{ "uniprot_canonical_ac": "P13231-1", "uniprot_ac": "P13231", "uniprot_id": "HATA_DICDI", "mass": { "chemical_mass": 13456.0, "monoisotopic_mass": 13456.0 }, "refseq": { "ac": "XP_640342", "name": "actin binding protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_640342" }, "gene_names": [ { "name": "hatA", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P13231", "id": "P13231" }, { "name": "DDB_G0282141", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P13231", "id": "P13231" }, { "name": "abpH", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P13231", "id": "P13231" }, { "name": "hatA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_640342", "id": "XP_640342" } ], "protein_names": [ { "name": "Hisactophilin-1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P13231" }, { "name": "HS I", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13231" }, { "name": "Histidine-rich actin-binding protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13231" }, { "name": "actin binding protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_640342", "id": "XP_640342" }, { "name": "hisactophilin I", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_640342", "id": "XP_640342" } ], "function": [ { "annotation": "May act as an intracellular pH sensor that links chemotactic signals to responses in the microfilament system of the cells by nucleating actin polymerization or stabilizing the filaments.", "evidence": [ { "database": "UniProtKB", "id": "P13231", "url": "https://www.uniprot.org/uniprot/P13231#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "P13231", "url": "https://www.uniprot.org/uniprot/P13231" } ], "common_name": "Cellular slime molds" } ], "gene": [ { "name": "hatA", "url": "https://www.uniprot.org/uniprot/P13231", "locus": {} } ], "crossref": [ { "id": "cd00257", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00257", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "DDB_G0282141", "url": "http://dictybase.org/gene/DDB_G0282141", "database": "dictyBase", "categories": [ "Organism-specific" ] }, { "id": "8623443", "url": "https://www.ncbi.nlm.nih.gov/gene/8623443", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR008999", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008999", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR022768", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022768", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0282141", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0282141", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PTHR33351", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR33351", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR33351:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR33351:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1HCD", "url": "https://www.rcsb.org/structure/1HCD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1HCE", "url": "https://www.rcsb.org/structure/1HCE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF06268", "url": "http://pfam.xfam.org/family/PF06268", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P13231", "url": "http://purl.obolibrary.org/obo/PR_P13231", "database": "PRO", "categories": [ "Protein" ] }, { "id": "XP_640342", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_640342", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P13231", "url": "https://www.uniprot.org/uniprot/P13231", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13231-1", "url": "https://www.uniprot.org/uniprot/P13231-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGNRAFKSHHGHFLSAEGEAVKTHHGHHDHHTHFHVENHGGKVALKTHCGKYLSIGDHKQVYLSHHLHGDHSLFHLEHHGGKVSIKGHHHHYISADHHGHVSTKEHHDHDTTFEEIII", "length": 118, "header": "sp|P13231-1|HATA_DICDI Isoform 1 of Hisactophilin-1 OS=Dictyostelium discoideum OX=44689 GN=hatA PE=1 SV=3 CANONICAL=P13231-1" }, "isoforms": [ { "isoform_ac": "P13231-1", "url": "", "sequence": { "sequence": "MGNRAFKSHHGHFLSAEGEAVKTHHGHHDHHTHFHVENHGGKVALKTHCGKYLSIGDHKQVYLSHHLHGDHSLFHLEHHGGKVSIKGHHHHYISADHHGHVSTKEHHDHDTTFEEIII", "length": 118, "header": "sp|P13231-1|HATA_DICDI Isoform 1 of Hisactophilin-1 OS=Dictyostelium discoideum OX=44689 GN=hatA PE=1 SV=3 CANONICAL=P13231-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Structure of hisactophilin is similar to interleukin-1 beta and fibroblast growth factor.", "journal": "Nature", "date": "1992", "authors": "Habazettl J, Gondol D, Wiltscheck R, Otlewski J, Schleicher M, Holak T A", "evidence": [ { "database": "UniProtKB", "id": "P13231", "url": "https://www.uniprot.org/uniprot/P13231" } ], "reference": [ { "type": "PubMed", "id": "1436061", "url": "https://glygen.org/publication/PubMed/1436061" } ] }, { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Eichinger L, Pachebat J A, Gl\u00f6ckner G, Rajandream M-A, Sucgang R, Berriman M, Song J, Olsen R, Szafranski K, Xu Q, Tunggal B, Kummerfeld S, Madera M, Konfortov B A, Rivero F, Bankier A T, Lehmann R, Hamlin N, Davies R, Gaudet P, Fey P, Pilcher K, Chen G, Saunders D, Sodergren E, Davis P, Kerhornou A, Nie X, Hall N, Anjard C, Hemphill L, Bason N, Farbrother P, Desany B, Just E, Morio T, Rost R, Churcher C, Cooper J, Haydock S, van Driessche N, Cronin A, Goodhead I, Muzny D, Mourier T, Pain A, Lu M, Harper D, Lindsay R, Hauser H, James K, Quiles M, Madan Babu M, Saito T, Buchrieser C, Wardroper A, Felder M, Thangavelu M, Johnson D, Knights A, Loulseged H, Mungall K, Oliver K, Price C, Quail M A, Urushihara H, Hernandez J, Rabbinowitsch E, Steffen D, Sanders M, Ma J, Kohara Y, Sharp S, Simmonds M, Spiegler S, Tivey A, Sugano S, White B, Walker D, Woodward J, Winckler T, Tanaka Y, Shaulsky G, Schleicher M, Weinstock G, Rosenthal A, Cox E C, Chisholm R L, Gibbs R, Loomis W F, Platzer M, Kay R R, Williams J, Dear P H, Noegel A A, Barrell B, Kuspa A", "evidence": [ { "database": "UniProtKB", "id": "P13231", "url": "https://www.uniprot.org/uniprot/P13231" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] }, { "title": "Proteomics fingerprinting of phagosome maturation and evidence for the role of a Galpha during uptake.", "journal": "Mol. Cell. Proteomics", "date": "2006", "authors": "Gotthardt Daniel, Blancheteau Vincent, Bosserhoff Armin, Ruppert Thomas, Delorenzi Mauro, Soldati Thierry", "evidence": [ { "database": "UniProtKB", "id": "P13231", "url": "https://www.uniprot.org/uniprot/P13231" } ], "reference": [ { "type": "PubMed", "id": "16926386", "url": "https://glygen.org/publication/PubMed/16926386" } ] }, { "title": "Hisactophilin, a histidine-rich actin-binding protein from Dictyostelium discoideum.", "journal": "J. Biol. Chem.", "date": "1989", "authors": "Scheel J, Ziegelbauer K, Kupke T, Humbel B M, Noegel A A, Gerisch G, Schleicher M", "evidence": [ { "database": "UniProtKB", "id": "P13231", "url": "https://www.uniprot.org/uniprot/P13231" } ], "reference": [ { "type": "PubMed", "id": "2914932", "url": "https://glygen.org/publication/PubMed/2914932" } ] }, { "title": "The pH-sensitive actin-binding protein hisactophilin of Dictyostelium exists in two isoforms which both are myristoylated and distributed between plasma membrane and cytoplasm.", "journal": "The Journal of biological chemistry", "date": "1995-01-13", "authors": "Hanakam F, Eckerskorn C, Lottspeich F, M\u00fcller-Taubenberger A, Sch\u00e4fer W, Gerish G", "evidence": [ { "database": "UniProtKB", "id": "P13231", "url": "https://www.uniprot.org/uniprot/P13231" } ], "reference": [ { "type": "PubMed", "id": "7822284", "url": "https://glygen.org/publication/PubMed/7822284" } ] } ], "pathway": [ { "id": "ddi:DDB_G0282141", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0282141", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "actin monomer binding", "id": "GO:0003785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003785", "evidence": [ { "database": "UniProtKB", "id": "P13231", "url": "https://www.uniprot.org/uniprot/P13231" } ], "pmid": "" }, { "name": "fatty acid binding", "id": "GO:0005504", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005504", "evidence": [ { "database": "UniProtKB", "id": "P13231", "url": "https://www.uniprot.org/uniprot/P13231" } ], "pmid": "" }, { "name": "protein-macromolecule adaptor activity", "id": "GO:0030674", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030674", "evidence": [ { "database": "UniProtKB", "id": "P13231", "url": "https://www.uniprot.org/uniprot/P13231" } ], "pmid": "" }, { "name": "actin filament binding", "id": "GO:0051015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051015", "evidence": [ { "database": "UniProtKB", "id": "P13231", "url": "https://www.uniprot.org/uniprot/P13231" } ], "pmid": "" }, { "name": "lipid binding", "id": "GO:0008289", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008289", "evidence": [ { "database": "UniProtKB", "id": "P13231", "url": "https://www.uniprot.org/uniprot/P13231" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P13231", "url": "https://www.uniprot.org/uniprot/P13231" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P13231", "url": "https://www.uniprot.org/uniprot/P13231" } ], "pmid": "" }, { "name": "actin cytoskeleton", "id": "GO:0015629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015629", "evidence": [ { "database": "UniProtKB", "id": "P13231", "url": "https://www.uniprot.org/uniprot/P13231" } ], "pmid": "" }, { "name": "phagocytic vesicle", "id": "GO:0045335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045335", "evidence": [ { "database": "UniProtKB", "id": "P13231", "url": "https://www.uniprot.org/uniprot/P13231" } ], "pmid": "" }, { "name": "cortical cytoskeleton", "id": "GO:0030863", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030863", "evidence": [ { "database": "UniProtKB", "id": "P13231", "url": "https://www.uniprot.org/uniprot/P13231" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "actin filament polymerization", "id": "GO:0030041", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030041", "evidence": [ { "database": "UniProtKB", "id": "P13231", "url": "https://www.uniprot.org/uniprot/P13231" } ], "pmid": "" }, { "name": "response to acidic pH", "id": "GO:0010447", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010447", "evidence": [ { "database": "UniProtKB", "id": "P13231", "url": "https://www.uniprot.org/uniprot/P13231" } ], "pmid": "" }, { "name": "hyperosmotic response", "id": "GO:0006972", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006972", "evidence": [ { "database": "UniProtKB", "id": "P13231", "url": "https://www.uniprot.org/uniprot/P13231" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Phosphorylated.", "evidence": [ { "database": "UniProtKB", "id": "P13231", "url": "https://www.uniprot.org/uniprot/P13231" }, { "database": "PubMed", "id": "7822284", "url": "https://glygen.org/publication/PubMed/7822284" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }