "Ghazawi FM, Faller EM, Parmar P, El-Salfiti A, MacPherson PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "27423467", "url": "https://glygen.org/publication/PubMed/27423467" } ] }, { "title": "Tofacitinib: A Review in Rheumatoid Arthritis.", "journal": "Drugs", "date": "2017", "authors": "Dhillon S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "29139090", "url": "https://glygen.org/publication/PubMed/29139090" } ] }, { "title": "JAK3 inhibitors based on thieno[3,2-d]pyrimidine scaffold: design, synthesis and bioactivity evaluation for the treatment of B-cell lymphoma.", "journal": "Bioorganic chemistry", "date": "2020", "authors": "Chi F, Chen L, Wang C, Li L, Sun X, Xu Y, Ma T, Liu K, Ma X, Shu X", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "31918398", "url": "https://glygen.org/publication/PubMed/31918398" } ] }, { "title": "IL7 genetic variation and toxicity to immune checkpoint blockade in patients with melanoma.", "journal": "Nature medicine", "date": "2022-12", "authors": "Taylor Chelsea A, Watson Robert A, Tong Orion, Ye Weiyu, Nassiri Isar, Gilchrist James J, de Los Aires Alba Verge, Sharma Piyush Kumar, Koturan Surya, Cooper Rosalin A, Woodcock Victoria K, Jungkurth Elsita, Shine Brian, Coupe Nicholas, Payne Miranda J, Church David N, Naranbhai Vivek, Groha Stefan, Emery Paul, Mankia Kulveer, Freedman Matthew L, Choueiri Toni K, Middleton Mark R, Gusev Alexander, Fairfax Benjamin P", "evidence": [ { "database": "RefSeq", "id": "NP_000871", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000871" } ], "reference": [ { "type": "PubMed", "id": "36526722", "url": "https://glygen.org/publication/PubMed/36526722" } ] }, { "title": "Tear levels of IL-7, IL-1\u03b1, and IL-1\u03b2 may differentiate between IgG4-related disease and Sj\u00f6gren's syndrome.", "journal": "Clinical rheumatology", "date": "2023-04", "authors": "Mart\u00edn-Nares Eduardo, Hern\u00e1ndez-Molina Gabriela, Lima Guadalupe, Hern\u00e1ndez-Ram\u00edrez Diego Francisco, Chan-Campos Isela, Saavedra-Gonz\u00e1lez Vanessa, Llorente Luis", "evidence": [ { "database": "RefSeq", "id": "NP_000871", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000871" } ], "reference": [ { "type": "PubMed", "id": "36627528", "url": "https://glygen.org/publication/PubMed/36627528" } ] }, { "title": "IL-7 germline variant: setting the stage for immune-related adverse events.", "journal": "Molecular oncology", "date": "2023-03", "authors": "Issaoui Hussein, Ricci Jean-Ehrland", "evidence": [ { "database": "RefSeq", "id": "NP_000871", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000871" } ], "reference": [ { "type": "PubMed", "id": "36748568", "url": "https://glygen.org/publication/PubMed/36748568" } ] }, { "title": "IL-7 receptor signaling drives human B-cell progenitor differentiation and expansion.", "journal": "Blood", "date": "2023-09-28", "authors": "Kaiser Fabian M P, Janowska Iga, Menafra Roberta, de Gier Melanie, Korzhenevich Jakov, Pico-Knijnenburg Ingrid, Khatri Indu, Schulz Ansgar, Kuijpers Taco W, Lankester Arjan C, Konstantinidis Lukas, Erlacher Miriam, Kloet Susan, van Schouwenburg Pauline A, Rizzi Marta, van der Burg Mirjam", "evidence": [ { "database": "RefSeq", "id": "NP_000871", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000871" } ], "reference": [ { "type": "PubMed", "id": "37369082", "url": "https://glygen.org/publication/PubMed/37369082" } ] }, { "title": "The Therapeutic Values of IL-7/IL-7R and the Recombinant Derivatives in Glioma: A Narrative Review.", "journal": "Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research", "date": "2023-08", "authors": "Hesari Marjan, Attar Zeinab, Soltani-Shirazi Shakiba, Keshavarzian Omid, Taheri Reza, Tabrizi Reza, Fouladseresht Hamed", "evidence": [ { "database": "RefSeq", "id": "NP_000871", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000871" } ], "reference": [ { "type": "PubMed", "id": "37566474", "url": "https://glygen.org/publication/PubMed/37566474" } ] }, { "title": "Interleukin-7 can induce the activation of Jak 1, Jak 3 and STAT 5 proteins in murine T cells.", "journal": "European journal of immunology", "date": "1995", "authors": "Foxwell BM, Beadling C, Guschin D, Kerr I, Cantrell D", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "7489741", "url": "https://glygen.org/publication/PubMed/7489741" } ] }, { "title": "Cytoplasmic domains of the interleukin-2 receptor beta and gamma chains mediate the signal for T-cell proliferation.", "journal": "Nature", "date": "1994", "authors": "Nelson BH, Lord JD, Greenberg PD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "7514277", "url": "https://glygen.org/publication/PubMed/7514277" } ] }, { "title": "The growth response to IL-7 during normal human B cell ontogeny is restricted to B-lineage cells expressing CD34.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1995-01-01", "authors": "Dittel B N, LeBien T W", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "reference": [ { "type": "PubMed", "id": "7527823", "url": "https://glygen.org/publication/PubMed/7527823" } ] }, { "title": "The role of shared receptor motifs and common Stat proteins in the generation of cytokine pleiotropy and redundancy by IL-2, IL-4, IL-7, IL-13, and IL-15.", "journal": "Immunity", "date": "1995", "authors": "Lin JX, Migone TS, Tsang M, Friedmann M, Weatherbee JA, Zhou L, Yamauchi A, Bloom ET, Mietz J, John S, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "7719938", "url": "https://glygen.org/publication/PubMed/7719938" } ] }, { "title": "Functional participation of the IL-2 receptor gamma chain in IL-7 receptor complexes.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Kondo M, Takeshita T, Higuchi M, Nakamura M, Sudo T, Nishikawa S, Sugamura K", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" }, { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "8128231", "url": "https://glygen.org/publication/PubMed/8128231" } ] }, { "title": "Interleukin-2 receptor gamma chain: a functional component of the interleukin-7 receptor.", "journal": "Science (New York, N.Y.)", "date": "1993", "authors": "Noguchi M, Nakamura Y, Russell SM, Ziegler SF, Tsang M, Cao X, Leonard WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "8266077", "url": "https://glygen.org/publication/PubMed/8266077" } ] }, { "title": "Distinct tyrosine residues within the interleukin-2 receptor beta chain drive signal transduction specificity, redundancy, and diversity.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Gaffen SL, Lai SY, Ha M, Liu X, Hennighausen L, Greene WC, Goldsmith MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "8702919", "url": "https://glygen.org/publication/PubMed/8702919" } ] }, { "title": "Interleukin-7 signaling in human B cell precursor acute lymphoblastic leukemia cells and murine BAF3 cells involves activation of STAT1 and STAT5 mediated via the interleukin-7 receptor alpha chain.", "journal": "Leukemia", "date": "1996", "authors": "van der Plas DC, Smiers F, Pouwels K, Hoefsloot LH, Lowenberg B, Touw IP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "8709637", "url": "https://glygen.org/publication/PubMed/8709637" } ] }, { "title": "Prediction of the three-dimensional structure of human interleukin-7 by homology modeling.", "journal": "Protein Eng.", "date": "1996", "authors": "Kroemer R T, Doughty S W, Robinson A J, Richards W G", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "reference": [ { "type": "PubMed", "id": "8862549", "url": "https://glygen.org/publication/PubMed/8862549" } ] }, { "title": "Differential association of phosphatidylinositol 3-kinase with insulin receptor substrate (IRS)-1 and IRS-2 in human thymocytes in response to IL-7.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1997", "authors": "Sharfe N, Roifman CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "9233603", "url": "https://glygen.org/publication/PubMed/9233603" } ] }, { "title": "IL-2 and IL-7 induce heterodimerization of STAT5 isoforms in human peripheral blood T lymphoblasts.", "journal": "Cellular immunology", "date": "1997", "authors": "Rosenthal LA, Winestock KD, Finbloom DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "9398404", "url": "https://glygen.org/publication/PubMed/9398404" } ] }, { "title": "Disulfide bond assignment in human interleukin-7 by matrix-assisted laser desorption/ionization mass spectroscopy and site-directed cysteine to serine mutational analysis.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Cosenza L, Sweeney E, Murphy J R", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "reference": [ { "type": "PubMed", "id": "9407080", "url": "https://glygen.org/publication/PubMed/9407080" } ] }, { "title": "Delineation of the regions of interleukin-2 (IL-2) receptor beta chain important for association of Jak1 and Jak3. Jak1-independent functional recruitment of Jak3 to Il-2Rbeta.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Zhu MH, Berry JA, Russell SM, Leonard WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "9553136", "url": "https://glygen.org/publication/PubMed/9553136" } ] }, { "title": "Characterization of cytokine differential induction of STAT complexes in primary human T and NK cells.", "journal": "Journal of leukocyte biology", "date": "1998", "authors": "Yu CR, Young HA, Ortaldo JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-1266695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695" } ], "reference": [ { "type": "PubMed", "id": "9715265", "url": "https://glygen.org/publication/PubMed/9715265" } ] } ], "pathway": [ { "id": "hsa:3574", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3574", "resource": "KEGG Pathway" }, { "id": "R-HSA-1266695", "name": "Interleukin-7 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1266695", "resource": "Reactome", "description": "Interleukin-7 signaling" } ], "orthologs": [ { "uniprot_canonical_ac": "P10168-1", "protein_name": "Interleukin-7", "gene_name": "Il7", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MFHVSFRYIFGIPPLILVLLPVTSSECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI", "length": 154 }, "evidence": [ { "id": "45934147", "url": "http://www.informatics.jax.org/homology/45934147", "database": "MGI" }, { "id": "P13232", "url": "https://omabrowser.org/oma/group/P13232/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P56478-1", "protein_name": "Interleukin-7", "gene_name": "Il7", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MFHVSFRYIFGIPPLILVLLPVTSSDCHIKDKDGKAFGSVLMISINQLDKMTGTDSDCPNNEPNFFKKHLCDDTKEAAFLNRAARKLRQFLKMNISEEFNDHLLRVSDGTQTLVNCTSKEEKTIKEQKKNDPCFLKRLLREIKTCWNKILKGSI", "length": 154 }, "evidence": [ { "id": "45934147", "url": "http://www.informatics.jax.org/homology/45934147", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9N2G6-1", "protein_name": "Interleukin-7", "gene_name": "IL7", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MFHVSFRYIFGIPPLILVLLPVASSDCDIEGKDGGVYQNVLMVSIDDLDRMIDFDSNCLNNEPNFLKKHSCDDNKEASFLYRAARKLKQFIKMNISEEFNHHLSTVSQGTLTLFNCTSKVKGRKPPSLGEAQLTKNLEENKSLKEQKRQGDLCFLKILLQKIKTCWNKILRGAKEY", "length": 176 }, "evidence": [ { "id": "P13232", "url": "https://omabrowser.org/oma/group/P13232/", "database": "OMA" } ], "common_name": "Pig" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "interleukin-7 receptor binding", "id": "GO:0005139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005139", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" }, { "name": "cytokine activity", "id": "GO:0005125", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005125", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" }, { "name": "growth factor activity", "id": "GO:0008083", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008083", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 21, "go_terms": [ { "name": "positive regulation of cytokine-mediated signaling pathway", "id": "GO:0001961", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001961", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" }, { "name": "T cell lineage commitment", "id": "GO:0002360", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002360", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" }, { "name": "cell-cell signaling", "id": "GO:0007267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007267", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" }, { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" }, { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" }, { "name": "positive regulation of chemokine production", "id": "GO:0032722", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032722", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" }, { "name": "homeostasis of number of cells within a tissue", "id": "GO:0048873", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048873", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" }, { "name": "positive regulation of B cell proliferation", "id": "GO:0030890", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030890", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" }, { "name": "regulation of peptidyl-tyrosine phosphorylation", "id": "GO:0050730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050730", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" }, { "name": "animal organ morphogenesis", "id": "GO:0009887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009887", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" }, { "name": "bone resorption", "id": "GO:0045453", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045453", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" }, { "name": "extrinsic apoptotic signaling pathway", "id": "GO:0097191", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097191", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" }, { "name": "humoral immune response", "id": "GO:0006959", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006959", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" }, { "name": "organ growth", "id": "GO:0035265", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035265", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" }, { "name": "positive regulation of organ growth", "id": "GO:0046622", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046622", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" }, { "name": "negative regulation of extrinsic apoptotic signaling pathway in absence of ligand", "id": "GO:2001240", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001240", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" }, { "name": "cytokine-mediated signaling pathway", "id": "GO:0019221", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019221", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" }, { "name": "positive regulation of B cell differentiation", "id": "GO:0045579", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045579", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" }, { "name": "B cell proliferation", "id": "GO:0042100", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042100", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" }, { "name": "positive regulation of T cell differentiation", "id": "GO:0045582", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045582", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" }, { "name": "immune response", "id": "GO:0006955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" }, { "name": "collagen-containing extracellular matrix", "id": "GO:0062023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062023", "evidence": [ { "database": "UniProtKB", "id": "P13232", "url": "https://www.uniprot.org/uniprot/P13232" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 116, "end_pos": 118, "annotation": "n_glycosylation_sequon" }, { "start_pos": 141, "end_pos": 143, "annotation": "n_glycosylation_sequon" }, { "start_pos": 95, "end_pos": 97, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 95, 116, 141 ], "o_linked_sites": [], "snv_sites": [ 118, 143, 153, 170 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 116, "end_pos": 118 }, { "start_pos": 141, "end_pos": 143 }, { "start_pos": 95, "end_pos": 97 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 45 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }