{ "uniprot_canonical_ac": "P13051-1", "uniprot_ac": "P13051", "uniprot_id": "UNG_HUMAN", "mass": { "chemical_mass": 34645.0, "monoisotopic_mass": 34645.0 }, "refseq": { "ac": "NP_003353", "name": "uracil-DNA glycosylase isoform UNG1 precursor", "summary": "This gene encodes one of several uracil-DNA glycosylases. One important function of uracil-DNA glycosylases is to prevent mutagenesis by eliminating uracil from DNA molecules by cleaving the N-glycosylic bond and initiating the base-excision repair (BER) pathway. Uracil bases occur from cytosine deamination or misincorporation of dUMP residues. Alternative promoter usage and splicing of this gene leads to two different isoforms: the mitochondrial UNG1 and the nuclear UNG2. The UNG2 term was used as a previous symbol for the CCNO gene (GeneID 10309), which has been confused with this gene, in the literature and some databases. [provided by RefSeq, Nov 2010].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003353" }, "gene_names": [ { "name": "UNG", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P13051", "id": "P13051" }, { "name": "DGU; HIGM4; HIGM5; UDG; UNG1; UNG15; UNG2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003353", "id": "NP_003353" }, { "name": "DGU", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P13051", "id": "P13051" }, { "name": "DKFZp781L1143", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P13051", "id": "P13051" }, { "name": "UNG15", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P13051", "id": "P13051" }, { "name": "UNG1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P13051", "id": "P13051" }, { "name": "UNG", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003353", "id": "NP_003353" } ], "protein_names": [ { "name": "Uracil-DNA glycosylase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P13051" }, { "name": "3.2.2.27", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13051" }, { "name": "UDG", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P13051" }, { "name": "uracil-DNA glycosylase 1, uracil-DNA glycosylase 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003353", "id": "NP_003353" }, { "name": "uracil-DNA glycosylase isoform UNG1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003353", "id": "NP_003353" } ], "function": [ { "annotation": "Excises uracil residues from the DNA which can arise as a result of misincorporation of dUMP residues by DNA polymerase or due to deamination of cytosine.", "evidence": [ { "database": "UniProtKB", "id": "A0A8V8TQ66", "url": "https://www.uniprot.org/uniprot/A0A8V8TQ66#function" }, { "database": "UniProtKB", "id": "RU003780", "url": "https://www.uniprot.org/uniprot/RU003780#function" }, { "database": "UniProtKB", "id": "MF_03166", "url": "https://www.uniprot.org/uniprot/MF_03166#function" }, { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051#function" }, { "database": "UniProtKB", "id": "A0A8V8TPS1", "url": "https://www.uniprot.org/uniprot/A0A8V8TPS1#function" }, { "database": "UniProtKB", "id": "A0A8V8TNE1", "url": "https://www.uniprot.org/uniprot/A0A8V8TNE1#function" }, { "database": "UniProtKB", "id": "F5GYA2", "url": "https://www.uniprot.org/uniprot/F5GYA2#function" }, { "database": "UniProtKB", "id": "A0A8V8TNJ5", "url": "https://www.uniprot.org/uniprot/A0A8V8TNJ5#function" }, { "database": "UniProtKB", "id": "A0A8V8TNW2", "url": "https://www.uniprot.org/uniprot/A0A8V8TNW2#function" } ] }, { "annotation": "This gene encodes one of several uracil-DNA glycosylases. One important function of uracil-DNA glycosylases is to prevent mutagenesis by eliminating uracil from DNA molecules by cleaving the N-glycosylic bond and initiating the base-excision repair (BER) pathway. Uracil bases occur from cytosine deamination or misincorporation of dUMP residues. Alternative promoter usage and splicing of this gene leads to two different isoforms: the mitochondrial UNG1 and the nuclear UNG2. The UNG2 term was used as a previous symbol for the CCNO gene (GeneID 10309), which has been confused with this gene, in the literature and some databases. [provided by RefSeq, Nov 2010].", "evidence": [ { "database": "RefSeq", "id": "NP_003353", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003353" } ] }, { "annotation": "Uracil-DNA glycosylase efficiency is modulated by substrate rigidity. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_003353", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003353" }, { "database": "PubMed", "id": "36890276", "url": "https://glygen.org/publication/PubMed/36890276" } ] } ], "disease": [ { "disease_id": "DOID:0060759", "recommended_name": { "id": "DOID:0060759", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060759", "name": "immunodeficiency with hyper IgM type 5", "description": "A hyper IgM syndrome that is characterized by normal or increased serum IgM concentrations associated with low or absent serum IgG, IgA, and IgE concentrations, indicating a defect in the class-switch recombination (CSR) process that has_material_basis_in homozygous or compound heterozygous mutation in the UNG gene on chromosome 12q23-q24.1." }, "synonyms": [ { "id": "DOID:0060759", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060759", "name": "HIGM5", "description": "" }, { "id": "DOID:0060759", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060759", "name": "hyper-IgM syndrome 5", "description": "" }, { "id": "DOID:0060759", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060759", "name": "hyper-IgM syndrome due to UNG deficiency", "description": "" }, { "id": "DOID:0060759", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060759", "name": "hyper-IgM syndrome due to uracil N-glycosylase", "description": "" }, { "id": "MONDO:0011971", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011971", "name": "hyper-IgM syndrome type 5", "description": "Any hyper-IgM syndrome in which the cause of the disease is a mutation in the UNG gene." }, { "id": "MONDO:0011971", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011971", "name": "HIGM5", "description": "" }, { "id": "MONDO:0011971", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011971", "name": "UNG hyper-IgM syndrome", "description": "" }, { "id": "MONDO:0011971", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011971", "name": "hyper-IgM syndrome 5", "description": "" }, { "id": "MONDO:0011971", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011971", "name": "hyper-IgM syndrome caused by mutation in UNG", "description": "" }, { "id": "MONDO:0011971", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011971", "name": "hyper-IgM syndrome due to UNG deficiency", "description": "" }, { "id": "MONDO:0011971", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011971", "name": "hyper-IgM syndrome due to uracil N-glycosylase", "description": "" }, { "id": "MONDO:0011971", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011971", "name": "hyper-IgM syndrome type 5", "description": "" }, { "id": "MONDO:0011971", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011971", "name": "immunodeficiency with hyper IgM, type 5", "description": "" }, { "id": "MONDO:0011971", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011971", "name": "hyper IgM syndrome 5", "description": "" }, { "id": "MONDO:0011971", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011971", "name": "immunodeficiency with hyper IgM type 5", "description": "" }, { "id": "MONDO:0011971", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011971", "name": "immunodeficiency with hyper-IgM, type 5", "description": "" }, { "id": "MIM:608106", "resource": "MIM", "url": "https://www.omim.org/entry/608106", "name": "Immunodeficiency with hyper-IgM 5", "description": "Immunodeficiency with hyper-IgM 5" } ], "evidence": [ { "id": "608106", "database": "MIM", "url": "https://www.omim.org/entry/608106" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 154, "end_pos": 154, "sequence_org": "D", "sequence_mut": "E", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" }, { "database": "PubMed", "id": "8670846", "url": "https://glygen.org/publication/PubMed/8670846" } ] }, { "start_pos": 154, "end_pos": 154, "sequence_org": "D", "sequence_mut": "N", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" }, { "database": "PubMed", "id": "8670846", "url": "https://glygen.org/publication/PubMed/8670846" } ] }, { "start_pos": 156, "end_pos": 156, "sequence_org": "Y", "sequence_mut": "A", "comment": "Thymine-DNA glycosylase activity.", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" }, { "database": "PubMed", "id": "8670846", "url": "https://glygen.org/publication/PubMed/8670846" } ] }, { "start_pos": 156, "end_pos": 156, "sequence_org": "Y", "sequence_mut": "C", "comment": "Thymine-DNA glycosylase activity.", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" }, { "database": "PubMed", "id": "8670846", "url": "https://glygen.org/publication/PubMed/8670846" } ] }, { "start_pos": 156, "end_pos": 156, "sequence_org": "Y", "sequence_mut": "S", "comment": "Thymine-DNA glycosylase activity.", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" }, { "database": "PubMed", "id": "8670846", "url": "https://glygen.org/publication/PubMed/8670846" } ] }, { "start_pos": 213, "end_pos": 213, "sequence_org": "N", "sequence_mut": "D", "comment": "Cytosine-DNA glycosylase activity.", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" }, { "database": "PubMed", "id": "8670846", "url": "https://glygen.org/publication/PubMed/8670846" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "83.02", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000076248", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000076248" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "82.37", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000076248", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000076248" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "78.67", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000076248", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000076248" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "79.58", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000076248", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000076248" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "85.68", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000076248", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000076248" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "92.52", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000076248", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000076248" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "82.62", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000076248", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000076248" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "83.5", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000076248", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000076248" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "86.9", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000076248", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000076248" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "73.8", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000076248", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000076248" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "83.85", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000076248", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000076248" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "84.72", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000076248", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000076248" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "87.7", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000076248", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000076248" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P13051", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13051" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P13051", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13051" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P13051", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13051" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P13051", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13051" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P13051", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13051" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P13051", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13051" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P13051", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13051" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P13051", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13051" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P13051", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13051" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P13051", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13051" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P13051", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13051" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P13051", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P13051" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "common_name": "Human" } ], "gene": [ { "name": "UNG", "url": "https://www.uniprot.org/uniprot/P13051", "locus": { "chromosome": "12", "start_pos": 109126725, "end_pos": 109097597, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000076248", "url": "https://www.ensembl.org/id/ENSG00000076248" } ] } } ], "crossref": [ { "id": "ENSG00000076248", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000076248", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "3.2.2.27", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.2.2.27&UniProtAcc=P13051", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd10027", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd10027", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL3277", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3277", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "UNG", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=UNG", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "7374", "url": "https://www.ncbi.nlm.nih.gov/gene/7374", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "12572", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=12572", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P13051", "url": "https://www.ebi.ac.uk/intact/interactors/id:P13051*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002043", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002043", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR005122", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005122", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018085", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018085", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036895", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036895", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:7374", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7374", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "191525", "url": "http://www.omim.org/entry/191525", "database": "MIM", "categories": [ "Other" ] }, { "id": "608106", "url": "http://www.omim.org/entry/608106", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P13051", "url": "https://www.nextprot.org/entry/NX_P13051", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "PDNGYLM", "url": "https://omabrowser.org/oma/group/PDNGYLM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "11658at2759", "url": "http://www.orthodb.org/?query=11658at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11264", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11264", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11264:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11264:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1AKZ", "url": "https://www.rcsb.org/structure/1AKZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1DPU", "url": "https://www.rcsb.org/structure/1DPU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1EMH", "url": "https://www.rcsb.org/structure/1EMH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1EMJ", "url": "https://www.rcsb.org/structure/1EMJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1Q3F", "url": "https://www.rcsb.org/structure/1Q3F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1SSP", "url": "https://www.rcsb.org/structure/1SSP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1UGH", "url": "https://www.rcsb.org/structure/1UGH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1YUO", "url": "https://www.rcsb.org/structure/1YUO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2HXM", "url": "https://www.rcsb.org/structure/2HXM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2OXM", "url": "https://www.rcsb.org/structure/2OXM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2OYT", "url": "https://www.rcsb.org/structure/2OYT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2SSP", "url": "https://www.rcsb.org/structure/2SSP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3FCF", "url": "https://www.rcsb.org/structure/3FCF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3FCI", "url": "https://www.rcsb.org/structure/3FCI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3FCK", "url": "https://www.rcsb.org/structure/3FCK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3FCL", "url": "https://www.rcsb.org/structure/3FCL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3TKB", "url": "https://www.rcsb.org/structure/3TKB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4SKN", "url": "https://www.rcsb.org/structure/4SKN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5AYR", "url": "https://www.rcsb.org/structure/5AYR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5JK7", "url": "https://www.rcsb.org/structure/5JK7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6VBA", "url": "https://www.rcsb.org/structure/6VBA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7V7C", "url": "https://www.rcsb.org/structure/7V7C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF03167", "url": "http://pfam.xfam.org/family/PF03167", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P13051", "url": "https://pharos.nih.gov/targets/P13051", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P13051", "url": "http://purl.obolibrary.org/obo/PR_P13051", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-9821002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_003353", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003353", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A8V8TNE1", "url": "https://www.uniprot.org/uniprot/A0A8V8TNE1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TNE1-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TNE1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TNJ5", "url": "https://www.uniprot.org/uniprot/A0A8V8TNJ5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TNJ5-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TNJ5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TNW2", "url": "https://www.uniprot.org/uniprot/A0A8V8TNW2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TNW2-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TNW2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TNW7", "url": "https://www.uniprot.org/uniprot/A0A8V8TNW7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TNW7-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TNW7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TPS1", "url": "https://www.uniprot.org/uniprot/A0A8V8TPS1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TPS1-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TPS1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TPS7", "url": "https://www.uniprot.org/uniprot/A0A8V8TPS7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TPS7-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TPS7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TQ66", "url": "https://www.uniprot.org/uniprot/A0A8V8TQ66", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TQ66-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TQ66-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TQ70", "url": "https://www.uniprot.org/uniprot/A0A8V8TQ70", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TQ70-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TQ70-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5GYA2", "url": "https://www.uniprot.org/uniprot/F5GYA2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5GYA2-1", "url": "https://www.uniprot.org/uniprot/F5GYA2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13051-1", "url": "https://www.uniprot.org/uniprot/P13051-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P13051-2", "url": "https://www.uniprot.org/uniprot/P13051-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q68DM5", "url": "https://www.uniprot.org/uniprot/Q68DM5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q68DM5-1", "url": "https://www.uniprot.org/uniprot/Q68DM5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVPEESGDAAAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL", "length": 313, "header": "sp|P13051-1|UNG_HUMAN Isoform 1 of Uracil-DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG PE=1 SV=2 CANONICAL=P13051-1" }, "isoforms": [ { "isoform_ac": "A0A8V8TNE1-1", "url": "", "sequence": { "sequence": "MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRVCDFICFPVRS", "length": 269, "header": "tr|A0A8V8TNE1-1|UNG_HUMAN Computationally mapped isoform of Uracil-DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG PE=1 SV=1 CANONICAL=P13051-1" }, "locus": { "chromosome": "12", "start_pos": 109125977, "end_pos": 109098327, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000699563.1", "url": "https://www.ensembl.org/id/ENST00000699563.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000514437.1", "url": "https://www.ensembl.org/id/ENSP00000514437.1" } ] } }, { "isoform_ac": "A0A8V8TNJ5-1", "url": "", "sequence": { "sequence": "MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRRLGFTMLTRLVLNS", "length": 272, "header": "tr|A0A8V8TNJ5-1|A0A8V8TNJ5_HUMAN Computationally mapped isoform of Uracil-DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG PE=1 SV=1 CANONICAL=P13051-1" }, "locus": { "chromosome": "12", "start_pos": 109105140, "end_pos": 109098327, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000699559.1", "url": "https://www.ensembl.org/id/ENST00000699559.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000514433.1", "url": "https://www.ensembl.org/id/ENSP00000514433.1" } ] } }, { "isoform_ac": "A0A8V8TNW2-1", "url": "", "sequence": { "sequence": "MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRVCFVFFLFFLFFLTL", "length": 273, "header": "tr|A0A8V8TNW2-1|A0A8V8TNW2_HUMAN Computationally mapped isoform of Uracil-DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG PE=1 SV=1 CANONICAL=P13051-1" }, "locus": { "chromosome": "12", "start_pos": 109103656, "end_pos": 109098327, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000699561.1", "url": "https://www.ensembl.org/id/ENST00000699561.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000514435.1", "url": "https://www.ensembl.org/id/ENSP00000514435.1" } ] } }, { "isoform_ac": "A0A8V8TNW7-1", "url": "", "sequence": { "sequence": "MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKERLA", "length": 108, "header": "tr|A0A8V8TNW7-1|A0A8V8TNW7_HUMAN Computationally mapped isoform of Uracil DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG PE=1 SV=1 CANONICAL=P13051-1" }, "locus": { "chromosome": "12", "start_pos": 109098898, "end_pos": 109098327, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000699566.1", "url": "https://www.ensembl.org/id/ENST00000699566.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000514440.1", "url": "https://www.ensembl.org/id/ENSP00000514440.1" } ] } }, { "isoform_ac": "A0A8V8TPS1-1", "url": "", "sequence": { "sequence": "MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL", "length": 272, "header": "tr|A0A8V8TPS1-1|A0A8V8TPS1_HUMAN Computationally mapped isoform of Uracil-DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG PE=1 SV=1 CANONICAL=P13051-1" }, "locus": { "chromosome": "12", "start_pos": 109109966, "end_pos": 109098327, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000699560.1", "url": "https://www.ensembl.org/id/ENST00000699560.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000514434.1", "url": "https://www.ensembl.org/id/ENSP00000514434.1" } ] } }, { "isoform_ac": "A0A8V8TPS7-1", "url": "", "sequence": { "sequence": "MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPRYSCFTVWRTFIKSCLQT", "length": 186, "header": "tr|A0A8V8TPS7-1|A0A8V8TPS7_HUMAN Computationally mapped isoform of Uracil DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG PE=1 SV=1 CANONICAL=P13051-1" }, "locus": { "chromosome": "12", "start_pos": 109102873, "end_pos": 109098327, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000699564.1", "url": "https://www.ensembl.org/id/ENST00000699564.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000514438.1", "url": "https://www.ensembl.org/id/ENSP00000514438.1" } ] } }, { "isoform_ac": "A0A8V8TQ66-1", "url": "", "sequence": { "sequence": "MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL", "length": 303, "header": "tr|A0A8V8TQ66-1|A0A8V8TQ66_HUMAN Computationally mapped isoform of Uracil-DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG PE=1 SV=1 CANONICAL=P13051-1" }, "locus": { "chromosome": "12", "start_pos": 109109966, "end_pos": 109098327, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000699562.1", "url": "https://www.ensembl.org/id/ENST00000699562.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000514436.1", "url": "https://www.ensembl.org/id/ENSP00000514436.1" } ] } }, { "isoform_ac": "A0A8V8TQ70-1", "url": "", "sequence": { "sequence": "MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPRCSPSQRCPHGSCPSSQLS", "length": 187, "header": "tr|A0A8V8TQ70-1|A0A8V8TQ70_HUMAN Computationally mapped isoform of Uracil DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG PE=1 SV=1 CANONICAL=P13051-1" }, "locus": { "chromosome": "12", "start_pos": 109103487, "end_pos": 109098327, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000699567.1", "url": "https://www.ensembl.org/id/ENST00000699567.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000514441.1", "url": "https://www.ensembl.org/id/ENSP00000514441.1" } ] } }, { "isoform_ac": "F5GYA2-1", "url": "", "sequence": { "sequence": "MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDR", "length": 258, "header": "tr|F5GYA2-1|F5GYA2_HUMAN Computationally mapped isoform of Uracil-DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG PE=1 SV=1 CANONICAL=P13051-1" }, "locus": { "chromosome": "12", "start_pos": 109103611, "end_pos": 109098327, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000539287.6", "url": "https://www.ensembl.org/id/ENST00000539287.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000440784.1", "url": "https://www.ensembl.org/id/ENSP00000440784.1" } ] } }, { "isoform_ac": "P13051-1", "url": "", "sequence": { "sequence": "MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVPEESGDAAAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL", "length": 313, "header": "sp|P13051-1|UNG_HUMAN Isoform 1 of Uracil-DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG PE=1 SV=2 CANONICAL=P13051-1" }, "locus": { "chromosome": "12", "start_pos": 109109966, "end_pos": 109097680, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000242576.7", "url": "https://www.ensembl.org/id/ENST00000242576.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000242576.3", "url": "https://www.ensembl.org/id/ENSP00000242576.3" } ] } }, { "isoform_ac": "P13051-2", "url": "", "sequence": { "sequence": "MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL", "length": 304, "header": "sp|P13051-2|UNG_HUMAN Isoform 2 of Uracil-DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG PE=1 SV=2 CANONICAL=P13051-1" }, "locus": { "chromosome": "12", "start_pos": 109109966, "end_pos": 109098327, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000336865.6", "url": "https://www.ensembl.org/id/ENST00000336865.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000337398.2", "url": "https://www.ensembl.org/id/ENSP00000337398.2" } ] } }, { "isoform_ac": "Q68DM5-1", "url": "", "sequence": { "sequence": "MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDFGEHL", "length": 141, "header": "tr|Q68DM5-1|UNG_HUMAN Computationally mapped isoform of Uracil-DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG PE=1 SV=1 CANONICAL=P13051-1" }, "locus": { "chromosome": "12", "start_pos": 109102853, "end_pos": 109098327, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000446767.2", "url": "https://www.ensembl.org/id/ENST00000446767.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000400287.2", "url": "https://www.ensembl.org/id/ENSP00000400287.2" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 126, "end_pos": 126, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P13051", "url": "http://phospho.elm.eu.org/byAccession/P13051.html" }, { "database": "iPTMnet", "id": "P13051", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051" }, { "database": "PubMed", "id": "15327777", "url": "https://glygen.org/publication/PubMed/15327777" } ], "site_lbl": "Thr126" }, { "start_pos": 12, "end_pos": 12, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P13051", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051" }, { "database": "phospho.ELM", "id": "P13051", "url": "http://phospho.elm.eu.org/byAccession/P13051.html" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" }, { "database": "PubMed", "id": "18079698", "url": "https://glygen.org/publication/PubMed/18079698" } ], "site_lbl": "Ser12" }, { "start_pos": 14, "end_pos": 14, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "P13051", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "phospho.ELM", "id": "P13051", "url": "http://phospho.elm.eu.org/byAccession/P13051.html" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" }, { "database": "PubMed", "id": "18079698", "url": "https://glygen.org/publication/PubMed/18079698" } ], "site_lbl": "Ser14" }, { "start_pos": 23, "end_pos": 23, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "P13051", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "P13051", "url": "http://phospho.elm.eu.org/byAccession/P13051.html" }, { "database": "PubMed", "id": "18079698", "url": "https://glygen.org/publication/PubMed/18079698" } ], "site_lbl": "Ser23" }, { "start_pos": 31, "end_pos": 31, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P13051", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P13051", "url": "http://phospho.elm.eu.org/byAccession/P13051.html" } ], "site_lbl": "Thr31" }, { "start_pos": 40, "end_pos": 40, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P13051", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser40" }, { "start_pos": 60, "end_pos": 60, "kinase_uniprot_canonical_ac": "P49840-1", "kinase_gene_name": "GSK3A", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P13051", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051" }, { "database": "PubMed", "id": "27875297", "url": "https://glygen.org/publication/PubMed/27875297" } ], "site_lbl": "Thr60" }, { "start_pos": 60, "end_pos": 60, "kinase_uniprot_canonical_ac": "P49841-1", "kinase_gene_name": "GSK3B", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P13051", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051" }, { "database": "PubMed", "id": "27875297", "url": "https://glygen.org/publication/PubMed/27875297" } ], "site_lbl": "Thr60" }, { "start_pos": 60, "end_pos": 60, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "P13051", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "phospho.ELM", "id": "P13051", "url": "http://phospho.elm.eu.org/byAccession/P13051.html" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18079698", "url": "https://glygen.org/publication/PubMed/18079698" }, { "database": "PubMed", "id": "27875297", "url": "https://glygen.org/publication/PubMed/27875297" }, { "database": "PubMed", "id": "33784377", "url": "https://glygen.org/publication/PubMed/33784377" } ], "site_lbl": "Thr60" }, { "start_pos": 63, "end_pos": 63, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P13051", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P13051", "url": "http://phospho.elm.eu.org/byAccession/P13051.html" } ], "site_lbl": "Ser63" }, { "start_pos": 64, "end_pos": 64, "kinase_uniprot_canonical_ac": "P49840-1", "kinase_gene_name": "GSK3A", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P13051", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051" }, { "database": "PubMed", "id": "27875297", "url": "https://glygen.org/publication/PubMed/27875297" } ], "site_lbl": "Ser64" }, { "start_pos": 64, "end_pos": 64, "kinase_uniprot_canonical_ac": "P49841-1", "kinase_gene_name": "GSK3B", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P13051", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051" }, { "database": "PubMed", "id": "27875297", "url": "https://glygen.org/publication/PubMed/27875297" } ], "site_lbl": "Ser64" }, { "start_pos": 64, "end_pos": 64, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "P13051", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P13051", "url": "http://phospho.elm.eu.org/byAccession/P13051.html" }, { "database": "PubMed", "id": "18079698", "url": "https://glygen.org/publication/PubMed/18079698" }, { "database": "PubMed", "id": "33784377", "url": "https://glygen.org/publication/PubMed/33784377" } ], "site_lbl": "Ser64" }, { "start_pos": 67, "end_pos": 67, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P13051", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ], "site_lbl": "Ser67" }, { "start_pos": 6, "end_pos": 6, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P13051", "url": "http://phospho.elm.eu.org/byAccession/P13051.html" }, { "database": "iPTMnet", "id": "P13051", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051" }, { "database": "PubMed", "id": "15327777", "url": "https://glygen.org/publication/PubMed/15327777" }, { "database": "PubMed", "id": "28746850", "url": "https://glygen.org/publication/PubMed/28746850" } ], "site_lbl": "Thr6" }, { "start_pos": 8, "end_pos": 8, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P13051", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051" }, { "database": "PubMed", "id": "28746850", "url": "https://glygen.org/publication/PubMed/28746850" } ], "site_lbl": "Tyr8" } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Human uracil-DNA glycosylase deficiency associated with profoundly impaired immunoglobulin class-switch recombination.", "journal": "Nature immunology", "date": "2003", "authors": "Imai K, Slupphaug G, Lee WI, Revy P, Nonoyama S, Catalan N, Yel L, Forveille M, Kavli B, Krokan HE, Ochs HD, Fischer A, Durandy A", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "reference": [ { "type": "PubMed", "id": "12958596", "url": "https://glygen.org/publication/PubMed/12958596" } ] }, { "title": "Large-scale characterization of HeLa cell nuclear phosphoproteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "P13051-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051-1" } ], "reference": [ { "type": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" } ] }, { "title": "The p53-induced oncogenic phosphatase PPM1D interacts with uracil DNA glycosylase and suppresses base excision repair.", "journal": "Molecular cell", "date": "2004", "authors": "Lu X, Bocangel D, Nannenga B, Yamaguchi H, Appella E, Donehower LA", "evidence": [ { "database": "iPTMnet", "id": "P13051", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051" } ], "reference": [ { "type": "PubMed", "id": "15327777", "url": "https://glygen.org/publication/PubMed/15327777" } ] }, { "title": "B cells from hyper-IgM patients carrying UNG mutations lack ability to remove uracil from ssDNA and have elevated genomic uracil.", "journal": "The Journal of experimental medicine", "date": "2005", "authors": "Kavli B, Andersen S, Otterlei M, Liabakk NB, Imai K, Fischer A, Durandy A, Krokan HE, Slupphaug G", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "reference": [ { "type": "PubMed", "id": "15967827", "url": "https://glygen.org/publication/PubMed/15967827" } ] }, { "title": "A probability-based approach for high-throughput protein phosphorylation analysis and site localization.", "journal": "Nature biotechnology", "date": "2006", "authors": "Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "P13051-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051-1" } ], "reference": [ { "type": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "UniProtKB", "id": "F5GYA2", "url": "https://www.uniprot.org/uniprot/F5GYA2" }, { "database": "iPTMnet", "id": "P13051-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051-1" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Molina H, Horn DM, Tang N, Mathivanan S, Pandey A", "evidence": [ { "database": "iPTMnet", "id": "P13051-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051-1" } ], "reference": [ { "type": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" } ] }, { "title": "The X-linked mental retardation gene SMCX/JARID1C defines a family of histone H3 lysine 4 demethylases.", "journal": "Cell", "date": "2007", "authors": "Iwase S, Lan F, Bayliss P, de la Torre-Ubieta L, Huarte M, Qi HH, Whetstine JR, Bonni A, Roberts TM, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9821002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002" } ], "reference": [ { "type": "PubMed", "id": "17320160", "url": "https://glygen.org/publication/PubMed/17320160" } ] }, { "title": "RBP2 belongs to a family of demethylases, specific for tri-and dimethylated lysine 4 on histone 3.", "journal": "Cell", "date": "2007-03-23", "authors": "Christensen Jesper, Agger Karl, Cloos Paul A C, Pasini Diego, Rose Simon, Sennels Lau, Rappsilber Juri, Hansen Klaus H, Salcini Anna Elisabetta, Helin Kristian", "evidence": [ { "database": "Reactome", "id": "R-HSA-9821002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002" } ], "reference": [ { "type": "PubMed", "id": "17320161", "url": "https://glygen.org/publication/PubMed/17320161" } ] }, { "title": "The retinoblastoma binding protein RBP2 is an H3K4 demethylase.", "journal": "Cell", "date": "2007", "authors": "Klose RJ, Yan Q, Tothova Z, Yamane K, Erdjument-Bromage H, Tempst P, Gilliland DG, Zhang Y, Kaelin WG Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9821002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002" } ], "reference": [ { "type": "PubMed", "id": "17320163", "url": "https://glygen.org/publication/PubMed/17320163" } ] }, { "title": "PLU-1 is an H3K4 demethylase involved in transcriptional repression and breast cancer cell proliferation.", "journal": "Molecular cell", "date": "2007", "authors": "Yamane K, Tateishi K, Klose RJ, Fang J, Fabrizio LA, Erdjument-Bromage H, Taylor-Papadimitriou J, Tempst P, Zhang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9821002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002" } ], "reference": [ { "type": "PubMed", "id": "17363312", "url": "https://glygen.org/publication/PubMed/17363312" } ] }, { "title": "UTX and JMJD3 are histone H3K27 demethylases involved in HOX gene regulation and development.", "journal": "Nature", "date": "2007", "authors": "Agger K, Cloos PA, Christensen J, Pasini D, Rose S, Rappsilber J, Issaeva I, Canaani E, Salcini AE, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9821002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002" } ], "reference": [ { "type": "PubMed", "id": "17713478", "url": "https://glygen.org/publication/PubMed/17713478" } ] }, { "title": "A histone H3 lysine 27 demethylase regulates animal posterior development.", "journal": "Nature", "date": "2007", "authors": "Lan F, Bayliss PE, Rinn JL, Whetstine JR, Wang JK, Chen S, Iwase S, Alpatov R, Issaeva I, Canaani E, Roberts TM, Chang HY, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9821002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002" } ], "reference": [ { "type": "PubMed", "id": "17851529", "url": "https://glygen.org/publication/PubMed/17851529" } ] }, { "title": "Identification of JmjC domain-containing UTX and JMJD3 as histone H3 lysine 27 demethylases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Hong S, Cho YW, Yu LR, Yu H, Veenstra TD, Ge K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9821002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002" } ], "reference": [ { "type": "PubMed", "id": "18003914", "url": "https://glygen.org/publication/PubMed/18003914" } ] }, { "title": "Cell cycle-specific UNG2 phosphorylations regulate protein turnover, activity and association with RPA.", "journal": "The EMBO journal", "date": "2008", "authors": "Hagen L, Kavli B, Sousa MM, Torseth K, Liabakk NB, Sundheim O, Pena-Diaz J, Otterlei M, Horning O, Jensen ON, Krokan HE, Slupphaug G", "evidence": [ { "database": "iPTMnet", "id": "P13051", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051" } ], "reference": [ { "type": "PubMed", "id": "18079698", "url": "https://glygen.org/publication/PubMed/18079698" } ] }, { "title": "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.", "journal": "J. Proteome Res.", "date": "2008", "authors": "Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" }, { "database": "iPTMnet", "id": "P13051", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051" } ], "reference": [ { "type": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "P13051-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051-1" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" }, { "database": "iPTMnet", "id": "P13051-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Ugene, a newly identified protein that is commonly overexpressed in cancer and binds uracil DNA glycosylase.", "journal": "Cancer Res.", "date": "2008", "authors": "Guo C, Zhang X, Fink SP, Platzer P, Wilson K, Willson JK, Wang Z, Markowitz SD", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "reference": [ { "type": "PubMed", "id": "18676834", "url": "https://glygen.org/publication/PubMed/18676834" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "P13051-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051-1" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P13051-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051-1" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Phosphorylation dynamics during early differentiation of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Van Hoof D, Munoz J, Braam SR, Pinkse MW, Linding R, Heck AJ, Mummery CL, Krijgsveld J", "evidence": [ { "database": "iPTMnet", "id": "P13051-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051-1" } ], "reference": [ { "type": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" }, { "database": "iPTMnet", "id": "P13051", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" }, { "database": "iPTMnet", "id": "P13051-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" }, { "database": "iPTMnet", "id": "P13051", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "Studies of H3K4me3 demethylation by KDM5B/Jarid1B/PLU1 reveals strong substrate recognition in vitro and identifies 2,4-pyridine-dicarboxylic acid as an in vitro and in cell inhibitor.", "journal": "The FEBS journal", "date": "2012-06", "authors": "Kristensen Line H, Nielsen Anders L, Helgstrand Charlotte, Lees Michael, Cloos Paul, Kastrup Jette S, Helin Kristian, Olsen Lars, Gajhede Michael", "evidence": [ { "database": "Reactome", "id": "R-HSA-9821002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002" } ], "reference": [ { "type": "PubMed", "id": "22420752", "url": "https://glygen.org/publication/PubMed/22420752" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" }, { "database": "iPTMnet", "id": "P13051", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Molecular cloning of human uracil-DNA glycosylase, a highly conserved DNA repair enzyme.", "journal": "EMBO J.", "date": "1989", "authors": "Olsen LC, Aasland R, Wittwer CU, Krokan HE, Helland DE", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "reference": [ { "type": "PubMed", "id": "2555154", "url": "https://glygen.org/publication/PubMed/2555154" } ] }, { "title": "Glycogen Synthase Kinase 3 (GSK-3)-mediated Phosphorylation of Uracil N-Glycosylase 2 (UNG2) Facilitates the Repair of Floxuridine-induced DNA Lesions and Promotes Cell Survival.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Baehr CA, Huntoon CJ, Hoang SM, Jerde CR, Karnitz LM", "evidence": [ { "database": "iPTMnet", "id": "P13051", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051" } ], "reference": [ { "type": "PubMed", "id": "27875297", "url": "https://glygen.org/publication/PubMed/27875297" } ] }, { "title": "Investigation of N-Terminal Phospho-Regulation of\u00a0Uracil DNA Glycosylase Using Protein Semisynthesis.", "journal": "Biophysical journal", "date": "2017-07-25", "authors": "Weiser Brian P, Stivers James T, Cole Philip A", "evidence": [ { "database": "iPTMnet", "id": "P13051", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051" } ], "reference": [ { "type": "PubMed", "id": "28746850", "url": "https://glygen.org/publication/PubMed/28746850" } ] }, { "title": "RPA2 winged-helix domain facilitates UNG-mediated removal of uracil from ssDNA; implications for repair of mutagenic uracil at the replication fork.", "journal": "Nucleic acids research", "date": "2021", "authors": "Kavli B, Iveland TS, Buchinger E, Hagen L, Liabakk NB, Aas PA, Obermann TS, Aachmann FL, Slupphaug G", "evidence": [ { "database": "iPTMnet", "id": "P13051", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13051" } ], "reference": [ { "type": "PubMed", "id": "33784377", "url": "https://glygen.org/publication/PubMed/33784377" } ] }, { "title": "Rolling back human pluripotent stem cells to an eight-cell embryo-like stage.", "journal": "Nature", "date": "2022-05", "authors": "Mazid Md Abdul, Ward Carl, Luo Zhiwei, Liu Chuanyu, Li Yunpan, Lai Yiwei, Wu Liang, Li Jinxiu, Jia Wenqi, Jiang Yu, Liu Hao, Fu Lixin, Yang Yueli, Iba\u00f1ez David P, Lai Junjian, Wei Xiaoyu, An Juan, Guo Pengcheng, Yuan Yue, Deng Qiuting, Wang Yang, Liu Ying, Gao Fei, Wang Junwen, Zaman Shahriar, Qin Baoming, Wu Guangming, Maxwell Patrick H, Xu Xun, Liu Longqi, Li Wenjuan, Esteban Miguel A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9821002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002" } ], "reference": [ { "type": "PubMed", "id": "35314832", "url": "https://glygen.org/publication/PubMed/35314832" } ] }, { "title": "Uracil-DNA glycosylase efficiency is modulated by substrate rigidity.", "journal": "Scientific reports", "date": "2023-03-08", "authors": "Orndorff Paul B, Poddar Souvik, Owens Aerial M, Kumari Nikita, Ugaz Bryan T, Amin Samrat, Van Horn Wade D, van der Vaart Arjan, Levitus Marcia", "evidence": [ { "database": "RefSeq", "id": "NP_003353", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003353" } ], "reference": [ { "type": "PubMed", "id": "36890276", "url": "https://glygen.org/publication/PubMed/36890276" } ] }, { "title": "Crystal structure of human uracil-DNA glycosylase in complex with a protein inhibitor: protein mimicry of DNA.", "journal": "Cell", "date": "1995", "authors": "Mol CD, Arvai AS, Sanderson RJ, Slupphaug G, Kavli B, Krokan HE, Mosbaugh DW, Tainer JA", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "reference": [ { "type": "PubMed", "id": "7671300", "url": "https://glygen.org/publication/PubMed/7671300" } ] }, { "title": "Crystal structure and mutational analysis of human uracil-DNA glycosylase: structural basis for specificity and catalysis.", "journal": "Cell", "date": "1995", "authors": "Mol C D, Arvai A S, Slupphaug G, Kavli B, Alseth I, Krokan H E, Tainer J A", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "reference": [ { "type": "PubMed", "id": "7697717", "url": "https://glygen.org/publication/PubMed/7697717" } ] }, { "title": "Structure of the gene for human uracil-DNA glycosylase and analysis of the promoter function.", "journal": "FEBS Lett.", "date": "1994", "authors": "Haug T, Skorpen F, Lund H, Krokan H E", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "reference": [ { "type": "PubMed", "id": "7926048", "url": "https://glygen.org/publication/PubMed/7926048" } ] }, { "title": "Nuclear and mitochondrial forms of human uracil-DNA glycosylase are encoded by the same gene.", "journal": "Nucleic Acids Res.", "date": "1993", "authors": "Slupphaug G, Markussen F H, Olsen L C, Aasland R, Aarsaether N, Bakke O, Krokan H E, Helland D E", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "reference": [ { "type": "PubMed", "id": "8332455", "url": "https://glygen.org/publication/PubMed/8332455" } ] }, { "title": "Human immunodeficiency virus type 1 Vpr protein binds to the uracil DNA glycosylase DNA repair enzyme.", "journal": "J. Virol.", "date": "1996", "authors": "Bouhamdan M, Benichou S, Rey F, Navarro J M, Agostini I, Spire B, Camonis J, Slupphaug G, Vigne R, Benarous R, Sire J", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "reference": [ { "type": "PubMed", "id": "8551605", "url": "https://glygen.org/publication/PubMed/8551605" } ] }, { "title": "Excision of cytosine and thymine from DNA by mutants of human uracil-DNA glycosylase.", "journal": "The EMBO journal", "date": "1996", "authors": "Kavli B, Slupphaug G, Mol CD, Arvai AS, Peterson SB, Tainer JA, Krokan HE", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "reference": [ { "type": "PubMed", "id": "8670846", "url": "https://glygen.org/publication/PubMed/8670846" } ] }, { "title": "A nucleotide-flipping mechanism from the structure of human uracil-DNA glycosylase bound to DNA.", "journal": "Nature", "date": "1996", "authors": "Slupphaug G, Mol C D, Kavli B, Arvai A S, Krokan H E, Tainer J A", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "reference": [ { "type": "PubMed", "id": "8900285", "url": "https://glygen.org/publication/PubMed/8900285" } ] }, { "title": "Nuclear and mitochondrial uracil-DNA glycosylases are generated by alternative splicing and transcription from different positions in the UNG gene.", "journal": "Nucleic Acids Res.", "date": "1997", "authors": "Nilsen H, Otterlei M, Haug T, Solum K, Nagelhus TA, Skorpen F, Krokan HE", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "reference": [ { "type": "PubMed", "id": "9016624", "url": "https://glygen.org/publication/PubMed/9016624" } ] }, { "title": "Base excision repair initiation revealed by crystal structures and binding kinetics of human uracil-DNA glycosylase with DNA.", "journal": "EMBO J.", "date": "1998", "authors": "Parikh SS, Mol CD, Slupphaug G, Bharati S, Krokan HE, Tainer JA", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "reference": [ { "type": "PubMed", "id": "9724657", "url": "https://glygen.org/publication/PubMed/9724657" } ] }, { "title": "Nuclear and mitochondrial splice forms of human uracil-DNA glycosylase contain a complex nuclear localisation signal and a strong classical mitochondrial localisation signal, respectively.", "journal": "Nucleic Acids Res.", "date": "1998", "authors": "Otterlei M, Haug T, Nagelhus T A, Slupphaug G, Lindmo T, Krokan H E", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "reference": [ { "type": "PubMed", "id": "9753728", "url": "https://glygen.org/publication/PubMed/9753728" } ] } ], "pathway": [ { "id": "hsa:7374", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7374", "resource": "KEGG Pathway" }, { "id": "R-HSA-9821002", "name": "Chromatin modifications during the maternal to zygotic transition (MZT)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002", "resource": "Reactome", "description": "Chromatin modifications during the maternal to zygotic transition (MZT)" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A8J8YLI4-1", "protein_name": "Uracil-DNA glycosylase", "gene_name": "Ung", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MIGQKTLYSFFSPTPTGKRTTRSPQPAPGSGVTAENSSDAAASPAKKARVEQDEPATPPSSPLSAEQLVRIQRNKAAALLRLAARNVPAGLGESWKQQLCGEFGKPYFVKLMGFVAEERKHHKVYPPPEQVFTWTQMCDIRDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIFKELSTDIDGFVHPGHGDLSGWARQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNLNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKANELLQRSGKKPISWKEL", "length": 310 }, "evidence": [ { "id": "45925223", "url": "http://www.informatics.jax.org/homology/45925223", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P97931-1", "protein_name": "Uracil-DNA glycosylase", "gene_name": "Ung", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MIGQKTLYSFFSPTPTGKRTTRSPEPVPGSGVAAEIGGDAVASPAKKARVEQNEQGSPLSAEQLVRIQRNKAAALLRLAARNVPAGFGESWKQQLCGEFGKPYFVKLMGFVAEERNHHKVYPPPEQVFTWTQMCDIRDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIFKELSTDIDGFVHPGHGDLSGWARQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNLSGLVFLLWGSYAQKKGSVIDRKRHHVLQTAHPSPLSVHRGFLGCRHFSKANELLQKSGKKPINWKEL", "length": 306 }, "evidence": [ { "id": "45925223", "url": "http://www.informatics.jax.org/homology/45925223", "database": "MGI" }, { "id": "P13051", "url": "https://omabrowser.org/oma/group/P13051/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "base-excision repair", "id": "GO:0006284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006284", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "pmid": "" }, { "name": "DNA repair", "id": "GO:0006281", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006281", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "pmid": "" }, { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "pmid": "" }, { "name": "somatic hypermutation of immunoglobulin genes", "id": "GO:0016446", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016446", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "pmid": "" }, { "name": "isotype switching", "id": "GO:0045190", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045190", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "pmid": "" }, { "name": "depyrimidination", "id": "GO:0045008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045008", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "pmid": "" }, { "name": "base-excision repair, AP site formation via deaminated base removal", "id": "GO:0097510", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097510", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "uracil DNA N-glycosylase activity", "id": "GO:0004844", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004844", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "pmid": "" }, { "name": "damaged DNA binding", "id": "GO:0003684", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003684", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "pmid": "" }, { "name": "ribosomal small subunit binding", "id": "GO:0043024", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043024", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P13051", "url": "https://www.uniprot.org/uniprot/P13051" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-HSA-9817512", "name": "UNG (UNG2) and base excision repair remove uridine and 5-methylcytidine from chromatin containing histone H3.3", "equation": "", "summary": "The cytidine deaminase AICDA, the uracil-DNA glycosylase UNG (UNG2), and base excision repair are required for removal of 5-methylcytidine from DNA in the male pronucleus of the zygote (inferred from mouse homologs in mouse zygotes). The inference is that AICDA deaminates cytidine to uridine and then UNG and the base excision repair pathway remove the uridine residue and any adjacent 5-methylcytidine residues, resynthesizing DNA with unmodified cytidine residues in their places.", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P13051-1" ], "evidence": [ { "id": "R-HSA-9817512", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9817512" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "P13051", "gene_name": "UNG", "activity": [ { "ec_number": "3.2.2.27", "activity": "Hydrolyzes single-stranded DNA or mismatched double-stranded DNA and polynucleotides, releasing free uracil.", "evidence": [ { "id": "P13051", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13051" } ] }, { "ec_number": "3.2.2.27", "activity": "", "evidence": [ { "id": "P13051", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13051" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 6, 8, 12, 14, 23, 31, 40, 60, 63, 64, 67, 126 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 16 }, { "field": "total_sites", "count": 12 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 44 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }