{ "uniprot_canonical_ac": "P13224-1", "uniprot_ac": "P13224", "uniprot_id": "GP1BB_HUMAN", "mass": { "chemical_mass": 21718.0, "monoisotopic_mass": 21718.0 }, "refseq": { "ac": "NP_000398", "name": "platelet glycoprotein Ib beta chain precursor", "summary": "Platelet glycoprotein Ib (GPIb) is a heterodimeric transmembrane protein consisting of a disulfide-linked 140 kD alpha chain and 22 kD beta chain. It is part of the GPIb-V-IX system that constitutes the receptor for von Willebrand factor (VWF), and mediates platelet adhesion in the arterial circulation. GPIb alpha chain provides the VWF binding site, and GPIb beta contributes to surface expression of the receptor and participates in transmembrane signaling through phosphorylation of its intracellular domain. Mutations in the GPIb beta subunit have been associated with Bernard-Soulier syndrome, velocardiofacial syndrome and giant platelet disorder. The 206 amino acid precursor of GPIb beta is synthesized from a 1.0 kb mRNA expressed in plateletes and megakaryocytes. A 411 amino acid protein arising from a longer, unspliced transcript in endothelial cells has been described; however, the authenticity of this product has been questioned. Yet another less abundant GPIb beta mRNA species of 3.5 kb, expressed in nonhematopoietic tissues such as endothelium, brain and heart, was shown to result from inefficient usage of a non-consensus polyA signal in the neighboring upstream gene (SEPT5, septin 5). In the absence of polyadenylation from its own imperfect site, the SEPT5 gene produces read-through transcripts that use the consensus polyA signal of this gene. [provided by RefSeq, Dec 2010].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000398" }, "gene_names": [ { "name": "GP1BB", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P13224", "id": "P13224" }, { "name": "BDPLT1; BS; CD42C; GPIBB; GPIbbeta", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000398", "id": "NP_000398" }, { "name": "GP1BB", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000398", "id": "NP_000398" } ], "protein_names": [ { "name": "Platelet glycoprotein Ib beta chain", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P13224" }, { "name": "Antigen CD42b-beta", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13224" }, { "name": "GP-Ib beta", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13224" }, { "name": "GPIb-beta", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13224" }, { "name": "GPIbB", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13224" }, { "name": "platelet glycoprotein Ib beta chain precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000398", "id": "NP_000398" }, { "name": "platelet glycoprotein Ib beta chain; glycoprotein Ib platelet beta subunit; GP-Ib beta; antigen CD42b-beta; nuclear localization signal deleted in velocardiofacial syndrome; glycoprotein Ib (platelet), beta polypeptide; platelet membrane glycoprotein Ib beta", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000398", "id": "NP_000398" } ], "function": [ { "annotation": "A Novel Mutation in GP1BB Reveals the Role of the Cytoplasmic Domain of GPIbbeta in the Pathophysiology of Bernard-Soulier Syndrome and GPIb-IX Complex Assembly. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000398", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000398" }, { "database": "PubMed", "id": "34638529", "url": "https://glygen.org/publication/PubMed/34638529" } ] }, { "annotation": "A novel frameshift GP1BB mutation causes autosomal dominant macrothrombocytopenia with decreased vWF receptor expression but normal platelet aggregation.", "evidence": [ { "database": "RefSeq", "id": "NP_000398", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000398" }, { "database": "PubMed", "id": "33813986", "url": "https://glygen.org/publication/PubMed/33813986" } ] }, { "annotation": "Biological, clinical features and modelling of heterozygous variants of glycoprotein Ib platelet subunit alpha (GP1BA) and glycoprotein Ib platelet subunit beta (GP1BB) genes responsible for constitutional thrombocytopenia.", "evidence": [ { "database": "RefSeq", "id": "NP_000398", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000398" }, { "database": "PubMed", "id": "36173017", "url": "https://glygen.org/publication/PubMed/36173017" } ] }, { "annotation": "GP1BB c.179C > T is the most frequent cause of monoallelic Bernard-Soulier syndrome in the Italian population after the Bolzano variant: a report of two new families.", "evidence": [ { "database": "RefSeq", "id": "NP_000398", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000398" }, { "database": "PubMed", "id": "36539614", "url": "https://glygen.org/publication/PubMed/36539614" } ] }, { "annotation": "Gp-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to von Willebrand factor, which is already bound to the subendothelium.", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224#function" } ] }, { "annotation": "Platelet glycoprotein Ib (GPIb) is a heterodimeric transmembrane protein consisting of a disulfide-linked 140 kD alpha chain and 22 kD beta chain. It is part of the GPIb-V-IX system that constitutes the receptor for von Willebrand factor (VWF), and mediates platelet adhesion in the arterial circulation. GPIb alpha chain provides the VWF binding site, and GPIb beta contributes to surface expression of the receptor and participates in transmembrane signaling through phosphorylation of its intracellular domain. Mutations in the GPIb beta subunit have been associated with Bernard-Soulier syndrome, velocardiofacial syndrome and giant platelet disorder. The 206 amino acid precursor of GPIb beta is synthesized from a 1.0 kb mRNA expressed in plateletes and megakaryocytes. A 411 amino acid protein arising from a longer, unspliced transcript in endothelial cells has been described; however, the authenticity of this product has been questioned. Yet another less abundant GPIb beta mRNA species of 3.5 kb, expressed in nonhematopoietic tissues such as endothelium, brain and heart, was shown to result from inefficient usage of a non-consensus polyA signal in the neighboring upstream gene (SEPT5, septin 5). In the absence of polyadenylation from its own imperfect site, the SEPT5 gene produces read-through transcripts that use the consensus polyA signal of this gene. [provided by RefSeq, Dec 2010].", "evidence": [ { "database": "RefSeq", "id": "NP_000398", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000398" } ] } ], "disease": [ { "disease_id": "DOID:2217", "recommended_name": { "id": "DOID:2217", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2217", "name": "Bernard-Soulier syndrome", "description": "A blood coagulation disease characterized by autosomal recessive inheritance of mucosal bleeding, purpuric skin bleeding, epistaxis, and menorrhagia with prolonged bleeding times, enlarged platelets and absence of platelet aggregation in response to von Willebrand factor that has_material_basis_in mutation in the GP1BA gene, the GP1BB gene, or the GP9 gene which are subunits of the platelet membrane von Willebrand factor receptor complex, glycoprotein Ib." }, "synonyms": [ { "id": "DOID:2217", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2217", "name": "Bernard - Soulier thrombopathy", "description": "" }, { "id": "DOID:2217", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2217", "name": "Bernard Soulier syndrome", "description": "" }, { "id": "DOID:2217", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2217", "name": "Giant platelet syndrome", "description": "" }, { "id": "DOID:2217", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2217", "name": "Hemorrhagic dystrophic thrombocytopenia", "description": "" }, { "id": "DOID:2217", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2217", "name": "Thrombopathy, Bernard-Soulier", "description": "" }, { "id": "MONDO:0009276", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009276", "name": "Bernard-Soulier syndrome", "description": "Bernard Soulier syndrome (BSS) is an inherited platelet disorder characterized by mild to severe bleeding tendency, macrothrombocytopenia and absent ristocetin-induced platelet agglutination." }, { "id": "MONDO:0009276", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009276", "name": "Bernard - Soulier thrombopathy", "description": "" }, { "id": "MONDO:0009276", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009276", "name": "Bernard Soulier syndrome", "description": "" }, { "id": "MONDO:0009276", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009276", "name": "Bernard-Soulier syndrome", "description": "" }, { "id": "MONDO:0009276", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009276", "name": "Bernard-Soulier syndrome, type A1 (recessive)", "description": "" }, { "id": "MONDO:0009276", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009276", "name": "Hemorrhagiparous thrombocytic dystrophy", "description": "" }, { "id": "MONDO:0009276", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009276", "name": "giant platelet disorder, isolated", "description": "" }, { "id": "MONDO:0009276", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009276", "name": "giant platelet syndrome", "description": "" }, { "id": "MONDO:0009276", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009276", "name": "hemorrhagic dystrophic thrombocytopenia", "description": "" }, { "id": "MONDO:0009276", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009276", "name": "thrombopathy, Bernard-Soulier", "description": "" }, { "id": "MONDO:0009276", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009276", "name": "BSS", "description": "" }, { "id": "MONDO:0009276", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009276", "name": "Bernard-Soulier syndrome, type A1", "description": "" }, { "id": "MONDO:0009276", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009276", "name": "Bernard-Soulier syndrome, type B", "description": "" }, { "id": "MONDO:0009276", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009276", "name": "Bernard-Soulier syndrome, type C", "description": "" }, { "id": "MONDO:0009276", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009276", "name": "Platelet glycoprotein 1b, deficiency of", "description": "" }, { "id": "MONDO:0009276", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009276", "name": "Platelet glycoprotein Ib deficiency", "description": "" }, { "id": "MONDO:0009276", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009276", "name": "Von Willebrand Factor receptor deficiency", "description": "" }, { "id": "MONDO:0009276", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009276", "name": "bleeding disorder, Platelet-type, 1", "description": "" }, { "id": "MONDO:0009276", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009276", "name": "deficiency of platelet glycoprotein 1b", "description": "" }, { "id": "MONDO:0009276", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009276", "name": "giant platelet disease", "description": "" }, { "id": "MONDO:0009276", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009276", "name": "glycoprotein Ib, Platelet, deficiency of", "description": "" }, { "id": "MONDO:0009276", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009276", "name": "macrothrombocytopenia, familial Bernard-Soulier type", "description": "" }, { "id": "MIM:231200", "resource": "MIM", "url": "https://www.omim.org/entry/231200", "name": "Bernard-Soulier syndrome", "description": "Bernard-Soulier syndrome" } ], "evidence": [ { "id": "231200", "database": "MIM", "url": "https://www.omim.org/entry/231200" } ] } ], "snv": [ { "evidence": [ { "id": "rs753093914", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753093914" }, { "id": "rs753093914", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753093914" }, { "id": "rs753093914", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753093914" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 204, "end_pos": 204, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DES->NES).", "chr_id": "22", "chr_pos": "19724453", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D204", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs868269107", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs868269107" }, { "id": "rs868269107", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs868269107#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 56, "end_pos": 56, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DTT->NTT).", "chr_id": "22", "chr_pos": "19724009", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D56", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1177794833", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1177794833" }, { "id": "rs1177794833", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1177794833#frequency_tab" }, { "id": "rs1177794833", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1177794833" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 66, "end_pos": 66, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "22", "chr_pos": "19724041", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N66", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1601248530", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1601248530" }, { "id": "rs1601248530", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1601248530" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 68, "end_pos": 68, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->NLM).", "chr_id": "22", "chr_pos": "19724046", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T68", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1352034307", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1352034307" }, { "id": "rs1352034307", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1352034307#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 83, "end_pos": 83, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "22", "chr_pos": "19724091", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T83", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "70.01", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000203618", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000203618" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "16.41", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000203618", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000203618" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "43.33", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000203618", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000203618" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "39.95", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000203618", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000203618" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "54.49", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000203618", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000203618" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "48.91", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000203618", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000203618" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "48.11", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000203618", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000203618" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "62.29", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000203618", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000203618" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "52.38", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000203618", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000203618" } ] } ], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" } ], "common_name": "Human" } ], "gene": [ { "name": "GP1BB", "url": "https://www.uniprot.org/uniprot/P13224", "locus": { "chromosome": "22", "start_pos": 6232, "end_pos": 5001, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "LRG_478", "url": "https://www.ensembl.org/id/LRG_478" } ] } } ], "crossref": [ { "id": "ENSG00000203618", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000203618", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "GP1BB", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GP1BB", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "2812", "url": "https://www.ncbi.nlm.nih.gov/gene/2812", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "4440", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4440", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P13224", "url": "https://www.ebi.ac.uk/intact/interactors/id:P13224*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000372", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000372", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000483", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000483", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032675", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032675", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:2812", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2812", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "138720", "url": "http://www.omim.org/entry/138720", "database": "MIM", "categories": [ "Other" ] }, { "id": "231200", "url": "http://www.omim.org/entry/231200", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P13224", "url": "https://www.nextprot.org/entry/NX_P13224", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "HLQGRII", "url": "https://omabrowser.org/oma/group/HLQGRII/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5356136at2759", "url": "http://www.orthodb.org/?query=5356136at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR22650", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22650", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR22650:SF7", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22650:SF7", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3REZ", "url": "https://www.rcsb.org/structure/3REZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3RFE", "url": "https://www.rcsb.org/structure/3RFE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "P13224", "url": "https://pharos.nih.gov/targets/P13224", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P13224", "url": "http://purl.obolibrary.org/obo/PR_P13224", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-430116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-430116", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-75892", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75892", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-76009", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76009", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9673221", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673221", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9845620", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845620", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9846298", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9846298", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000398", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000398", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P13224", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13224-1", "url": "https://www.uniprot.org/uniprot/P13224-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13224-2", "url": "https://www.uniprot.org/uniprot/P13224-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGSGPRGALSLLLLLLAPPSRPAAGCPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES", "length": 206, "header": "sp|P13224-1|GP1BB_HUMAN Isoform 1 of Platelet glycoprotein Ib beta chain OS=Homo sapiens OX=9606 GN=GP1BB PE=1 SV=1 CANONICAL=P13224-1" }, "isoforms": [ { "isoform_ac": "P13224-1", "url": "", "sequence": { "sequence": "MGSGPRGALSLLLLLLAPPSRPAAGCPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES", "length": 206, "header": "sp|P13224-1|GP1BB_HUMAN Isoform 1 of Platelet glycoprotein Ib beta chain OS=Homo sapiens OX=9606 GN=GP1BB PE=1 SV=1 CANONICAL=P13224-1" }, "locus": { "chromosome": "22", "start_pos": 19724461, "end_pos": 19723570, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000366425.4", "url": "https://www.ensembl.org/id/ENST00000366425.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000383382.2", "url": "https://www.ensembl.org/id/ENSP00000383382.2" } ] } }, { "isoform_ac": "P13224-2", "url": "", "sequence": { "sequence": "MIPSRHTMLRFLPVVNAASCPGDRRTMLVNVAAGVRVLRVPLRAGGSGSLSGLRPPAIVCYLPLQRASAASGLFLARPQHCGRCGRGRGGAALSLGSPAYASRCRVSRAAVFSPWAPVSLESGRAPGCSLGRPGLRGALVVWLQLGETWVRLRGDFQPACGVVRVERLAGYRDAGHQGLDGAGPAVWVLRDVAQVPADRSAYCGASLAGPRGALSLLLLLLAPPSRPAAGCPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES", "length": 411, "header": "sp|P13224-2|GP1BB_HUMAN Isoform 2 of Platelet glycoprotein Ib beta chain OS=Homo sapiens OX=9606 GN=GP1BB PE=1 SV=1 CANONICAL=P13224-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 65, "start_aa": "Asn", "end_pos": 65, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn65", "evidence": [ { "id": "3RFE", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3RFE" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 66, "start_aa": "Asn", "end_pos": 66, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn66", "evidence": [ { "id": "P13224", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13224#ptm_processing" }, { "id": "21908432", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21908432" }, { "id": "3353370", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/3353370" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 83, "start_aa": "Thr", "end_pos": 83, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr83", "evidence": [ { "id": "P13224", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "TAHLGANPWR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 83, "start_aa": "Thr", "end_pos": 92, "end_aa": "Arg", "evidence": [ { "id": "P13224", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] } ], "phosphorylation": [ { "start_pos": 191, "end_pos": 191, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P13224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13224" }, { "database": "PubMed", "id": "18088087", "url": "https://glygen.org/publication/PubMed/18088087" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" }, { "database": "PubMed", "id": "2504723", "url": "https://glygen.org/publication/PubMed/2504723" } ], "site_lbl": "Ser191" }, { "start_pos": 191, "end_pos": 191, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" }, { "database": "phospho.ELM", "id": "P13224", "url": "http://phospho.elm.eu.org/byAccession/P13224.html" }, { "database": "iPTMnet", "id": "P13224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13224" }, { "database": "PubMed", "id": "18088087", "url": "https://glygen.org/publication/PubMed/18088087" }, { "database": "PubMed", "id": "2504723", "url": "https://glygen.org/publication/PubMed/2504723" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ], "site_lbl": "Ser191" }, { "start_pos": 193, "end_pos": 193, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "18088087", "url": "https://glygen.org/publication/PubMed/18088087" }, { "database": "iPTMnet", "id": "P13224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13224" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" }, { "database": "phospho.ELM", "id": "P13224", "url": "http://phospho.elm.eu.org/byAccession/P13224.html" } ], "site_lbl": "Thr193" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "P13224", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "Cytoplasmic domains of GpIbalpha and GpIbbeta regulate 14-3-3zeta binding to GpIb/IX/V.", "journal": "Blood", "date": "2000", "authors": "Feng S, Christodoulides N, Resendiz JC, Berndt MC, Kroll MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-430116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-430116" } ], "reference": [ { "type": "PubMed", "id": "10627461", "url": "https://glygen.org/publication/PubMed/10627461" } ] }, { "title": "Mechanisms for the involvement of high molecular weight kininogen in surface-dependent reactions of Hageman factor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1976", "authors": "Griffin JH, Cochrane CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "1066663", "url": "https://glygen.org/publication/PubMed/1066663" } ] }, { "title": "Thrombin-mediated feedback activation of factor XI on the activated platelet surface is preferred over contact activation by factor XIIa or factor XIa.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Baglia FA, Walsh PN", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "10781579", "url": "https://glygen.org/publication/PubMed/10781579" } ] }, { "title": "Phosphoinositide 3-kinase forms a complex with platelet membrane glycoprotein Ib-IX-V complex and 14-3-3zeta.", "journal": "Blood", "date": "2000", "authors": "Munday AD, Berndt MC, Mitchell CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-430116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-430116" } ], "reference": [ { "type": "PubMed", "id": "10887121", "url": "https://glygen.org/publication/PubMed/10887121" } ] }, { "title": "Factor XII-dependent contact activation on endothelial cells and binding proteins gC1qR and cytokeratin 1.", "journal": "Thrombosis and haemostasis", "date": "2001", "authors": "Joseph K, Shibayama Y, Ghebrehiwet B, Kaplan AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "11204562", "url": "https://glygen.org/publication/PubMed/11204562" } ] }, { "title": "Model for a factor IX activation complex on blood platelets: dimeric conformation of factor XIa is essential.", "journal": "Blood", "date": "2001", "authors": "Gailani D, Ho D, Sun MF, Cheng Q, Walsh PN", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "11342438", "url": "https://glygen.org/publication/PubMed/11342438" } ] }, { "title": "Factor XI binding to the platelet glycoprotein Ib-IX-V complex promotes factor XI activation by thrombin.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Baglia FA, Badellino KO, Li CQ, Lopez JA, Walsh PN", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "11696542", "url": "https://glygen.org/publication/PubMed/11696542" } ] }, { "title": "Interaction between platelet glycoprotein Ibalpha and filamin-1 is essential for glycoprotein Ib/IX receptor anchorage at high shear.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Williamson D, Pikovski I, Cranmer SL, Mangin P, Mistry N, Domagala T, Chehab S, Lanza F, Salem HH, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-430116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-430116" } ], "reference": [ { "type": "PubMed", "id": "11700320", "url": "https://glygen.org/publication/PubMed/11700320" } ] }, { "title": "Identification and characterization of prolylcarboxypeptidase as an endothelial cell prekallikrein activator.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Shariat-Madar Z, Mahdi F, Schmaier AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "11830581", "url": "https://glygen.org/publication/PubMed/11830581" } ] }, { "title": "Bivalirudin: a direct thrombin inhibitor.", "journal": "Clinical therapeutics", "date": "2002", "authors": "Gladwell TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "11833835", "url": "https://glygen.org/publication/PubMed/11833835" } ] }, { "title": "Association of Fyn and Lyn with the proline-rich domain of glycoprotein VI regulates intracellular signaling.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Suzuki-Inoue K, Tulasne D, Shen Y, Bori-Sanz T, Inoue O, Jung SM, Moroi M, Andrews RK, Berndt MC, Watson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-75892", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75892" } ], "reference": [ { "type": "PubMed", "id": "11943772", "url": "https://glygen.org/publication/PubMed/11943772" } ] }, { "title": "Factor XII interacts with the multiprotein assembly of urokinase plasminogen activator receptor, gC1qR, and cytokeratin 1 on endothelial cell membranes.", "journal": "Blood", "date": "2002", "authors": "Mahdi F, Madar ZS, Figueroa CD, Schmaier AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "11986212", "url": "https://glygen.org/publication/PubMed/11986212" } ] }, { "title": "Identification of prolylcarboxypeptidase as the cell matrix-associated prekallikrein activator.", "journal": "FEBS letters", "date": "2002", "authors": "Moreira CR, Schmaier AH, Mahdi F, da Motta G, Nader HB, Shariat-Madar Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "12123826", "url": "https://glygen.org/publication/PubMed/12123826" } ] }, { "title": "Localization of the adhesion receptor glycoprotein Ib-IX-V complex to lipid rafts is required for platelet adhesion and activation.", "journal": "The Journal of experimental medicine", "date": "2002", "authors": "Shrimpton CN, Borthakur G, Larrucea S, Cruz MA, Dong JF, Lopez JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "12391017", "url": "https://glygen.org/publication/PubMed/12391017" } ] }, { "title": "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.", "journal": "Nat. Biotechnol.", "date": "2003", "authors": "Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" } ], "reference": [ { "type": "PubMed", "id": "12665801", "url": "https://glygen.org/publication/PubMed/12665801" } ] }, { "title": "Crystal structure of the GpIbalpha-thrombin complex essential for platelet aggregation.", "journal": "Science (New York, N.Y.)", "date": "2003", "authors": "Dumas JJ, Kumar R, Seehra J, Somers WS, Mosyak L", "evidence": [ { "database": "Reactome", "id": "R-HSA-76009", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76009" } ], "reference": [ { "type": "PubMed", "id": "12855811", "url": "https://glygen.org/publication/PubMed/12855811" } ] }, { "title": "The relative priority of prekallikrein and factors XI/XIa assembly on cultured endothelial cells.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Mahdi F, Shariat-Madar Z, Schmaier AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "12944405", "url": "https://glygen.org/publication/PubMed/12944405" } ] }, { "title": "Identification of a novel point mutation in platelet glycoprotein Ibalpha, Gly to Ser at residue 233, in a Japanese family with platelet-type von Willebrand disease.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2003", "authors": "Matsubara Y, Murata M, Sugita K, Ikeda Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845620", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845620" } ], "reference": [ { "type": "PubMed", "id": "14521605", "url": "https://glygen.org/publication/PubMed/14521605" } ] }, { "title": "The physiologic basis of assembly and activation of the plasma kallikrein/kinin system.", "journal": "Thrombosis and haemostasis", "date": "2004", "authors": "Schmaier AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "14691562", "url": "https://glygen.org/publication/PubMed/14691562" } ] }, { "title": "Recombinant prolylcarboxypeptidase activates plasma prekallikrein.", "journal": "Blood", "date": "2004", "authors": "Shariat-Madar Z, Mahdi F, Schmaier AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "14996700", "url": "https://glygen.org/publication/PubMed/14996700" } ] }, { "title": "Platelet GPIb-IX-V-dependent signaling.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2005", "authors": "Ozaki Y, Asazuma N, Suzuki-Inoue K, Berndt MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-430116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-430116" } ], "reference": [ { "type": "PubMed", "id": "16102041", "url": "https://glygen.org/publication/PubMed/16102041" } ] }, { "title": "GPVI and integrin alphaIIb beta3 signaling in platelets.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2005", "authors": "Watson SP, Auger JM, McCarty OJ, Pearce AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-75892", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75892" } ], "reference": [ { "type": "PubMed", "id": "16102042", "url": "https://glygen.org/publication/PubMed/16102042" } ] }, { "title": "Characterization of the interaction between the A2 subunit and A1/A3-C1-C2 dimer in human factor VIIIa.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Fay PJ, Smudzin TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "1618828", "url": "https://glygen.org/publication/PubMed/1618828" } ] }, { "title": "Glycoprotein Ibalpha forms disulfide bonds with 2 glycoprotein Ibbeta subunits in the resting platelet.", "journal": "Blood", "date": "2007", "authors": "Luo Shi-Zhong, Mo Xi, Afshar-Kharghan Vahid, Srinivasan Sankaranarayanan, L\u00f3pez Jos\u00e9 A, Li Renhao", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" } ], "reference": [ { "type": "PubMed", "id": "17008541", "url": "https://glygen.org/publication/PubMed/17008541" } ] }, { "title": "Glycoproteins V and Ib-IX form a noncovalent complex in the platelet membrane.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Modderman PW, Admiraal LG, Sonnenberg A, von dem Borne AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "1730602", "url": "https://glygen.org/publication/PubMed/1730602" } ] }, { "title": "The pharmacokinetics, pharmacodynamics and tolerability of dabigatran etexilate, a new oral direct thrombin inhibitor, in healthy male subjects.", "journal": "British journal of clinical pharmacology", "date": "2007", "authors": "Stangier J, Rathgen K, Stahle H, Gansser D, Roth W", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "17506785", "url": "https://glygen.org/publication/PubMed/17506785" } ] }, { "title": "In-vitro profile and ex-vivo anticoagulant activity of the direct thrombin inhibitor dabigatran and its orally active prodrug, dabigatran etexilate.", "journal": "Thrombosis and haemostasis", "date": "2007", "authors": "Wienen W, Stassen JM, Priepke H, Ries UJ, Hauel N", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "17598008", "url": "https://glygen.org/publication/PubMed/17598008" } ] }, { "title": "Phosphoproteome of resting human platelets.", "journal": "Journal of proteome research", "date": "2008", "authors": "Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" }, { "database": "iPTMnet", "id": "P13224-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13224-1" } ], "reference": [ { "type": "PubMed", "id": "18088087", "url": "https://glygen.org/publication/PubMed/18088087" } ] }, { "title": "Human factor VIIIa subunit structure. Reconstruction of factor VIIIa from the isolated A1/A3-C1-C2 dimer and A2 subunit.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Fay PJ, Haidaris PJ, Smudzin TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "1902833", "url": "https://glygen.org/publication/PubMed/1902833" } ] }, { "title": "Inhibition of the thrombin-platelet reactions by DuP 714.", "journal": "Biochemical and biophysical research communications", "date": "1991", "authors": "Chiu AT, Mousa SA, Pease LJ, Roscoe WA, Bozarth JM, Reilly TM, Smith RD, Timmermans PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "1930190", "url": "https://glygen.org/publication/PubMed/1930190" } ] }, { "title": "Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.", "journal": "J. Proteome Res.", "date": "2008", "authors": "Carrascal M, Ovelleiro D, Casas V, Gay M, Abian J", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" } ], "reference": [ { "type": "PubMed", "id": "19367720", "url": "https://glygen.org/publication/PubMed/19367720" } ] }, { "title": "von Willebrand factor binding to platelet GpIb initiates signals for platelet activation.", "journal": "The Journal of clinical investigation", "date": "1991", "authors": "Kroll MH, Harris TS, Moake JL, Handin RI, Schafer AI", "evidence": [ { "database": "Reactome", "id": "R-HSA-430116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-430116" } ], "reference": [ { "type": "PubMed", "id": "1939645", "url": "https://glygen.org/publication/PubMed/1939645" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P13224-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13224-1" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Location of the disulfide bonds in human coagulation factor XI: the presence of tandem apple domains.", "journal": "Biochemistry", "date": "1991", "authors": "McMullen BA, Fujikawa K, Davie EW", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "1998667", "url": "https://glygen.org/publication/PubMed/1998667" } ] }, { "title": "Exploring the human leukocyte phosphoproteome using a microfluidic reversed-phase-TiO2-reversed-phase high-performance liquid chromatography phosphochip coupled to a quadrupole time-of-flight mass spectrometer.", "journal": "Analytical chemistry", "date": "2010", "authors": "Raijmakers R, Kraiczek K, de Jong AP, Mohammed S, Heck AJ", "evidence": [ { "database": "iPTMnet", "id": "P13224-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13224-1" } ], "reference": [ { "type": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" } ] }, { "title": "The role of von Willebrand factor and fibrinogen in platelet aggregation under varying shear stress.", "journal": "The Journal of clinical investigation", "date": "1991", "authors": "Ikeda Y, Handa M, Kawano K, Kamata T, Murata M, Araki Y, Anbo H, Kawai Y, Watanabe K, Itagaki I, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-430116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-430116" } ], "reference": [ { "type": "PubMed", "id": "2010539", "url": "https://glygen.org/publication/PubMed/2010539" } ] }, { "title": "Phosphoproteome analysis of human liver tissue by long-gradient nanoflow LC coupled with multiple stage MS analysis.", "journal": "Electrophoresis", "date": "2010", "authors": "Han G, Ye M, Liu H, Song C, Sun D, Wu Y, Jiang X, Chen R, Wang C, Wang L, Zou H", "evidence": [ { "database": "iPTMnet", "id": "P13224-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13224-1" } ], "reference": [ { "type": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ] }, { "title": "Activation of human blood coagulation factor XI independent of factor XII. Factor XI is activated by thrombin and factor XIa in the presence of negatively charged surfaces.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Naito K, Fujikawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "2019570", "url": "https://glygen.org/publication/PubMed/2019570" } ] }, { "title": "Mutation in the gene encoding the alpha chain of platelet glycoprotein Ib in platelet-type von Willebrand disease.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Miller JL, Cunningham D, Lyle VA, Finch CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845620", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845620" } ], "reference": [ { "type": "PubMed", "id": "2052556", "url": "https://glygen.org/publication/PubMed/2052556" } ] }, { "title": "TNF receptor-associated factor 4 (TRAF4) is a novel binding partner of glycoprotein Ib and glycoprotein VI in human platelets.", "journal": "J. Thromb. Haemost.", "date": "2011", "authors": "Arthur J F, Shen Y, Gardiner E E, Coleman L, Murphy D, Kenny D, Andrews R K, Berndt M C", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" } ], "reference": [ { "type": "PubMed", "id": "20946164", "url": "https://glygen.org/publication/PubMed/20946164" } ] }, { "title": "Binding of human factor VIII to phospholipid vesicles.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Gilbert GE, Furie BC, Furie B", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "2104832", "url": "https://glygen.org/publication/PubMed/2104832" } ] }, { "title": "Kinetics of coagulation factor X activation by platelet-bound factor IXa.", "journal": "Biochemistry", "date": "1990", "authors": "Rawala-Sheikh R, Ahmad SS, Ashby B, Walsh PN", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "2110473", "url": "https://glygen.org/publication/PubMed/2110473" } ] }, { "title": "Mutations in hemophilia Bm occur at the Arg180-Val activation site or in the catalytic domain of factor IX.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Bertina RM, van der Linden IK, Mannucci PM, Reinalda-Poot HH, Cupers R, Poort SR, Reitsma PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673221", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673221" } ], "reference": [ { "type": "PubMed", "id": "2162822", "url": "https://glygen.org/publication/PubMed/2162822" } ] }, { "title": "Analysis of serpin secretion, misfolding, and surveillance in the endoplasmic reticulum.", "journal": "Methods in enzymology", "date": "2011", "authors": "Pan S, Iannotti MJ, Sifers RN", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "21683246", "url": "https://glygen.org/publication/PubMed/21683246" } ] }, { "title": "Quaternary organization of GPIb-IX complex and insights into Bernard-Soulier syndrome revealed by the structures of GPIbbeta and a GPIbbeta/GPIX chimera.", "journal": "Blood", "date": "2011", "authors": "McEwan PA, Yang W, Carr KH, Mo X, Zheng X, Li R, Emsley J", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224#ptm_processing" }, { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" } ], "reference": [ { "type": "PubMed", "id": "21908432", "url": "https://glygen.org/publication/PubMed/21908432" } ] }, { "title": "Desirudin: a review of the pharmacology and clinical application for the prevention of deep vein thrombosis.", "journal": "Expert review of cardiovascular therapy", "date": "2011", "authors": "Graetz TJ, Tellor BR, Smith JR, Avidan MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "21932952", "url": "https://glygen.org/publication/PubMed/21932952" } ] }, { "title": "A sequential mechanism for exosite-mediated factor IX activation by factor XIa.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Geng Y, Verhamme IM, Messer A, Sun MF, Smith SB, Bajaj SP, Gailani D", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "22961984", "url": "https://glygen.org/publication/PubMed/22961984" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" }, { "database": "iPTMnet", "id": "P13224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13224" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "P13224", "url": "" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "Clot-bound thrombin is protected from inhibition by heparin-antithrombin III but is susceptible to inactivation by antithrombin III-independent inhibitors.", "journal": "The Journal of clinical investigation", "date": "1990", "authors": "Weitz JI, Hudoba M, Massel D, Maraganore J, Hirsh J", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "2384594", "url": "https://glygen.org/publication/PubMed/2384594" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" }, { "database": "iPTMnet", "id": "P13224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13224" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "In situ-generated thrombin is the only enzyme that effectively activates factor VIII and factor V in thromboplastin-activated plasma.", "journal": "Blood", "date": "1989", "authors": "Pieters J, Lindhout T, Hemker HC", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "2502206", "url": "https://glygen.org/publication/PubMed/2502206" } ] }, { "title": "Platelet glycoprotein Ib beta is phosphorylated on serine 166 by cyclic AMP-dependent protein kinase.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Wardell MR, Reynolds CC, Berndt MC, Wallace RW, Fox JE", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" }, { "database": "iPTMnet", "id": "P13224-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13224-1" } ], "reference": [ { "type": "PubMed", "id": "2504723", "url": "https://glygen.org/publication/PubMed/2504723" } ] }, { "title": "Differential proteolytic activation of factor VIII-von Willebrand factor complex by thrombin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Hill-Eubanks DC, Parker CG, Lollar P", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "2505252", "url": "https://glygen.org/publication/PubMed/2505252" } ] }, { "title": "The regulation of human factor XIIa by plasma proteinase inhibitors.", "journal": "The Journal of biological chemistry", "date": "1985", "authors": "Pixley RA, Schapira M, Colman RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "2578463", "url": "https://glygen.org/publication/PubMed/2578463" } ] }, { "title": "Distribution of plasma kallikrein between C-1 inactivator and alpha 2-macroglobulin in plasma utilizing a new assay for alpha 2-macroglobulin-kallikrein complexes.", "journal": "The Journal of biological chemistry", "date": "1985", "authors": "Harpel PC, Lewin MF, Kaplan AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "2579948", "url": "https://glygen.org/publication/PubMed/2579948" } ] }, { "title": "Blood clotting factor IX BM Nagoya. Substitution of arginine 180 by tryptophan and its activation by alpha-chymotrypsin and rat mast cell chymase.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Suehiro K, Kawabata S, Miyata T, Takeya H, Takamatsu J, Ogata K, Kamiya T, Saito H, Niho Y, Iwanaga S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673221", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673221" } ], "reference": [ { "type": "PubMed", "id": "2592373", "url": "https://glygen.org/publication/PubMed/2592373" } ] }, { "title": "Factor VIII Is Synthesized in Human Endothelial Cells, Packaged in Weibel-Palade Bodies and Secreted Bound to ULVWF Strings.", "journal": "PloS one", "date": "2015", "authors": "Turner NA, Moake JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "26473492", "url": "https://glygen.org/publication/PubMed/26473492" } ] }, { "title": "Functional consequences of an arginine180 to glutamine mutation in factor IX Hilo.", "journal": "Blood", "date": "1989", "authors": "Monroe DM, McCord DM, Huang MN, High KA, Lundblad RL, Kasper CK, Roberts HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673221", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673221" } ], "reference": [ { "type": "PubMed", "id": "2713493", "url": "https://glygen.org/publication/PubMed/2713493" } ] }, { "title": "Factor IX San Dimas. Substitution of glutamine for Arg-4 in the propeptide leads to incomplete gamma-carboxylation and altered phospholipid binding properties.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Ware J, Diuguid DL, Liebman HA, Rabiet MJ, Kasper CK, Furie BC, Furie B, Stafford DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673221", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673221" } ], "reference": [ { "type": "PubMed", "id": "2738071", "url": "https://glygen.org/publication/PubMed/2738071" } ] }, { "title": "Molecular defects of factor IX Chicago-2 (Arg 145----His) and prothrombin Madrid (Arg 271----cys): arginine mutations that preclude zymogen activation.", "journal": "Blood", "date": "1989", "authors": "Diuguid DL, Rabiet MJ, Furie BC, Furie B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673221", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673221" } ], "reference": [ { "type": "PubMed", "id": "2752109", "url": "https://glygen.org/publication/PubMed/2752109" } ] }, { "title": "Factor IX Cardiff: a variant factor IX protein that shows abnormal activation is caused by an arginine to cysteine substitution at position 145.", "journal": "British journal of haematology", "date": "1989", "authors": "Liddell MB, Peake IR, Taylor SA, Lillicrap DP, Giddings JC, Bloom AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673221", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673221" } ], "reference": [ { "type": "PubMed", "id": "2775660", "url": "https://glygen.org/publication/PubMed/2775660" } ] }, { "title": "Defective propeptide processing and abnormal activation underlie the molecular pathology of factor IX Troed-y-Rhiw.", "journal": "British journal of haematology", "date": "1989", "authors": "Liddell MB, Lillicrap DP, Peake IR, Bloom AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673221", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673221" } ], "reference": [ { "type": "PubMed", "id": "2788012", "url": "https://glygen.org/publication/PubMed/2788012" } ] }, { "title": "Purification and properties of prolylcarboxypeptidase (angiotensinase C) from human kidney.", "journal": "The Journal of biological chemistry", "date": "1978", "authors": "Odya CE, Marinkovic DV, Hammon KJ, Stewart TA, Erdos EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "28321", "url": "https://glygen.org/publication/PubMed/28321" } ] }, { "title": "An update on factor XI structure and function.", "journal": "Thrombosis research", "date": "2018", "authors": "Mohammed BM, Matafonov A, Ivanov I, Sun MF, Cheng Q, Dickeson SK, Li C, Sun D, Verhamme IM, Emsley J, Gailani D", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "29223926", "url": "https://glygen.org/publication/PubMed/29223926" } ] }, { "title": "Defective propeptide processing of blood clotting factor IX caused by mutation of arginine to glutamine at position -4.", "journal": "Cell", "date": "1986", "authors": "Bentley AK, Rees DJ, Rizza C, Brownlee GG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673221", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673221" } ], "reference": [ { "type": "PubMed", "id": "3009023", "url": "https://glygen.org/publication/PubMed/3009023" } ] }, { "title": "Binding of coagulation factor XI to washed human platelets.", "journal": "Biochemistry", "date": "1986", "authors": "Greengard JS, Heeb MJ, Ersdal E, Walsh PN, Griffin JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3017409", "url": "https://glygen.org/publication/PubMed/3017409" } ] }, { "title": "Proteolytic processing of human factor VIII. Correlation of specific cleavages by thrombin, factor Xa, and activated protein C with activation and inactivation of factor VIII coagulant activity.", "journal": "Biochemistry", "date": "1986", "authors": "Eaton D, Rodriguez H, Vehar GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3082357", "url": "https://glygen.org/publication/PubMed/3082357" } ] }, { "title": "Biosynthesis of complement C1 inhibitor by Hep G2 cells. Reactivity of different glycosylated forms of the inhibitor with C1s.", "journal": "The Biochemical journal", "date": "1986", "authors": "Prandini MH, Reboul A, Colomb MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3099750", "url": "https://glygen.org/publication/PubMed/3099750" } ] }, { "title": "Synthesis, processing, and secretion of recombinant human factor VIII expressed in mammalian cells.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Kaufman RJ, Wasley LC, Dorner AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3129422", "url": "https://glygen.org/publication/PubMed/3129422" } ] }, { "title": "Association of the factor VIII light chain with von Willebrand factor.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Lollar P, Hill-Eubanks DC, Parker CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3134349", "url": "https://glygen.org/publication/PubMed/3134349" } ] }, { "title": "On the association of glycoprotein Ib and actin-binding protein in human platelets.", "journal": "The Journal of cell biology", "date": "1985", "authors": "Okita JR, Pidard D, Newman PJ, Montgomery RR, Kunicki TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-430116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-430116" } ], "reference": [ { "type": "PubMed", "id": "3155520", "url": "https://glygen.org/publication/PubMed/3155520" } ] }, { "title": "The alpha and beta chains of human platelet glycoprotein Ib are both transmembrane proteins containing a leucine-rich amino acid sequence.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1988", "authors": "Lopez JA, Chung DW, Fujikawa K, Hagen FS, Davie EW, Roth GJ", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224#ptm_processing" }, { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" } ], "reference": [ { "type": "PubMed", "id": "3353370", "url": "https://glygen.org/publication/PubMed/3353370" } ] }, { "title": "A novel frameshift GP1BB mutation causes autosomal dominant macrothrombocytopenia with decreased vWF receptor expression but normal platelet aggregation.", "journal": "Platelets", "date": "2022", "authors": "Dunstan-Harrison C, Morison IM, Ledgerwood EC", "evidence": [ { "database": "RefSeq", "id": "NP_000398", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000398" } ], "reference": [ { "type": "PubMed", "id": "33813986", "url": "https://glygen.org/publication/PubMed/33813986" } ] }, { "title": "A Novel Mutation in GP1BB Reveals the Role of the Cytoplasmic Domain of GPIbbeta in the Pathophysiology of Bernard-Soulier Syndrome and GPIb-IX Complex Assembly.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Barozzi S, Bozzi V, De Rocco D, Giangregorio T, Noris P, Savoia A, Pecci A", "evidence": [ { "database": "RefSeq", "id": "NP_000398", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000398" } ], "reference": [ { "type": "PubMed", "id": "34638529", "url": "https://glygen.org/publication/PubMed/34638529" } ] }, { "title": "Completion of the primary structure of human high-molecular-mass kininogen. The amino acid sequence of the entire heavy chain and evidence for its evolution by gene triplication.", "journal": "European journal of biochemistry", "date": "1986", "authors": "Kellermann J, Lottspeich F, Henschen A, Muller-Esterl W", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3484703", "url": "https://glygen.org/publication/PubMed/3484703" } ] }, { "title": "Human plasma prekallikrein, a zymogen to a serine protease that contains four tandem repeats.", "journal": "Biochemistry", "date": "1986", "authors": "Chung DW, Fujikawa K, McMullen BA, Davie EW", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3521732", "url": "https://glygen.org/publication/PubMed/3521732" } ] }, { "title": "Amino acid sequence of human von Willebrand factor.", "journal": "Biochemistry", "date": "1986", "authors": "Titani K, Kumar S, Takio K, Ericsson LH, Wade RD, Ashida K, Walsh KA, Chopek MW, Sadler JE, Fujikawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3524673", "url": "https://glygen.org/publication/PubMed/3524673" } ] }, { "title": "Biological, clinical features and modelling of heterozygous variants of glycoprotein Ib platelet subunit alpha (GP1BA) and glycoprotein Ib platelet subunit beta (GP1BB) genes responsible for constitutional thrombocytopenia.", "journal": "British journal of haematology", "date": "2022-12", "authors": "Dib Fatema, Qu\u00e9m\u00e9ner Agn\u00e8s, Bayart Sophie, Boisseau Pierre, Babuty Antoine, Trossa\u00ebrt Marc, Sigaud Marianne, Ternisien Catherine, Drillaud Nicolas, Eveillard Marion, Guillet Benoit, B\u00e9n\u00e9 Marie C, Fouassier Marc", "evidence": [ { "database": "RefSeq", "id": "NP_000398", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000398" } ], "reference": [ { "type": "PubMed", "id": "36173017", "url": "https://glygen.org/publication/PubMed/36173017" } ] }, { "title": "Isolation and characterization of the alpha and beta chains of human platelet glycoprotein Ib.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1987", "authors": "Canfield V A, Ozols J, Nugent D, Roth G J", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" } ], "reference": [ { "type": "PubMed", "id": "3632685", "url": "https://glygen.org/publication/PubMed/3632685" } ] }, { "title": "GP1BB c.179C\u2009>\u2009T is the most frequent cause of monoallelic Bernard-Soulier syndrome in the Italian population after the Bolzano variant: a report of two new families.", "journal": "Annals of hematology", "date": "2022-12-21", "authors": "Barozzi Serena, Pecci Alessandro, Marinoni Maddalena, Fontana Giorgia, Zanchetta Melania Eva, Noris Patrizia, Savoia Anna, Faleschini Michela", "evidence": [ { "database": "RefSeq", "id": "NP_000398", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000398" } ], "reference": [ { "type": "PubMed", "id": "36539614", "url": "https://glygen.org/publication/PubMed/36539614" } ] }, { "title": "Expression, purification, and characterization of recombinant gamma-carboxylated factor IX synthesized in Chinese hamster ovary cells.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Kaufman RJ, Wasley LC, Furie BC, Furie B, Shoemaker CB", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3733688", "url": "https://glygen.org/publication/PubMed/3733688" } ] }, { "title": "Human C1 inhibitor: primary structure, cDNA cloning, and chromosomal localization.", "journal": "Biochemistry", "date": "1986", "authors": "Bock SC, Skriver K, Nielsen E, Thogersen HC, Wiman B, Donaldson VH, Eddy RL, Marrinan J, Radziejewska E, Huber R, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3756141", "url": "https://glygen.org/publication/PubMed/3756141" } ] }, { "title": "Factor VIII/von Willebrand factor in subendothelium mediates platelet adhesion.", "journal": "Blood", "date": "1985", "authors": "Turitto VT, Weiss HJ, Zimmerman TS, Sussman II", "evidence": [ { "database": "Reactome", "id": "R-HSA-430116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-430116" } ], "reference": [ { "type": "PubMed", "id": "3872140", "url": "https://glygen.org/publication/PubMed/3872140" } ] }, { "title": "Amino acid sequence of the heavy chain of human alpha-factor XIIa (activated Hageman factor).", "journal": "The Journal of biological chemistry", "date": "1985", "authors": "McMullen BA, Fujikawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "3886654", "url": "https://glygen.org/publication/PubMed/3886654" } ] }, { "title": "The amino acid sequence of the light chain of human high-molecular-mass kininogen.", "journal": "European journal of biochemistry", "date": "1985", "authors": "Lottspeich F, Kellermann J, Henschen A, Foertsch B, Muller-Esterl W", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "4054110", "url": "https://glygen.org/publication/PubMed/4054110" } ] }, { "title": "The inhibition of plasmin, plasma kallikrein, plasma permeability factor, and the C'1r subcomponent of the first component of complement by serum C'1 esterase inhibitor.", "journal": "The Journal of experimental medicine", "date": "1969", "authors": "Ratnoff OD, Pensky J, Ogston D, Naff GB", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "4178758", "url": "https://glygen.org/publication/PubMed/4178758" } ] }, { "title": "Inhibition by C1INH of Hagemann factor fragment activation of coagulation, fibrinolysis, and kinin generation.", "journal": "The Journal of clinical investigation", "date": "1973", "authors": "Schreiber AD, Kaplan AP, Austen KF", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "4703226", "url": "https://glygen.org/publication/PubMed/4703226" } ] }, { "title": "Human high molecular weight kininogen. Studies of structure-function relationships and of proteolysis of the molecule occurring during contact activation of plasma.", "journal": "The Journal of biological chemistry", "date": "1979", "authors": "Kerbiriou DM, Griffin JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "500690", "url": "https://glygen.org/publication/PubMed/500690" } ] }, { "title": "Activation of human factor XI (plasma thromboplastin antecedent) by factor XIIa (activated Hageman factor).", "journal": "Biochemistry", "date": "1977", "authors": "Kurachi K, Davie EW", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "588558", "url": "https://glygen.org/publication/PubMed/588558" } ] }, { "title": "Primary structure of human alpha 2-macroglobulin. V. The complete structure.", "journal": "The Journal of biological chemistry", "date": "1984", "authors": "Sottrup-Jensen L, Stepanik TM, Kristensen T, Wierzbicki DM, Jones CM, Lonblad PB, Magnusson S, Petersen TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "6203908", "url": "https://glygen.org/publication/PubMed/6203908" } ] }, { "title": "Binding of human blood-coagulation Factors IXa and X to phospholipid membranes.", "journal": "The Biochemical journal", "date": "1984", "authors": "Mertens K, Cupers R, Van Wijngaarden A, Bertina RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "6334516", "url": "https://glygen.org/publication/PubMed/6334516" } ] }, { "title": "Structure of human factor VIII.", "journal": "Nature", "date": "1984", "authors": "Vehar GA, Keyt B, Eaton D, Rodriguez H, O'Brien DP, Rotblat F, Oppermann H, Keck R, Wood WI, Harkins RN, Tuddenham EG, Lawn RM, Capon DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "6438527", "url": "https://glygen.org/publication/PubMed/6438527" } ] }, { "title": "Amino acid sequence of human beta-factor XIIa.", "journal": "The Journal of biological chemistry", "date": "1983", "authors": "Fujikawa K, McMullen BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "6604055", "url": "https://glygen.org/publication/PubMed/6604055" } ] }, { "title": "Autoactivation of human Hageman factor. Demonstration utilizing a synthetic substrate.", "journal": "The Journal of biological chemistry", "date": "1980", "authors": "Silverberg M, Dunn JT, Garen L, Kaplan AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "7391081", "url": "https://glygen.org/publication/PubMed/7391081" } ] }, { "title": "Raf-1 interacts with Fyn and Src in a non-phosphotyrosine-dependent manner.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Cleghon V, Morrison DK", "evidence": [ { "database": "Reactome", "id": "R-HSA-430116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-430116" } ], "reference": [ { "type": "PubMed", "id": "7517401", "url": "https://glygen.org/publication/PubMed/7517401" } ] }, { "title": "Expression of the blood-clotting factor-VIII cDNA is repressed by a transcriptional silencer located in its coding region.", "journal": "Blood", "date": "1995", "authors": "Hoeben RC, Fallaux FJ, Cramer SJ, van den Wollenberg DJ, van Ormondt H, Briet E, van der Eb AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "7727775", "url": "https://glygen.org/publication/PubMed/7727775" } ] }, { "title": "The affinity and stoichiometry of binding of human factor VIII to von Willebrand factor.", "journal": "Blood", "date": "1995", "authors": "Vlot AJ, Koppelman SJ, van den Berg MH, Bouma BN, Sixma JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "7756647", "url": "https://glygen.org/publication/PubMed/7756647" } ] }, { "title": "Activation of Raf-1 by 14-3-3 proteins.", "journal": "Nature", "date": "1994", "authors": "Fantl WJ, Muslin AJ, Kikuchi A, Martin JA, MacNicol AM, Gross RW, Williams LT", "evidence": [ { "database": "Reactome", "id": "R-HSA-430116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-430116" } ], "reference": [ { "type": "PubMed", "id": "7935795", "url": "https://glygen.org/publication/PubMed/7935795" } ] }, { "title": "Structural characterization and chromosomal location of the gene encoding human platelet glycoprotein Ib beta.", "journal": "J. Biol. Chem.", "date": "1994", "authors": "Yagi M, Edelhoff S, Disteche CM, Roth GJ", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" } ], "reference": [ { "type": "PubMed", "id": "8021244", "url": "https://glygen.org/publication/PubMed/8021244" } ] }, { "title": "Association of a phospholipase A2 (14-3-3 protein) with the platelet glycoprotein Ib-IX complex.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Du X, Harris SJ, Tetaz TJ, Ginsberg MH, Berndt MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-430116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-430116" } ], "reference": [ { "type": "PubMed", "id": "8034572", "url": "https://glygen.org/publication/PubMed/8034572" } ] }, { "title": "Biology of factor IX.", "journal": "Blood coagulation & fibrinolysis : an international journal in haemostasis and thrombosis", "date": "1993", "authors": "Kurachi K, Kurachi S, Furukawa M, Yao SN", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "8148489", "url": "https://glygen.org/publication/PubMed/8148489" } ] }, { "title": "Isolation, cDNA cloning, and overexpression of a 33-kD cell surface glycoprotein that binds to the globular `heads` of C1q.", "journal": "The Journal of experimental medicine", "date": "1994", "authors": "Ghebrehiwet B, Lim BL, Peerschke EI, Willis AC, Reid KB", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "8195709", "url": "https://glygen.org/publication/PubMed/8195709" } ] }, { "title": "Complementary DNA cloning of the alternatively expressed endothelial cell glycoprotein Ib beta (GPIb beta) and localization of the GPIb beta gene to chromosome 22.", "journal": "J. Clin. Invest.", "date": "1994", "authors": "Kelly M D, Essex D W, Shapiro S S, Meloni F J, Druck T, Huebner K, Konkle B A", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" } ], "reference": [ { "type": "PubMed", "id": "8200976", "url": "https://glygen.org/publication/PubMed/8200976" } ] }, { "title": "Factor XII-independent activation of factor XI in plasma: effects of sulfatides on tissue factor-induced coagulation.", "journal": "Blood", "date": "1993", "authors": "Gailani D, Broze GJ Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "8338946", "url": "https://glygen.org/publication/PubMed/8338946" } ] }, { "title": "Sequencing and cloning of human prolylcarboxypeptidase (angiotensinase C). Similarity to both serine carboxypeptidase and prolylendopeptidase families.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Tan F, Morris PW, Skidgel RA, Erdos EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "8344943", "url": "https://glygen.org/publication/PubMed/8344943" } ] }, { "title": "Pseudo-von Willebrand disease: a mutation in the platelet glycoprotein Ib alpha gene associated with a hyperactive surface receptor.", "journal": "Blood", "date": "1993", "authors": "Russell SD, Roth GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845620", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845620" } ], "reference": [ { "type": "PubMed", "id": "8384898", "url": "https://glygen.org/publication/PubMed/8384898" } ] }, { "title": "Propeptide processing during factor IX biosynthesis. Effect of point mutations adjacent to the propeptide cleavage site.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Bristol JA, Furie BC, Furie B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673221", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673221" } ], "reference": [ { "type": "PubMed", "id": "8463288", "url": "https://glygen.org/publication/PubMed/8463288" } ] }, { "title": "Activation of the factor VIIIa-factor IXa enzyme complex of blood coagulation by membranes containing phosphatidyl-L-serine.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Gilbert GE, Arena AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "8626656", "url": "https://glygen.org/publication/PubMed/8626656" } ] }, { "title": "Identification of a binding sequence for the 14-3-3 protein within the cytoplasmic domain of the adhesion receptor, platelet glycoprotein Ib alpha.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Du X, Fox JE, Pei S", "evidence": [ { "database": "Reactome", "id": "R-HSA-430116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-430116" } ], "reference": [ { "type": "PubMed", "id": "8631758", "url": "https://glygen.org/publication/PubMed/8631758" } ] }, { "title": "Partial purification and characterization of a protease from human plasma cleaving von Willebrand factor to fragments produced by in vivo proteolysis.", "journal": "Blood", "date": "1996", "authors": "Furlan M, Robles R, Lammle B", "evidence": [ { "database": "Reactome", "id": "R-HSA-75892", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75892" } ], "reference": [ { "type": "PubMed", "id": "8639781", "url": "https://glygen.org/publication/PubMed/8639781" } ] }, { "title": "Identification of the zinc-dependent endothelial cell binding protein for high molecular weight kininogen and factor XII: identity with the receptor that binds to the globular `heads` of C1q (gC1q-R).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Joseph K, Ghebrehiwet B, Peerschke EI, Reid KB, Kaplan AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "8710908", "url": "https://glygen.org/publication/PubMed/8710908" } ] }, { "title": "Activation and function of human Hageman factor. The role of high molecular weight kininogen and prekallikrein.", "journal": "The Journal of clinical investigation", "date": "1977", "authors": "Meier HL, Pierce JV, Colman RW, Kaplan AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "874082", "url": "https://glygen.org/publication/PubMed/874082" } ] }, { "title": "Human blood coagulation factor XI. Purification, properties, and mechanism of activation by activated factor XII.", "journal": "The Journal of biological chemistry", "date": "1977", "authors": "Bouma BN, Griffin JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "893417", "url": "https://glygen.org/publication/PubMed/893417" } ] }, { "title": "Alternative expression of platelet glycoprotein Ib(beta) mRNA from an adjacent 5' gene with an imperfect polyadenylation signal sequence.", "journal": "J. Clin. Invest.", "date": "1997", "authors": "Zieger B, Hashimoto Y, Ware J", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" } ], "reference": [ { "type": "PubMed", "id": "9022087", "url": "https://glygen.org/publication/PubMed/9022087" } ] }, { "title": "Missense mutations of the glycoprotein (GP) Ib beta gene impairing the GPIb alpha/beta disulfide linkage in a family with giant platelet disorder.", "journal": "Blood", "date": "1997", "authors": "Kunishima S, Lopez JA, Kobayashi S, Imai N, Kamiya T, Saito H, Naoe T", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" } ], "reference": [ { "type": "PubMed", "id": "9116284", "url": "https://glygen.org/publication/PubMed/9116284" } ] }, { "title": "Modification of the N-terminus of human factor IX by defective propeptide cleavage or acetylation results in a destabilized calcium-induced conformation: effects on phospholipid binding and activation by factor XIa.", "journal": "The Biochemical journal", "date": "1997", "authors": "Wojcik EG, Van Den Berg M, Poort SR, Bertina RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9673221", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673221" } ], "reference": [ { "type": "PubMed", "id": "9169594", "url": "https://glygen.org/publication/PubMed/9169594" } ] }, { "title": "High molecular weight kininogen peptides inhibit the formation of kallikrein on endothelial cell surfaces and subsequent urokinase-dependent plasmin formation.", "journal": "Blood", "date": "1997", "authors": "Lin Y, Harris RB, Yan W, McCrae KR, Zhang H, Colman RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "9226169", "url": "https://glygen.org/publication/PubMed/9226169" } ] }, { "title": "Glycoprotein VI is the collagen receptor in platelets which underlies tyrosine phosphorylation of the Fc receptor gamma-chain.", "journal": "FEBS letters", "date": "1997", "authors": "Gibbins JM, Okuma M, Farndale R, Barnes M, Watson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-75892", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75892" } ], "reference": [ { "type": "PubMed", "id": "9280292", "url": "https://glygen.org/publication/PubMed/9280292" } ] }, { "title": "Crystal structure of the A3 domain of human von Willebrand factor: implications for collagen binding.", "journal": "Structure (London, England : 1993)", "date": "1997-09-15", "authors": "Huizinga E G, Martijn van der Plas R, Kroon J, Sixma J J, Gros P", "evidence": [ { "database": "Reactome", "id": "R-HSA-75892", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75892" } ], "reference": [ { "type": "PubMed", "id": "9331419", "url": "https://glygen.org/publication/PubMed/9331419" } ] }, { "title": "Binding of purified 14-3-3 zeta signaling protein to discrete amino acid sequences within the cytoplasmic domain of the platelet membrane glycoprotein Ib-IX-V complex.", "journal": "Biochemistry", "date": "1998", "authors": "Andrews RK, Harris SJ, McNally T, Berndt MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-430116", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-430116" } ], "reference": [ { "type": "PubMed", "id": "9425086", "url": "https://glygen.org/publication/PubMed/9425086" } ] }, { "title": "High molecular weight kininogen regulates prekallikrein assembly and activation on endothelial cells: a novel mechanism for contact activation.", "journal": "Blood", "date": "1998", "authors": "Motta G, Rojkjaer R, Hasan AA, Cines DB, Schmaier AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "9427705", "url": "https://glygen.org/publication/PubMed/9427705" } ] }, { "title": "Effects of melagatran, a new low-molecular-weight thrombin inhibitor, on thrombin and fibrinolytic enzymes.", "journal": "Thrombosis and haemostasis", "date": "1998", "authors": "Gustafsson D, Antonsson T, Bylund R, Eriksson U, Gyzander E, Nilsson I, Elg M, Mattsson C, Deinum J, Pehrsson S, Karlsson O, Nilsson A, Sorensen H", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "9459334", "url": "https://glygen.org/publication/PubMed/9459334" } ] }, { "title": "Novastan (brand of argatroban): a small-molecule, direct thrombin inhibitor.", "journal": "Seminars in thrombosis and hemostasis", "date": "1997", "authors": "Hursting MJ, Alford KL, Becker JC, Brooks RL, Joffrion JL, Knappenberger GD, Kogan PW, Kogan TP, McKinney AA, Schwarz RP Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "9469622", "url": "https://glygen.org/publication/PubMed/9469622" } ] }, { "title": "Biosynthesis, assembly and secretion of coagulation factor VIII.", "journal": "Blood coagulation & fibrinolysis : an international journal in haemostasis and thrombosis", "date": "1997", "authors": "Kaufman RJ, Pipe SW, Tagliavacca L, Swaroop M, Moussalli M", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "9607108", "url": "https://glygen.org/publication/PubMed/9607108" } ] }, { "title": "Activation of factor VIII by thrombin increases its affinity for binding to synthetic phospholipid membranes and activated platelets.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Saenko EL, Scandella D, Yakhyaev AV, Greco NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "9774404", "url": "https://glygen.org/publication/PubMed/9774404" } ] }, { "title": "The life cycle of coagulation factor VIII in view of its structure and function.", "journal": "Blood", "date": "1998", "authors": "Lenting PJ, van Mourik JA, Mertens K", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "9834200", "url": "https://glygen.org/publication/PubMed/9834200" } ] }, { "title": "Thrombin activates factor XI on activated platelets in the absence of factor XII.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "1999", "authors": "Oliver JA, Monroe DM, Roberts HR, Hoffman M", "evidence": [ { "database": "Reactome", "id": "R-HSA-140837", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837" } ], "reference": [ { "type": "PubMed", "id": "9888880", "url": "https://glygen.org/publication/PubMed/9888880" } ] } ], "pathway": [ { "id": "hsa:2812", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2812", "resource": "KEGG Pathway" }, { "id": "R-HSA-140837", "name": "Intrinsic Pathway of Fibrin Clot Formation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140837", "resource": "Reactome", "description": "Intrinsic Pathway of Fibrin Clot Formation" }, { "id": "R-HSA-430116", "name": "GP1b-IX-V activation signalling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-430116", "resource": "Reactome", "description": "GP1b-IX-V activation signalling" }, { "id": "R-HSA-75892", "name": "Platelet Adhesion to exposed collagen", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75892", "resource": "Reactome", "description": "Platelet Adhesion to exposed collagen" }, { "id": "R-HSA-76009", "name": "Platelet Aggregation (Plug Formation)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76009", "resource": "Reactome", "description": "Platelet Aggregation (Plug Formation)" }, { "id": "R-HSA-9673221", "name": "Defective F9 activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9673221", "resource": "Reactome", "description": "Defective F9 activation" }, { "id": "R-HSA-9845620", "name": "Enhanced binding of GP1BA variant to VWF multimer:collagen", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845620", "resource": "Reactome", "description": "Enhanced binding of GP1BA variant to VWF multimer:collagen" }, { "id": "R-HSA-9846298", "name": "Defective binding of VWF variant to GPIb:IX:V", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9846298", "resource": "Reactome", "description": "Defective binding of VWF variant to GPIb:IX:V" } ], "orthologs": [ { "uniprot_canonical_ac": "P56400-1", "protein_name": "Platelet glycoprotein Ib beta chain", "gene_name": "Gp1bb", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGSRPRGALSLLLLLLALLSRPASGCPAPCSCAGTLVDCGRRGLTWASLPAAFPPDTTELVLTGNNLTALPPGLLDALPALRAAHLGANPWRCDCRLLPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYVAEDELRAACAPGLLCWGALVAQLALLVLGLLHALLLALLLGRLRRLRARARARSIQEFSLTAPLVAESARGGAS", "length": 206 }, "evidence": [ { "id": "45927278", "url": "http://www.informatics.jax.org/homology/45927278", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9JJM7-1", "protein_name": "Platelet glycoprotein Ib beta chain", "gene_name": "Gp1bb", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGSRPRGALSLLLLLLAPPSRPASGCPAPCRCSETRVDCGRRGLTWASLPAAFPPDTTELVLTDNNLTALPPGLLDTLPALRRVHLGANPWRCDCRLLPLRAWLAGRPEREFYRDLRCVAPLALRGRLLPYVAEDELRAACAPGLLCWGALVAQLALLVLGLLHALLLALLLSRLRRLRAQARARSTREFSLTAPLVAESAGGGAS", "length": 206 }, "evidence": [ { "id": "45927278", "url": "http://www.informatics.jax.org/homology/45927278", "database": "MGI" }, { "id": "P13224", "url": "https://omabrowser.org/oma/group/P13224/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "transmembrane signaling receptor activity", "id": "GO:0004888", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004888", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" } ], "pmid": "" }, { "name": "glycoprotein Ib-IX-V complex", "id": "GO:1990779", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990779", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "cell adhesion", "id": "GO:0007155", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007155", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" } ], "pmid": "" }, { "name": "cell surface receptor signaling pathway", "id": "GO:0007166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007166", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" } ], "pmid": "" }, { "name": "blood coagulation, intrinsic pathway", "id": "GO:0007597", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007597", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" } ], "pmid": "" }, { "name": "platelet activation", "id": "GO:0030168", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030168", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" } ], "pmid": "" }, { "name": "release of sequestered calcium ion into cytosol", "id": "GO:0051209", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051209", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" } ], "pmid": "" }, { "name": "megakaryocyte development", "id": "GO:0035855", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035855", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" } ], "pmid": "" }, { "name": "positive regulation of platelet activation", "id": "GO:0010572", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010572", "evidence": [ { "database": "UniProtKB", "id": "P13224", "url": "https://www.uniprot.org/uniprot/P13224" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 66, "end_pos": 68, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 65, 66 ], "o_linked_sites": [ 83 ], "snv_sites": [ 56, 66, 68, 83, 204 ], "glycation_sites": [], "phosphorylation_sites": [ 191, 193 ], "sequon_annotation_sites": [ { "start_pos": 66, "end_pos": 68 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 129 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }