{
"uniprot_canonical_ac": "P12277-1",
"uniprot_ac": "P12277",
"uniprot_id": "KCRB_HUMAN",
"mass": {
"chemical_mass": 42644.0,
"monoisotopic_mass": 42644.0
},
"refseq": {
"ac": "NP_001814",
"name": "creatine kinase B-type isoform 1",
"summary": "The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a heterodimer with a similar muscle isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. A pseudogene of this gene has been characterized. [provided by RefSeq, Jul 2008].",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001814"
},
"gene_names": [
{
"name": "CKB",
"resource": "UniProtKB",
"type": "recommended",
"url": "https://www.uniprot.org/uniprot/P12277",
"id": "P12277"
},
{
"name": "B-CK; BCK; CKBB; CPK-B; HEL-211; HEL-S-29",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001814",
"id": "NP_001814"
},
{
"name": "CKBB",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/P12277",
"id": "P12277"
},
{
"name": "CKB",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001814",
"id": "NP_001814"
},
{
"name": "hCG_25499",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/P12277",
"id": "P12277"
}
],
"protein_names": [
{
"name": "Creatine kinase B-type",
"resource": "UniProtKB",
"type": "recommended",
"url": "",
"id": "P12277"
},
{
"name": "2.7.3.2",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P12277"
},
{
"name": "B-CK",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P12277"
},
{
"name": "Brain creatine kinase",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P12277"
},
{
"name": "CPK-B",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P12277"
},
{
"name": "Creatine kinase B chain",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P12277"
},
{
"name": "Creatine phosphokinase B-type",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "P12277"
},
{
"name": "creatine kinase B-type isoform 1",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001814",
"id": "NP_001814"
},
{
"name": "creatine kinase B-type; creatine kinase B chain; epididymis secretory protein Li 29; epididymis luminal protein 211; creatine kinase brain; creatine kinase brain-type; brain creatine kinase; creatine phosphokinase B-type",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001814",
"id": "NP_001814"
}
],
"function": [
{
"annotation": "CKB inhibits epithelial-mesenchymal transition and prostate cancer progression by sequestering and inhibiting AKT activation.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001814",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001814"
},
{
"database": "PubMed",
"id": "34706306",
"url": "https://glygen.org/publication/PubMed/34706306"
}
]
},
{
"annotation": "Clinical impact of creatine phosphokinase and c-reactive protein as predictors of postgastrectomy complications in patients with gastric cancer. Publication Status: Online-Only",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001814",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001814"
},
{
"database": "PubMed",
"id": "33485312",
"url": "https://glygen.org/publication/PubMed/33485312"
}
]
},
{
"annotation": "Creatine kinase B controls futile creatine cycling in thermogenic fat.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001814",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001814"
},
{
"database": "PubMed",
"id": "33597756",
"url": "https://glygen.org/publication/PubMed/33597756"
}
]
},
{
"annotation": "Creatine kinase B suppresses ferroptosis by phosphorylating GPX4 through a moonlighting function.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001814",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001814"
},
{
"database": "PubMed",
"id": "37156912",
"url": "https://glygen.org/publication/PubMed/37156912"
}
]
},
{
"annotation": "Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate) (PubMed:8186255). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa (Probable). Acts as a key regulator of adaptive thermogenesis as part of the futile creatine cycle: localizes to the mitochondria of thermogenic fat cells and acts by mediating phosphorylation of creatine to initiate a futile cycle of creatine phosphorylation and dephosphorylation (By similarity). During the futile creatine cycle, creatine and N-phosphocreatine are in a futile cycle, which dissipates the high energy charge of N-phosphocreatine as heat without performing any mechanical or chemical work (By similarity).",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277#function"
},
{
"database": "UniProtKB",
"id": "Q04447",
"url": "https://www.uniprot.org/uniprot/Q04447#function"
},
{
"database": "PubMed",
"id": "8186255",
"url": "https://glygen.org/publication/PubMed/8186255"
}
]
},
{
"annotation": "The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a heterodimer with a similar muscle isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. A pseudogene of this gene has been characterized. [provided by RefSeq, Jul 2008].",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001814",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001814"
}
]
}
],
"disease": [],
"snv": [],
"mutagenesis": [
{
"start_pos": 283,
"end_pos": 283,
"sequence_org": "C",
"sequence_mut": "S",
"comment": "Complete loss of activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
},
{
"database": "PubMed",
"id": "8186255",
"url": "https://glygen.org/publication/PubMed/8186255"
}
]
},
{
"start_pos": 283,
"end_pos": 283,
"sequence_org": "C",
"sequence_mut": "Y",
"comment": "Complete loss of activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
},
{
"database": "PubMed",
"id": "8186255",
"url": "https://glygen.org/publication/PubMed/8186255"
}
]
},
{
"start_pos": 292,
"end_pos": 292,
"sequence_org": "R",
"sequence_mut": "H",
"comment": "Complete loss of activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
},
{
"database": "PubMed",
"id": "8186255",
"url": "https://glygen.org/publication/PubMed/8186255"
}
]
},
{
"start_pos": 292,
"end_pos": 292,
"sequence_org": "R",
"sequence_mut": "K",
"comment": "42% of wild-type activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
},
{
"database": "PubMed",
"id": "8186255",
"url": "https://glygen.org/publication/PubMed/8186255"
}
]
},
{
"start_pos": 292,
"end_pos": 292,
"sequence_org": "R",
"sequence_mut": "L",
"comment": "Complete loss of activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
},
{
"database": "PubMed",
"id": "8186255",
"url": "https://glygen.org/publication/PubMed/8186255"
}
]
},
{
"start_pos": 292,
"end_pos": 292,
"sequence_org": "R",
"sequence_mut": "Q",
"comment": "Complete loss of activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
},
{
"database": "PubMed",
"id": "8186255",
"url": "https://glygen.org/publication/PubMed/8186255"
}
]
},
{
"start_pos": 340,
"end_pos": 340,
"sequence_org": "D",
"sequence_mut": "E",
"comment": "No change in activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
},
{
"database": "PubMed",
"id": "8186255",
"url": "https://glygen.org/publication/PubMed/8186255"
}
]
}
],
"expression_tissue": [
{
"tissue": {
"name": "Adult mammalian kidney",
"namespace": "UBERON",
"id": "0000082",
"url": "http://purl.obolibrary.org/obo/UBERON_0000082"
},
"score": "99.46",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000166165",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000166165"
}
]
},
{
"tissue": {
"name": "Stomach",
"namespace": "UBERON",
"id": "0000945",
"url": "http://purl.obolibrary.org/obo/UBERON_0000945"
},
"score": "99.46",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000166165",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000166165"
}
]
},
{
"tissue": {
"name": "Esophagus",
"namespace": "UBERON",
"id": "0001043",
"url": "http://purl.obolibrary.org/obo/UBERON_0001043"
},
"score": "99.73",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000166165",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000166165"
}
]
},
{
"tissue": {
"name": "Rectum",
"namespace": "UBERON",
"id": "0001052",
"url": "http://purl.obolibrary.org/obo/UBERON_0001052"
},
"score": "99.5",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000166165",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000166165"
}
]
},
{
"tissue": {
"name": "Urinary bladder",
"namespace": "UBERON",
"id": "0001255",
"url": "http://purl.obolibrary.org/obo/UBERON_0001255"
},
"score": "99.66",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000166165",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000166165"
}
]
},
{
"tissue": {
"name": "Thyroid gland",
"namespace": "UBERON",
"id": "0002046",
"url": "http://purl.obolibrary.org/obo/UBERON_0002046"
},
"score": "99.31",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000166165",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000166165"
}
]
},
{
"tissue": {
"name": "Liver",
"namespace": "UBERON",
"id": "0002107",
"url": "http://purl.obolibrary.org/obo/UBERON_0002107"
},
"score": "80.01",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000166165",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000166165"
}
]
},
{
"tissue": {
"name": "Prostate gland",
"namespace": "UBERON",
"id": "0002367",
"url": "http://purl.obolibrary.org/obo/UBERON_0002367"
},
"score": "99.84",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000166165",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000166165"
}
]
},
{
"tissue": {
"name": "Thoracic mammary gland",
"namespace": "UBERON",
"id": "0005200",
"url": "http://purl.obolibrary.org/obo/UBERON_0005200"
},
"score": "97.8",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000166165",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000166165"
}
]
}
],
"expression_disease": [
{
"significant": "No",
"trend": "down",
"name": "Prostate cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10283",
"evidence": [
{
"database": "BioXpress",
"id": "P12277",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12277"
}
],
"disease": [
{
"disease_id": "DOID:10283",
"recommended_name": {
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer",
"description": "A male reproductive organ cancer that is located_in the prostate."
},
"synonyms": [
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "NGP - new growth of prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "malignant tumor of the prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "tumor of the prostate",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, type 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "HPC9",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "EHBP1 familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "familial prostate cancer caused by mutation in EHBP1",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, type 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "HPC12",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, type 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "HPC5",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, type 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, susceptibility to, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "HPC3",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, type 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, susceptibility to, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "HPC4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, on chromosome 7",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "MSMB familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "familial prostate cancer caused by mutation in MSMB",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, type 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "HPC13",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, type 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "HPC8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "predisposing for prostate cancer",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, type 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "HPC6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "HPC10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate carcinoma",
"description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate carcinoma",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, somatic",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, hereditary",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "HPC7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer aggressiveness",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "RNASEL familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "familial prostate cancer caused by mutation in RNASEL",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, type 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "HPC1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "Prca1",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "HPC11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "HPC14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "HPC15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "HPCX1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer susceptibility, X-linked",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "HPCX2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MIM:611868",
"resource": "MIM",
"url": "https://www.omim.org/entry/611868",
"name": "Prostate cancer, hereditary, 12",
"description": "Prostate cancer, hereditary, 12"
},
{
"id": "MIM:611928",
"resource": "MIM",
"url": "https://www.omim.org/entry/611928",
"name": "Prostate cancer, hereditary, 13",
"description": "Prostate cancer, hereditary, 13"
},
{
"id": "MIM:176807",
"resource": "MIM",
"url": "https://www.omim.org/entry/176807",
"name": "Prostate cancer",
"description": "Prostate cancer"
},
{
"id": "MIM:601518",
"resource": "MIM",
"url": "https://www.omim.org/entry/601518",
"name": "Prostate cancer, hereditary, 1",
"description": "Prostate cancer, hereditary, 1"
},
{
"id": "MIM:611955",
"resource": "MIM",
"url": "https://www.omim.org/entry/611955",
"name": "Prostate cancer, hereditary, 11",
"description": "Prostate cancer, hereditary, 11"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Stomach cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10534",
"evidence": [
{
"database": "BioXpress",
"id": "P12277",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12277"
}
],
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Urinary bladder cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11054",
"evidence": [
{
"database": "BioXpress",
"id": "P12277",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12277"
}
],
"disease": [
{
"disease_id": "DOID:11054",
"recommended_name": {
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
},
"synonyms": [
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "bladder cancer",
"description": ""
},
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": "A primary or metastatic malignant neoplasm involving the bladder."
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "bladder cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "cancer of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumour",
"description": ""
},
{
"id": "MIM:109800",
"resource": "MIM",
"url": "https://www.omim.org/entry/109800",
"name": "Bladder cancer",
"description": "Bladder cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Head and neck cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11934",
"evidence": [
{
"database": "BioXpress",
"id": "P12277",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12277"
}
],
"disease": [
{
"disease_id": "DOID:11934",
"recommended_name": {
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck cancer",
"description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
},
"synonyms": [
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck tumours",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head/neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "tumor of head and neck",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Lung cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1324",
"evidence": [
{
"database": "BioXpress",
"id": "P12277",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12277"
}
],
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Breast cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1612",
"evidence": [
{
"database": "BioXpress",
"id": "P12277",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12277"
}
],
"disease": [
{
"disease_id": "DOID:1612",
"recommended_name": {
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland."
},
"synonyms": [
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant neoplasm of breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant tumor of the breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary cancer",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "primary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, lobular, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of the breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial Male",
"description": ""
},
{
"id": "MIM:114480",
"resource": "MIM",
"url": "https://www.omim.org/entry/114480",
"name": "Breast cancer",
"description": "Breast cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Thyroid cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1781",
"evidence": [
{
"database": "BioXpress",
"id": "P12277",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12277"
}
],
"disease": [
{
"disease_id": "DOID:1781",
"recommended_name": {
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid cancer",
"description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
},
"synonyms": [
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid gland cancer",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "Thyroid gland neoplasm",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant tumour of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Kidney cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:263",
"evidence": [
{
"database": "BioXpress",
"id": "P12277",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12277"
}
],
"disease": [
{
"disease_id": "DOID:263",
"recommended_name": {
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "kidney cancer",
"description": "A urinary system cancer that is located_in the kidney."
},
"synonyms": [
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant neoplasm of kidney except pelvis",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant tumour of kidney",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "renal cancer",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Liver cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:3571",
"evidence": [
{
"database": "BioXpress",
"id": "P12277",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12277"
}
],
"disease": [
{
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "down",
"name": "Uterine cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:363",
"evidence": [
{
"database": "BioXpress",
"id": "P12277",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12277"
}
],
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Esophageal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:5041",
"evidence": [
{
"database": "BioXpress",
"id": "P12277",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12277"
}
],
"disease": [
{
"disease_id": "DOID:5041",
"recommended_name": {
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophageal cancer",
"description": "A gastrointestinal system cancer that is located_in the esophagus."
},
"synonyms": [
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophagus cancer",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Distal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Proximal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of the middle Third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": "A primary or metastatic malignant neoplasm involving the esophagus."
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "oesophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the middle third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of abdominal oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the middle third of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Aerodigestive tract cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Escc, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "gastric cardia adenocarcinoma, susceptibility to",
"description": ""
},
{
"id": "MIM:133239",
"resource": "MIM",
"url": "https://www.omim.org/entry/133239",
"name": "Esophageal cancer",
"description": "Esophageal cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Colorectal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:9256",
"evidence": [
{
"database": "BioXpress",
"id": "P12277",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12277"
}
],
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
}
]
}
],
"species": [
{
"name": "Homo sapiens",
"taxid": 9606,
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"common_name": "Human"
}
],
"gene": [
{
"name": "CKB",
"url": "https://www.uniprot.org/uniprot/P12277",
"locus": {
"chromosome": "14",
"start_pos": 103519667,
"end_pos": 103522833,
"strand": "+",
"evidence": [
{
"database": "Ensembl Gene",
"id": "ENSG00000166165",
"url": "https://www.ensembl.org/id/ENSG00000166165"
}
]
}
}
],
"crossref": [
{
"id": "ENSG00000166165",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000166165",
"database": "Bgee",
"categories": [
"Gene Expression"
]
},
{
"id": "2.7.3.2",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.7.3.2&UniProtAcc=P12277",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "cd00716",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00716",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "CHEMBL6049",
"url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL6049",
"database": "ChEMBL",
"categories": [
"Other"
]
},
{
"id": "CKB",
"url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CKB",
"database": "GeneCards",
"categories": [
"Gene Annotation",
"Organism-specific"
]
},
{
"id": "1152",
"url": "https://www.ncbi.nlm.nih.gov/gene/1152",
"database": "GeneID",
"categories": [
"Genome Annotation"
]
},
{
"id": "1991",
"url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=1991",
"database": "HGNC",
"categories": [
"Organism-specific"
]
},
{
"id": "P12277",
"url": "https://www.ebi.ac.uk/intact/interactors/id:P12277*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "IPR000749",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR000749",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR014746",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR014746",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR022413",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR022413",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR022414",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR022414",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR022415",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR022415",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR036802",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR036802",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "hsa:1152",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1152",
"database": "KEGG Pathway",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "123280",
"url": "http://www.omim.org/entry/123280",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "NX_P12277",
"url": "https://www.nextprot.org/entry/NX_P12277",
"database": "neXtProt",
"categories": [
"Protein",
"Organism-specific"
]
},
{
"id": "P12277",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P12277",
"database": "O-GlcNAc Database",
"categories": [
"Glycoproteomics"
]
},
{
"id": "NRGHEFM",
"url": "https://omabrowser.org/oma/group/NRGHEFM/",
"database": "OMA",
"categories": [
"Protein Classification"
]
},
{
"id": "35839at2759",
"url": "http://www.orthodb.org/?query=35839at2759",
"database": "OrthoDB",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR11547",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11547",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR11547:SF23",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11547:SF23",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "3B6R",
"url": "https://www.rcsb.org/structure/3B6R",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3DRB",
"url": "https://www.rcsb.org/structure/3DRB",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3DRE",
"url": "https://www.rcsb.org/structure/3DRE",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6V9H",
"url": "https://www.rcsb.org/structure/6V9H",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7BF1",
"url": "https://www.rcsb.org/structure/7BF1",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7TUN",
"url": "https://www.rcsb.org/structure/7TUN",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "PF00217",
"url": "http://pfam.xfam.org/family/PF00217",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "PF02807",
"url": "http://pfam.xfam.org/family/PF02807",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "P12277",
"url": "https://pharos.nih.gov/targets/P12277",
"database": "PHAROS",
"categories": [
"Organism-specific"
]
},
{
"id": "PR_P12277",
"url": "http://purl.obolibrary.org/obo/PR_P12277",
"database": "PRO",
"categories": [
"Protein"
]
},
{
"id": "R-HSA-71288",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71288",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9696264",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696264",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "NP_001814",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001814",
"database": "RefSeq",
"categories": [
"Protein"
]
},
{
"id": "17157",
"url": "https://www.rhea-db.org/rhea/17157",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "A0A0S2Z471",
"url": "https://www.uniprot.org/uniprot/A0A0S2Z471",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A0S2Z471-1",
"url": "https://www.uniprot.org/uniprot/A0A0S2Z471-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "G3V2I1",
"url": "https://www.uniprot.org/uniprot/G3V2I1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "G3V2I1-1",
"url": "https://www.uniprot.org/uniprot/G3V2I1-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "G3V461",
"url": "https://www.uniprot.org/uniprot/G3V461",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "G3V461-1",
"url": "https://www.uniprot.org/uniprot/G3V461-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "G3V4N7",
"url": "https://www.uniprot.org/uniprot/G3V4N7",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "G3V4N7-1",
"url": "https://www.uniprot.org/uniprot/G3V4N7-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "H0YJG0",
"url": "https://www.uniprot.org/uniprot/H0YJG0",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "H0YJG0-1",
"url": "https://www.uniprot.org/uniprot/H0YJG0-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "H0YJJ7",
"url": "https://www.uniprot.org/uniprot/H0YJJ7",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "H0YJJ7-1",
"url": "https://www.uniprot.org/uniprot/H0YJJ7-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "H0YJK0",
"url": "https://www.uniprot.org/uniprot/H0YJK0",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "H0YJK0-1",
"url": "https://www.uniprot.org/uniprot/H0YJK0-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "P12277-1",
"url": "https://www.uniprot.org/uniprot/P12277-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
}
],
"sequence": {
"sequence": "MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK",
"length": 381,
"header": "sp|P12277-1|KCRB_HUMAN Isoform 1 of Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1 CANONICAL=P12277-1"
},
"isoforms": [
{
"isoform_ac": "A0A0S2Z471-1",
"url": "",
"sequence": {
"sequence": "MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQVRGCGRAGRAGPGSSGAHSRLASQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK",
"length": 405,
"header": "tr|A0A0S2Z471-1|KCRB_HUMAN Computationally mapped isoform of Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1 CANONICAL=P12277-1"
},
"locus": {
"chromosome": "14",
"start_pos": 103522493,
"end_pos": 103519867,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000689346.1",
"url": "https://www.ensembl.org/id/ENST00000689346.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000508488.1",
"url": "https://www.ensembl.org/id/ENSP00000508488.1"
}
]
}
},
{
"isoform_ac": "G3V2I1-1",
"url": "",
"sequence": {
"sequence": "MPFSNSHNALKLRFPAEDEPPVHHDRGLRGGRRGVLRSVQGSLRPHHRGPARRLQAQR",
"length": 58,
"header": "tr|G3V2I1-1|KCRB_HUMAN Computationally mapped isoform of Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1 CANONICAL=P12277-1"
},
"locus": {
"chromosome": "14",
"start_pos": 103522493,
"end_pos": 103522060,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000553652.5",
"url": "https://www.ensembl.org/id/ENST00000553652.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000450676.1",
"url": "https://www.ensembl.org/id/ENSP00000450676.1"
}
]
}
},
{
"isoform_ac": "G3V461-1",
"url": "",
"sequence": {
"sequence": "MAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKL",
"length": 128,
"header": "tr|G3V461-1|KCRB_HUMAN Computationally mapped isoform of Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1 CANONICAL=P12277-1"
},
"locus": {
"chromosome": "14",
"start_pos": 103522406,
"end_pos": 103521828,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000557530.1",
"url": "https://www.ensembl.org/id/ENST00000557530.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000451611.1",
"url": "https://www.ensembl.org/id/ENSP00000451611.1"
}
]
}
},
{
"isoform_ac": "G3V4N7-1",
"url": "",
"sequence": {
"sequence": "MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGI",
"length": 217,
"header": "tr|G3V4N7-1|KCRB_HUMAN Computationally mapped isoform of Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1 CANONICAL=P12277-1"
},
"locus": {
"chromosome": "14",
"start_pos": 103522493,
"end_pos": 103521265,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000553878.5",
"url": "https://www.ensembl.org/id/ENST00000553878.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000451904.1",
"url": "https://www.ensembl.org/id/ENSP00000451904.1"
}
]
}
},
{
"isoform_ac": "H0YJG0-1",
"url": "",
"sequence": {
"sequence": "FLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK",
"length": 179,
"header": "tr|H0YJG0-1|KCRB_HUMAN Computationally mapped isoform of Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1 CANONICAL=P12277-1"
},
"locus": {
"chromosome": "14",
"start_pos": 103521342,
"end_pos": 103519867,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000553610.5",
"url": "https://www.ensembl.org/id/ENST00000553610.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000451426.1",
"url": "https://www.ensembl.org/id/ENSP00000451426.1"
}
]
}
},
{
"isoform_ac": "H0YJJ7-1",
"url": "",
"sequence": {
"sequence": "XSPLLLASGMARDWPDARGI",
"length": 20,
"header": "tr|H0YJJ7-1|KCRB_HUMAN Computationally mapped isoform of Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1 CANONICAL=P12277-1"
},
"locus": {
"chromosome": "14",
"start_pos": 103521322,
"end_pos": 103521263,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000554989.1",
"url": "https://www.ensembl.org/id/ENST00000554989.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000451680.1",
"url": "https://www.ensembl.org/id/ENSP00000451680.1"
}
]
}
},
{
"isoform_ac": "H0YJK0-1",
"url": "",
"sequence": {
"sequence": "XPAPVTLAEQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNA",
"length": 90,
"header": "tr|H0YJK0-1|H0YJK0_HUMAN Computationally mapped isoform of Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1 CANONICAL=P12277-1"
},
"locus": {
"chromosome": "14",
"start_pos": 103521101,
"end_pos": 103519992,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000555039.1",
"url": "https://www.ensembl.org/id/ENST00000555039.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000451686.1",
"url": "https://www.ensembl.org/id/ENSP00000451686.1"
}
]
}
},
{
"isoform_ac": "P12277-1",
"url": "",
"sequence": {
"sequence": "MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK",
"length": 381,
"header": "sp|P12277-1|KCRB_HUMAN Isoform 1 of Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1 CANONICAL=P12277-1"
},
"locus": {
"chromosome": "14",
"start_pos": 103522493,
"end_pos": 103519867,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000348956.7",
"url": "https://www.ensembl.org/id/ENST00000348956.7"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000299198.2",
"url": "https://www.ensembl.org/id/ENSP00000299198.2"
}
]
}
}
],
"glycosylation": [
{
"glytoucan_ac": "G49108TO",
"type": "O-linked",
"subtype": "O-GlcNAcylation",
"site_category": "reported_with_glycan",
"site_seq": "",
"relation": "attached",
"comment": "O-GlcNAcylation",
"evidence": [
{
"id": "P12277",
"database": "O-GlcNAc Database",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P12277"
},
{
"id": "35008409",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/35008409"
},
{
"id": "33214551",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/33214551"
},
{
"id": "35138101",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/35138101"
},
{
"id": "24126823",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/24126823"
},
{
"id": "34725712",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/34725712"
},
{
"id": "34019948",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/34019948"
},
{
"id": "32119511",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/32119511"
},
{
"id": "28510447",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/28510447"
}
]
}
],
"phosphorylation": [
{
"start_pos": 125,
"end_pos": 125,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Tyr",
"comment": "Phosphotyrosine",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"site_lbl": "Tyr125"
},
{
"start_pos": 199,
"end_pos": 199,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
},
{
"database": "PubMed",
"id": "18669648",
"url": "https://glygen.org/publication/PubMed/18669648"
},
{
"database": "iPTMnet",
"id": "P12277",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12277"
},
{
"database": "phospho.ELM",
"id": "P12277",
"url": "http://phospho.elm.eu.org/byAccession/P12277.html"
}
],
"site_lbl": "Ser199"
},
{
"start_pos": 309,
"end_pos": 309,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"site_lbl": "Ser309"
},
{
"start_pos": 322,
"end_pos": 322,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "Phosphothreonine",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"site_lbl": "Thr322"
},
{
"start_pos": 35,
"end_pos": 35,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "Phosphothreonine",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
},
{
"database": "PubMed",
"id": "18669648",
"url": "https://glygen.org/publication/PubMed/18669648"
},
{
"database": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
},
{
"database": "iPTMnet",
"id": "P12277",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12277"
},
{
"database": "PubMed",
"id": "19651622",
"url": "https://glygen.org/publication/PubMed/19651622"
},
{
"database": "PubMed",
"id": "20058876",
"url": "https://glygen.org/publication/PubMed/20058876"
},
{
"database": "PubMed",
"id": "20068231",
"url": "https://glygen.org/publication/PubMed/20068231"
},
{
"database": "phospho.ELM",
"id": "P12277",
"url": "http://phospho.elm.eu.org/byAccession/P12277.html"
}
],
"site_lbl": "Thr35"
},
{
"start_pos": 4,
"end_pos": 4,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
},
{
"database": "PubMed",
"id": "20068231",
"url": "https://glygen.org/publication/PubMed/20068231"
},
{
"database": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
},
{
"database": "iPTMnet",
"id": "P12277",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12277"
},
{
"database": "PubMed",
"id": "19413330",
"url": "https://glygen.org/publication/PubMed/19413330"
},
{
"database": "PubMed",
"id": "19651622",
"url": "https://glygen.org/publication/PubMed/19651622"
}
],
"site_lbl": "Ser4"
}
],
"glycation": [],
"keywords": [
"enzyme",
"glycoprotein",
"glycoprotein_reported_with_glycan"
],
"publication": [
{
"title": "Arginine:glycine amidinotransferase deficiency: the third inborn error of creatine metabolism in humans.",
"journal": "American journal of human genetics",
"date": "2001",
"authors": "Item CB, Stockler-Ipsiroglu S, Stromberger C, Muhl A, Alessandri MG, Bianchi MC, Tosetti M, Fornai F, Cioni G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-71288",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71288"
}
],
"reference": [
{
"type": "PubMed",
"id": "11555793",
"url": "https://glygen.org/publication/PubMed/11555793"
}
]
},
{
"title": "Socius is a novel Rnd GTPase-interacting protein involved in disassembly of actin stress fibers.",
"journal": "Molecular and cellular biology",
"date": "2002",
"authors": "Katoh H, Harada A, Mori K, Negishi M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9696264",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696264"
}
],
"reference": [
{
"type": "PubMed",
"id": "11940653",
"url": "https://glygen.org/publication/PubMed/11940653"
}
]
},
{
"title": "Rnd proteins function as RhoA antagonists by activating p190 RhoGAP.",
"journal": "Current biology : CB",
"date": "2003",
"authors": "Wennerberg K, Forget MA, Ellerbroek SM, Arthur WT, Burridge K, Settleman J, Der CJ, Hansen SH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9696264",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696264"
}
],
"reference": [
{
"type": "PubMed",
"id": "12842009",
"url": "https://glygen.org/publication/PubMed/12842009"
}
]
},
{
"title": "X-linked creatine transporter defect: an overview.",
"journal": "Journal of inherited metabolic disease",
"date": "2003",
"authors": "Salomons GS, van Dooren SJ, Verhoeven NM, Marsden D, Schwartz C, Cecil KM, DeGrauw TJ, Jakobs C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-71288",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71288"
}
],
"reference": [
{
"type": "PubMed",
"id": "12889669",
"url": "https://glygen.org/publication/PubMed/12889669"
}
]
},
{
"title": "C-terminal lysines determine phospholipid interaction of sarcomeric mitochondrial creatine kinase.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Schlattner U, Gehring F, Vernoux N, Tokarska-Schlattner M, Neumann D, Marcillat O, Vial C, Wallimann T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-71288",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71288"
}
],
"reference": [
{
"type": "PubMed",
"id": "15044463",
"url": "https://glygen.org/publication/PubMed/15044463"
}
]
},
{
"title": "Direct interaction of Rnd1 with FRS2 beta regulates Rnd1-induced down-regulation of RhoA activity and is involved in fibroblast growth factor-induced neurite outgrowth in PC12 cells.",
"journal": "The Journal of biological chemistry",
"date": "2005",
"authors": "Harada A, Katoh H, Negishi M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9696264",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696264"
}
],
"reference": [
{
"type": "PubMed",
"id": "15738000",
"url": "https://glygen.org/publication/PubMed/15738000"
}
]
},
{
"title": "Exploring the role of the active site cysteine in human muscle creatine kinase.",
"journal": "Biochemistry",
"date": "2006",
"authors": "Wang PF, Flynn AJ, Naor MM, Jensen JH, Cui G, Merz KM Jr, Kenyon GL, McLeish MJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-71288",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71288"
}
],
"reference": [
{
"type": "PubMed",
"id": "16981706",
"url": "https://glygen.org/publication/PubMed/16981706"
}
]
},
{
"title": "HMSN/ACC truncation mutations disrupt brain-type creatine kinase-dependant activation of K+/Cl- co-transporter 3.",
"journal": "Hum. Mol. Genet.",
"date": "2008",
"authors": "Salin-Cantegrel Ad\u00e8le, Shekarabi Masoud, Holbert S\u00e9bastien, Dion Patrick, Rochefort Daniel, Lagani\u00e8re Janet, Dacal Sandra, Hince Pascale, Karemera Liliane, Gaspar Claudia, Lapointe Jean-Yves, Rouleau Guy A",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"reference": [
{
"type": "PubMed",
"id": "18566107",
"url": "https://glygen.org/publication/PubMed/18566107"
}
]
},
{
"title": "A quantitative atlas of mitotic phosphorylation.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2008",
"authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
},
{
"database": "iPTMnet",
"id": "P12277",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12277"
}
],
"reference": [
{
"type": "PubMed",
"id": "18669648",
"url": "https://glygen.org/publication/PubMed/18669648"
}
]
},
{
"title": "Structural studies of human brain-type creatine kinase complexed with the ADP-Mg2+-NO3- -creatine transition-state analogue complex.",
"journal": "FEBS Lett.",
"date": "2008",
"authors": "Bong SM, Moon JH, Nam KH, Lee KS, Chi YM, Hwang KY",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"reference": [
{
"type": "PubMed",
"id": "18977227",
"url": "https://glygen.org/publication/PubMed/18977227"
}
]
},
{
"title": "Rnd1 regulates axon extension by enhancing the microtubule destabilizing activity of SCG10.",
"journal": "The Journal of biological chemistry",
"date": "2009",
"authors": "Li YH, Ghavampur S, Bondallaz P, Will L, Grenningloh G, Puschel AW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9696264",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696264"
}
],
"reference": [
{
"type": "PubMed",
"id": "18996843",
"url": "https://glygen.org/publication/PubMed/18996843"
}
]
},
{
"title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.",
"journal": "Analytical chemistry",
"date": "2009",
"authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S",
"evidence": [
{
"database": "iPTMnet",
"id": "P12277",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12277"
}
],
"reference": [
{
"type": "PubMed",
"id": "19413330",
"url": "https://glygen.org/publication/PubMed/19413330"
}
]
},
{
"title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.",
"journal": "Molecular & cellular proteomics : MCP",
"date": "2009",
"authors": "Pan C, Olsen JV, Daub H, Mann M",
"evidence": [
{
"database": "iPTMnet",
"id": "P12277",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12277"
}
],
"reference": [
{
"type": "PubMed",
"id": "19651622",
"url": "https://glygen.org/publication/PubMed/19651622"
}
]
},
{
"title": "Exploring the human leukocyte phosphoproteome using a microfluidic reversed-phase-TiO2-reversed-phase high-performance liquid chromatography phosphochip coupled to a quadrupole time-of-flight mass spectrometer.",
"journal": "Analytical chemistry",
"date": "2010",
"authors": "Raijmakers R, Kraiczek K, de Jong AP, Mohammed S, Heck AJ",
"evidence": [
{
"database": "iPTMnet",
"id": "P12277",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12277"
}
],
"reference": [
{
"type": "PubMed",
"id": "20058876",
"url": "https://glygen.org/publication/PubMed/20058876"
}
]
},
{
"title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.",
"journal": "Science signaling",
"date": "2010",
"authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
},
{
"database": "iPTMnet",
"id": "P12277",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12277"
}
],
"reference": [
{
"type": "PubMed",
"id": "20068231",
"url": "https://glygen.org/publication/PubMed/20068231"
}
]
},
{
"title": "The RhoA GEF Syx is a target of Rnd3 and regulated via a Raf1-like ubiquitin-related domain.",
"journal": "PloS one",
"date": "2010",
"authors": "Goh LL, Manser E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9696264",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696264"
}
],
"reference": [
{
"type": "PubMed",
"id": "20811643",
"url": "https://glygen.org/publication/PubMed/20811643"
}
]
},
{
"title": "Resveratrol-induced changes of the human adipocyte secretion profile.",
"journal": "J. Proteome Res.",
"date": "2012",
"authors": "Rosenow Anja, Noben Jean-Paul, Jocken Johan, Kallendrusch Sonja, Fischer-Posovszky Pamela, Mariman Edwin C M, Renes Johan",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"reference": [
{
"type": "PubMed",
"id": "22905912",
"url": "https://glygen.org/publication/PubMed/22905912"
}
]
},
{
"title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.",
"journal": "Journal of proteome research",
"date": "2013",
"authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
},
{
"database": "iPTMnet",
"id": "P12277",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12277"
}
],
"reference": [
{
"type": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
}
]
},
{
"title": "Separate nuclear genes encode sarcomere-specific and ubiquitous human mitochondrial creatine kinase isoenzymes.",
"journal": "The Journal of biological chemistry",
"date": "1990",
"authors": "Haas RC, Strauss AW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-71288",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71288"
}
],
"reference": [
{
"type": "PubMed",
"id": "2324105",
"url": "https://glygen.org/publication/PubMed/2324105"
}
]
},
{
"title": "Aberrant O-GlcNAc-modified proteins expressed in primary colorectal cancer.",
"journal": "Oncology reports",
"date": "2013",
"authors": "Phueaouan T, Chaiyawat P, Netsirisawan P, Chokchaichamnankit D, Punyarit P, Srisomsap C, Svasti J, Champattanachai V",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P12277",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P12277"
}
],
"reference": [
{
"type": "PubMed",
"id": "24126823",
"url": "https://glygen.org/publication/PubMed/24126823"
}
]
},
{
"title": "Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.",
"journal": "Cell",
"date": "2016",
"authors": "Yang Xinping, Coulombe-Huntington Jasmin, Kang Shuli, Sheynkman Gloria M, Hao Tong, Richardson Aaron, Sun Song, Yang Fan, Shen Yun A, Murray Ryan R, Spirohn Kerstin, Begg Bridget E, Duran-Frigola Miquel, MacWilliams Andrew, Pevzner Samuel J, Zhong Quan, Trigg Shelly A, Tam Stanley, Ghamsari Lila, Sahni Nidhi, Yi Song, Rodriguez Maria D, Balcha Dawit, Tan Guihong, Costanzo Michael, Andrews Brenda, Boone Charles, Zhou Xianghong J, Salehi-Ashtiani Kourosh, Charloteaux Benoit, Chen Alyce A, Calderwood Michael A, Aloy Patrick, Roth Frederick P, Hill David E, Iakoucheva Lilia M, Xia Yu, Vidal Marc",
"evidence": [
{
"database": "UniProtKB",
"id": "A0A0S2Z471",
"url": "https://www.uniprot.org/uniprot/A0A0S2Z471"
}
],
"reference": [
{
"type": "PubMed",
"id": "26871637",
"url": "https://glygen.org/publication/PubMed/26871637"
}
]
},
{
"title": "Bacurd1/Kctd13 and Bacurd2/Tnfaip1 are interacting partners to Rnd proteins which influence the long-term positioning and dendritic maturation of cerebral cortical neurons.",
"journal": "Neural development",
"date": "2016",
"authors": "Gladwyn-Ng I, Huang L, Ngo L, Li SS, Qu Z, Vanyai HK, Cullen HD, Davis JM, Heng JI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9696264",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696264"
}
],
"reference": [
{
"type": "PubMed",
"id": "26969432",
"url": "https://glygen.org/publication/PubMed/26969432"
}
]
},
{
"title": "Complete nucleotide sequence of the human creatine kinase B gene.",
"journal": "Nucleic Acids Res.",
"date": "1989",
"authors": "Mariman EC, Schepens JT, Wieringa B",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"reference": [
{
"type": "PubMed",
"id": "2771648",
"url": "https://glygen.org/publication/PubMed/2771648"
}
]
},
{
"title": "Isolation of a functional human gene for brain creatine kinase.",
"journal": "J. Biol. Chem.",
"date": "1988",
"authors": "Daouk G H, Kaddurah-Daouk R, Putney S, Kingston R, Schimmel P",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"reference": [
{
"type": "PubMed",
"id": "2828370",
"url": "https://glygen.org/publication/PubMed/2828370"
}
]
},
{
"title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.",
"journal": "Analytical chemistry",
"date": "2017",
"authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P12277",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P12277"
}
],
"reference": [
{
"type": "PubMed",
"id": "28510447",
"url": "https://glygen.org/publication/PubMed/28510447"
}
]
},
{
"title": "Human creatine kinase-B complementary DNA. Nucleotide sequence, gene expression in lung cancer, and chromosomal assignment to two distinct loci.",
"journal": "J. Clin. Invest.",
"date": "1987",
"authors": "Kaye F J, McBride O W, Battey J F, Gazdar A F, Sausville E A",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"reference": [
{
"type": "PubMed",
"id": "2883200",
"url": "https://glygen.org/publication/PubMed/2883200"
}
]
},
{
"title": "Isolation and characterization of the gene and cDNA encoding human mitochondrial creatine kinase.",
"journal": "The Journal of biological chemistry",
"date": "1989",
"authors": "Haas RC, Korenfeld C, Zhang ZF, Perryman B, Roman D, Strauss AW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-71288",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71288"
}
],
"reference": [
{
"type": "PubMed",
"id": "2914937",
"url": "https://glygen.org/publication/PubMed/2914937"
}
]
},
{
"title": "Human creatine kinase: isolation and sequence analysis of cDNA clones for the B subunit, development of subunit specific probes and determination of gene copy number.",
"journal": "Biochem. Biophys. Res. Commun.",
"date": "1987",
"authors": "Villarreal-Levy G, Ma T S, Kerner S A, Roberts R, Perryman M B",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"reference": [
{
"type": "PubMed",
"id": "3034271",
"url": "https://glygen.org/publication/PubMed/3034271"
}
]
},
{
"title": "Mapping the proximity interaction network of the Rho-family GTPases reveals signalling pathways and regulatory mechanisms.",
"journal": "Nature cell biology",
"date": "2020",
"authors": "Bagci H, Sriskandarajah N, Robert A, Boulais J, Elkholi IE, Tran V, Lin ZY, Thibault MP, Dube N, Faubert D, Hipfner DR, Gingras AC, Cote JF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9696264",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696264"
}
],
"reference": [
{
"type": "PubMed",
"id": "31871319",
"url": "https://glygen.org/publication/PubMed/31871319"
}
]
},
{
"title": "Engineering a Proximity-Directed O-GlcNAc Transferase for Selective Protein O-GlcNAcylation in Cells.",
"journal": "ACS chemical biology",
"date": "2020",
"authors": "Ramirez DH, Aonbangkhen C, Wu HY, Naftaly JA, Tang S, O'Meara TR, Woo CM",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P12277",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P12277"
}
],
"reference": [
{
"type": "PubMed",
"id": "32119511",
"url": "https://glygen.org/publication/PubMed/32119511"
}
]
},
{
"title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.",
"journal": "Nature communications",
"date": "2020",
"authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P12277",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P12277"
}
],
"reference": [
{
"type": "PubMed",
"id": "33214551",
"url": "https://glygen.org/publication/PubMed/33214551"
}
]
},
{
"title": "Clinical impact of creatine phosphokinase and c-reactive protein as predictors of postgastrectomy complications in patients with gastric cancer.",
"journal": "BMC cancer",
"date": "2021",
"authors": "Okubo K, Arigami T, Matsushita D, Kijima T, Shimonosono M, Uenosono Y, Yanagita S, Kurahara H, Mori S, Ohtsuka T, Natsugoe S",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001814",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001814"
}
],
"reference": [
{
"type": "PubMed",
"id": "33485312",
"url": "https://glygen.org/publication/PubMed/33485312"
}
]
},
{
"title": "Creatine kinase B controls futile creatine cycling in thermogenic fat.",
"journal": "Nature",
"date": "2021",
"authors": "Rahbani JF, Roesler A, Hussain MF, Samborska B, Dykstra CB, Tsai L, Jedrychowski MP, Vergnes L, Reue K, Spiegelman BM, Kazak L",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001814",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001814"
}
],
"reference": [
{
"type": "PubMed",
"id": "33597756",
"url": "https://glygen.org/publication/PubMed/33597756"
}
]
},
{
"title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.",
"journal": "Biochimica et biophysica acta. General subjects",
"date": "2021",
"authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P12277",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P12277"
}
],
"reference": [
{
"type": "PubMed",
"id": "34019948",
"url": "https://glygen.org/publication/PubMed/34019948"
}
]
},
{
"title": "CKB inhibits epithelial-mesenchymal transition and prostate cancer progression by sequestering and inhibiting AKT activation.",
"journal": "Neoplasia (New York, N.Y.)",
"date": "2021",
"authors": "Wang Z, Hulsurkar M, Zhuo L, Xu J, Yang H, Naderinezhad S, Wang L, Zhang G, Ai N, Li L, Chang JT, Zhang S, Fazli L, Creighton CJ, Bai F, Ittmann MM, Gleave ME, Li W",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001814",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001814"
}
],
"reference": [
{
"type": "PubMed",
"id": "34706306",
"url": "https://glygen.org/publication/PubMed/34706306"
}
]
},
{
"title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.",
"journal": "Analytical and bioanalytical chemistry",
"date": "2021",
"authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P12277",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P12277"
}
],
"reference": [
{
"type": "PubMed",
"id": "34725712",
"url": "https://glygen.org/publication/PubMed/34725712"
}
]
},
{
"title": "Comparative O-GlcNAc Proteomic Analysis Reveals a Role of O-GlcNAcylated SAM68 in Lung Cancer Aggressiveness.",
"journal": "Cancers",
"date": "2022",
"authors": "Lin CH, Liao CC, Wang SY, Peng CY, Yeh YC, Chen MY, Chou TY",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P12277",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P12277"
}
],
"reference": [
{
"type": "PubMed",
"id": "35008409",
"url": "https://glygen.org/publication/PubMed/35008409"
}
]
},
{
"title": "Spatiotemporal Activation of Protein O-GlcNAcylation in Living Cells.",
"journal": "Journal of the American Chemical Society",
"date": "2022",
"authors": "He J, Fan Z, Tian Y, Yang W, Zhou Y, Zhu Q, Zhang W, Qin W, Yi W",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "P12277",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=P12277"
}
],
"reference": [
{
"type": "PubMed",
"id": "35138101",
"url": "https://glygen.org/publication/PubMed/35138101"
}
]
},
{
"title": "Structure and expression of the human creatine kinase B gene.",
"journal": "Genomics",
"date": "1987",
"authors": "Mariman E C, Broers C A, Claesen C A, Tesser G I, Wieringa B",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"reference": [
{
"type": "PubMed",
"id": "3692484",
"url": "https://glygen.org/publication/PubMed/3692484"
}
]
},
{
"title": "Creatine kinase B suppresses ferroptosis by phosphorylating GPX4 through a moonlighting function.",
"journal": "Nature cell biology",
"date": "2023-05-08",
"authors": "Wu Ke, Yan Meisi, Liu Tong, Wang Zheng, Duan Yuran, Xia Yan, Ji Guimei, Shen Yuli, Wang Lei, Li Lin, Zheng Peixiang, Dong Bofei, Wu Qingang, Xiao Liwei, Yang Xueying, Shen Haochen, Wen Ting, Zhang Jingjing, Yi Jinfeng, Deng Yuhan, Qian Xu, Ma Leina, Fang Jing, Zhou Qin, Lu Zhimin, Xu Daqian",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001814",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001814"
}
],
"reference": [
{
"type": "PubMed",
"id": "37156912",
"url": "https://glygen.org/publication/PubMed/37156912"
}
]
},
{
"title": "Protein analysis of human maculae in relation to age-related maculopathy.",
"journal": "Lab. Invest.",
"date": "1995",
"authors": "Kliffen M, de Jong P T, Luider T M",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"reference": [
{
"type": "PubMed",
"id": "7637327",
"url": "https://glygen.org/publication/PubMed/7637327"
}
]
},
{
"title": "The cloning and expression of a human creatine transporter.",
"journal": "Biochemical and biophysical research communications",
"date": "1994",
"authors": "Sora I, Richman J, Santoro G, Wei H, Wang Y, Vanderah T, Horvath R, Nguyen M, Waite S, Roeske WR, et al.",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-71288",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71288"
}
],
"reference": [
{
"type": "PubMed",
"id": "7945388",
"url": "https://glygen.org/publication/PubMed/7945388"
}
]
},
{
"title": "Determination of the catalytic site of creatine kinase by site-directed mutagenesis.",
"journal": "Biochimica et biophysica acta",
"date": "1994",
"authors": "Lin L, Perryman MB, Friedman D, Roberts R, Ma TS",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"reference": [
{
"type": "PubMed",
"id": "8186255",
"url": "https://glygen.org/publication/PubMed/8186255"
}
]
},
{
"title": "Identification of a novel human Rho protein with unusual properties: GTPase deficiency and in vivo farnesylation.",
"journal": "Molecular and cellular biology",
"date": "1996",
"authors": "Foster R, Hu KQ, Lu Y, Nolan KM, Thissen J, Settleman J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9696264",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696264"
}
],
"reference": [
{
"type": "PubMed",
"id": "8649376",
"url": "https://glygen.org/publication/PubMed/8649376"
}
]
},
{
"title": "Guanidinoacetate methyltransferase deficiency: the first inborn error of creatine metabolism in man.",
"journal": "American journal of human genetics",
"date": "1996",
"authors": "Stockler S, Isbrandt D, Hanefeld F, Schmidt B, von Figura K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-71288",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71288"
}
],
"reference": [
{
"type": "PubMed",
"id": "8651275",
"url": "https://glygen.org/publication/PubMed/8651275"
}
]
},
{
"title": "Recombinant expression and isolation of human L-arginine:glycine amidinotransferase and identification of its active-site cysteine residue.",
"journal": "The Biochemical journal",
"date": "1997",
"authors": "Humm A, Fritsche E, Mann K, Gohl M, Huber R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-71288",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71288"
}
],
"reference": [
{
"type": "PubMed",
"id": "9148748",
"url": "https://glygen.org/publication/PubMed/9148748"
}
]
},
{
"title": "Crystal structure and mechanism of human L-arginine:glycine amidinotransferase: a mitochondrial enzyme involved in creatine biosynthesis.",
"journal": "The EMBO journal",
"date": "1997",
"authors": "Humm A, Fritsche E, Steinbacher S, Huber R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-71288",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71288"
}
],
"reference": [
{
"type": "PubMed",
"id": "9218780",
"url": "https://glygen.org/publication/PubMed/9218780"
}
]
},
{
"title": "Octamer formation and coupling of cardiac sarcomeric mitochondrial creatine kinase are mediated by charged N-terminal residues.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Khuchua ZA, Qin W, Boero J, Cheng J, Payne RM, Saks VA, Strauss AW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-71288",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71288"
}
],
"reference": [
{
"type": "PubMed",
"id": "9722522",
"url": "https://glygen.org/publication/PubMed/9722522"
}
]
}
],
"pathway": [
{
"id": "hsa:1152",
"name": "",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1152",
"resource": "KEGG Pathway"
},
{
"id": "R-HSA-71288",
"name": "Creatine metabolism",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-71288",
"resource": "Reactome",
"description": "Creatine metabolism"
},
{
"id": "R-HSA-9696264",
"name": "RND3 GTPase cycle",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696264",
"resource": "Reactome",
"description": "RND3 GTPase cycle"
}
],
"orthologs": [
{
"uniprot_canonical_ac": "P07335-1",
"protein_name": "Creatine kinase B-type",
"gene_name": "Ckb",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MPFSNSHNTQKLRFPAEDEFPDLSSHNNHMAKVLTPELYAELRAKCTPSGFTLDDAIQTGVDNPGHPYIMTVGAVAGDEESYDVFKDLFDPIIEDRHGGYQPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLSGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWINEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKNYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPHLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQPIDDLMPAQK",
"length": 381
},
"evidence": [
{
"id": "45917654",
"url": "http://www.informatics.jax.org/homology/45917654",
"database": "MGI"
}
],
"common_name": "Rat"
},
{
"uniprot_canonical_ac": "Q04447-1",
"protein_name": "Creatine kinase B-type",
"gene_name": "Ckb",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MPFSNSHNTQKLRFPAEDEFPDLSSHNNHMAKVLTPELYAELRAKCTPSGFTLDDAIQTGVDNPGHPYIMTVGAVAGDEESYDVFKDLFDPIIEERHGGYQPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLSGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWINEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKNYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPHLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK",
"length": 381
},
"evidence": [
{
"id": "45917654",
"url": "http://www.informatics.jax.org/homology/45917654",
"database": "MGI"
},
{
"id": "P12277",
"url": "https://omabrowser.org/oma/group/P12277/",
"database": "OMA"
}
],
"common_name": "Mouse"
}
],
"go_annotation": {
"categories": [
{
"name": "Biological Process",
"total": 4,
"go_terms": [
{
"name": "phosphocreatine biosynthetic process",
"id": "GO:0046314",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046314",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"pmid": ""
},
{
"name": "phosphorylation",
"id": "GO:0016310",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016310",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"pmid": ""
},
{
"name": "substantia nigra development",
"id": "GO:0021762",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021762",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"pmid": ""
},
{
"name": "futile creatine cycle",
"id": "GO:0140651",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140651",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"pmid": ""
}
]
},
{
"name": "Molecular Function",
"total": 4,
"go_terms": [
{
"name": "creatine kinase activity",
"id": "GO:0004111",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004111",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"pmid": ""
},
{
"name": "ATP binding",
"id": "GO:0005524",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"pmid": ""
},
{
"name": "ubiquitin protein ligase binding",
"id": "GO:0031625",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031625",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"pmid": ""
},
{
"name": "kinase activity",
"id": "GO:0016301",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016301",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"pmid": ""
}
]
},
{
"name": "Cellular Component",
"total": 5,
"go_terms": [
{
"name": "extracellular space",
"id": "GO:0005615",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"pmid": ""
},
{
"name": "mitochondrion",
"id": "GO:0005739",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"pmid": ""
},
{
"name": "cytosol",
"id": "GO:0005829",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"pmid": ""
},
{
"name": "plasma membrane",
"id": "GO:0005886",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"pmid": ""
},
{
"name": "extracellular exosome",
"id": "GO:0070062",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062",
"evidence": [
{
"database": "UniProtKB",
"id": "P12277",
"url": "https://www.uniprot.org/uniprot/P12277"
}
],
"pmid": ""
}
]
}
]
},
"pro_annotation": [],
"site_annotation": [
{
"start_pos": 222,
"end_pos": 224,
"annotation": "n_glycosylation_sequon"
}
],
"ptm_annotation": [],
"interactions": [],
"reactions": [
{
"id": "17157",
"name": "",
"equation": "ATP + creatine = ADP + H(+) + N-phosphocreatine",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P07335-1",
"P09605-1",
"P00564-1",
"P25809-1",
"P12277-1",
"P06732-1",
"P12532-1",
"P17540-1",
"P30275-1",
"P07310-1",
"Q6P8J7-1",
"Q04447-1"
],
"evidence": [
{
"id": "17157",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/17157"
}
]
},
{
"id": "R-HSA-200318",
"name": "creatine + ATP => phosphocreatine + ADP [CKB,CKM]",
"equation": "",
"summary": "Cytosolic creatine kinase catalyzes the reaction of creatine and ATP to form phosphocreatine and ADP. The active form of the enzyme is a dimer. Monomers of the cytosolic enzyme occur in two isoforms, B and M, so called because of their abundance in brain and muscle respectively. The enzyme is widely expressed in the body and many tissues express both isoforms. Both homo- (BB, MM) and heterodimers (BM) are catalytically active.",
"cellular_location": "cytosol",
"input_participant_list": [
"R-ALL-29916"
],
"output_participant_list": [
"R-ALL-200351"
],
"enzyme_list": [
"P06732-1",
"P12277-1"
],
"evidence": [
{
"id": "R-HSA-200318",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-200318"
}
]
},
{
"id": "R-HSA-9696268",
"name": "RND3 binds effectors",
"equation": "",
"summary": "Active GTP bound RND3 binds the following effectors:
ARHGAP5 (Wennerberg et al. 2003; Bagci et al. 2020)
KCTD13 (Gladwyn Ng et al. 2016)
PLEKHG5 (Goh and Manser 2010)
ROCK1 (Riento et al. 2003) RND3 inhibits kinase activity of ROCK1
TNFAIP1 (Gladwyn Ng et al. 2016)
UBXN11 (Katoh et al. 2002)
The following candidate RND3 effectors were reported in the high throughput screen by Bagci et al. 2020 or were reported by some but not all studies:
ANKRD26 (Bagci et al. 2020)
ARHGAP21 (Bagci et al. 2020)
ARHGAP35 (Wennerberg et al. 2003: binding to active RND3; Bagci et al. 2020: no binding to active RND3)
CAV1 (Bagci et al. 2020)
CCDC88A (Bagci et al. 2020)
CKAP4 (Bagci et al. 2020)
CKB (Bagci et al. 2020)
CPD (Bagci et al. 2020)
DDX4 (Bagci et al. 2020)
DEPDC1B (Bagci et al. 2020)
DLG5 (Bagci et al. 2020)
DSG1 (Bagci et al. 2020)
DSP (Bagci et al. 2020)
DST (Bagci et al. 2020)
EPHA2 (Bagci et al. 2020)
FAM83B (Bagci et al. 2020)
FLOT2 (Bagci et al. 2020)
KTN1 (Bagci et al. 2020) - RND3 has not been shown to localize to the endoplasmic reticulum membrane, but some isoforms of KTN1 have been shown to localize to the plasma membrane (Santama et al. 2004)
LEMD3 (Bagci et al. 2020)
MUC13 (Bagci et al. 2020)
NISCH (Bagci et al. 2020)
PICALM (Bagci et al. 2020)
PIK3R1 (Bagci et al. 2020)
PIK3R2 (Bagci et al. 2020)
PKP4 (Bagci et al. 2020)
PTPN13 (Bagci et al. 2020)
RASAL2 (Bagci et al. 2020)
RBMX (Bagci et al. 2020)
SCRIB (Bagci et al. 2020)
SEMA4F (Bagci et al. 2020)
TMOD3 (Bagci et al. 2020)
TXNL1 (Bagci et al. 2020)
VANGL1 (Bagci et al. 2020)
VANGL2 (Bagci et al. 2020)
WDR6 (Bagci et al. 2020)
RND3 does not interact with the following effectors:
ALDH3A2 (Bagci et al. 2020)
EPSTI1 (Bagci et al. 2020)
FAM135A (Bagci et al. 2020)
FNBP1 (Bagci et al. 2020)
FRS2 (Harada et al. 2005)
FRS3 (Harada et al. 2003)
GOLGA3 (Bagci et al. 2020)
KIDINS220 (Bagci et al. 2020)
KIF14 (Bagci et al. 2020)
LRRC1 (Bagci et al. 2020)
NUDC (Bagci et al. 2020)
ROCK2 (Riento et al. 2003)
RRAS2 (Bagci et al. 2020)
STMN2 (Li et al. 2009)
TFRC (Bagci et al. 2020)
TMEM59 (Bagci et al. 2020)
UHRF1BP1L (Bagci et al. 2020)",
"cellular_location": "cytosol, plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q13464-1",
"P12277-1",
"Q12923-1",
"O75976-1",
"P29317-1",
"Q9NQI0-1"
],
"evidence": [
{
"id": "R-HSA-9696268",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9696268"
}
]
}
],
"reaction_participants": [
{
"participant_id": "R-ALL-200351",
"participant_name": "Pcr [cytosol]",
"crossref": [
{
"id": "58092",
"database": "ChEBI",
"url": ""
},
{
"id": "000003869774",
"database": "ZINC",
"url": ""
},
{
"id": "58092",
"database": "ChEBI",
"url": ""
},
{
"id": "000003869774",
"database": "ZINC",
"url": ""
},
{
"id": "000003869774",
"database": "ZINC",
"url": ""
},
{
"id": "58092",
"database": "ChEBI",
"url": ""
},
{
"id": "58092",
"database": "ChEBI",
"url": ""
},
{
"id": "000003869774",
"database": "ZINC",
"url": ""
}
]
},
{
"participant_id": "R-ALL-29916",
"participant_name": "CRET [cytosol]",
"crossref": [
{
"id": "57947",
"database": "ChEBI",
"url": ""
},
{
"id": "000003861770",
"database": "ZINC",
"url": ""
},
{
"id": "C00300",
"database": "COMPOUND",
"url": ""
},
{
"id": "C00300",
"database": "COMPOUND",
"url": ""
},
{
"id": "57947",
"database": "ChEBI",
"url": ""
},
{
"id": "000003861770",
"database": "ZINC",
"url": ""
},
{
"id": "C00300",
"database": "COMPOUND",
"url": ""
},
{
"id": "57947",
"database": "ChEBI",
"url": ""
},
{
"id": "000003861770",
"database": "ZINC",
"url": ""
},
{
"id": "C00300",
"database": "COMPOUND",
"url": ""
},
{
"id": "57947",
"database": "ChEBI",
"url": ""
},
{
"id": "000003861770",
"database": "ZINC",
"url": ""
},
{
"id": "C00300",
"database": "COMPOUND",
"url": ""
},
{
"id": "57947",
"database": "ChEBI",
"url": ""
},
{
"id": "000003861770",
"database": "ZINC",
"url": ""
}
]
}
],
"reaction_enzymes": [
{
"uniprot_ac": "O75976",
"gene_name": "CPD",
"activity": [
{
"ec_number": "3.4.17.22",
"activity": "Releases C-terminal Arg and Lys from polypeptides.",
"evidence": [
{
"id": "O75976",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75976"
}
]
},
{
"ec_number": "3.4.17.22",
"activity": "",
"evidence": [
{
"id": "O75976",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75976"
}
]
}
]
},
{
"uniprot_ac": "P00564",
"gene_name": "Ckm",
"activity": [
{
"ec_number": "2.7.3.2",
"activity": "ATP + creatine = ADP + H(+) + N-phosphocreatine.",
"evidence": [
{
"id": "P00564",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00564"
}
]
},
{
"ec_number": "2.7.3.2",
"activity": "",
"evidence": [
{
"id": "P00564",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00564"
}
]
}
]
},
{
"uniprot_ac": "P06732",
"gene_name": "CKM",
"activity": [
{
"ec_number": "2.7.3.2",
"activity": "ATP + creatine = ADP + H(+) + N-phosphocreatine.",
"evidence": [
{
"id": "P06732",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06732"
}
]
},
{
"ec_number": "2.7.3.2",
"activity": "",
"evidence": [
{
"id": "P06732",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P06732"
}
]
}
]
},
{
"uniprot_ac": "P07310",
"gene_name": "Ckm",
"activity": [
{
"ec_number": "2.7.3.2",
"activity": "ATP + creatine = ADP + H(+) + N-phosphocreatine.",
"evidence": [
{
"id": "P07310",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07310"
}
]
},
{
"ec_number": "2.7.3.2",
"activity": "",
"evidence": [
{
"id": "P07310",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07310"
}
]
}
]
},
{
"uniprot_ac": "P07335",
"gene_name": "Ckb",
"activity": [
{
"ec_number": "2.7.3.2",
"activity": "ATP + creatine = ADP + H(+) + N-phosphocreatine.",
"evidence": [
{
"id": "P07335",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07335"
}
]
},
{
"ec_number": "2.7.3.2",
"activity": "",
"evidence": [
{
"id": "P07335",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P07335"
}
]
}
]
},
{
"uniprot_ac": "P09605",
"gene_name": "Ckmt2",
"activity": [
{
"ec_number": "2.7.3.2",
"activity": "ATP + creatine = ADP + H(+) + N-phosphocreatine.",
"evidence": [
{
"id": "P09605",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09605"
}
]
},
{
"ec_number": "2.7.3.2",
"activity": "",
"evidence": [
{
"id": "P09605",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P09605"
}
]
}
]
},
{
"uniprot_ac": "P12277",
"gene_name": "CKB",
"activity": [
{
"ec_number": "2.7.3.2",
"activity": "ATP + creatine = ADP + H(+) + N-phosphocreatine.",
"evidence": [
{
"id": "P12277",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P12277"
}
]
},
{
"ec_number": "2.7.3.2",
"activity": "",
"evidence": [
{
"id": "P12277",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P12277"
}
]
}
]
},
{
"uniprot_ac": "P12532",
"gene_name": "CKMT1A",
"activity": [
{
"ec_number": "2.7.3.2",
"activity": "ATP + creatine = ADP + H(+) + N-phosphocreatine.",
"evidence": [
{
"id": "P12532",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P12532"
}
]
},
{
"ec_number": "2.7.3.2",
"activity": "",
"evidence": [
{
"id": "P12532",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P12532"
}
]
}
]
},
{
"uniprot_ac": "P17540",
"gene_name": "CKMT2",
"activity": [
{
"ec_number": "2.7.3.2",
"activity": "ATP + creatine = ADP + H(+) + N-phosphocreatine.",
"evidence": [
{
"id": "P17540",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17540"
}
]
},
{
"ec_number": "2.7.3.2",
"activity": "",
"evidence": [
{
"id": "P17540",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17540"
}
]
}
]
},
{
"uniprot_ac": "P25809",
"gene_name": "Ckmt1",
"activity": [
{
"ec_number": "2.7.3.2",
"activity": "ATP + creatine = ADP + H(+) + N-phosphocreatine.",
"evidence": [
{
"id": "P25809",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25809"
}
]
},
{
"ec_number": "2.7.3.2",
"activity": "",
"evidence": [
{
"id": "P25809",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P25809"
}
]
}
]
},
{
"uniprot_ac": "P29317",
"gene_name": "EPHA2",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P29317",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P29317"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P29317",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P29317"
}
]
}
]
},
{
"uniprot_ac": "P30275",
"gene_name": "Ckmt1",
"activity": [
{
"ec_number": "2.7.3.2",
"activity": "ATP + creatine = ADP + H(+) + N-phosphocreatine.",
"evidence": [
{
"id": "P30275",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30275"
}
]
},
{
"ec_number": "2.7.3.2",
"activity": "",
"evidence": [
{
"id": "P30275",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30275"
}
]
}
]
},
{
"uniprot_ac": "Q04447",
"gene_name": "Ckb",
"activity": [
{
"ec_number": "2.7.3.2",
"activity": "ATP + creatine = ADP + H(+) + N-phosphocreatine.",
"evidence": [
{
"id": "Q04447",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04447"
}
]
},
{
"ec_number": "2.7.3.2",
"activity": "",
"evidence": [
{
"id": "Q04447",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04447"
}
]
}
]
},
{
"uniprot_ac": "Q12923",
"gene_name": "PTPN13",
"activity": [
{
"ec_number": "3.1.3.48",
"activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.",
"evidence": [
{
"id": "Q12923",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12923"
}
]
},
{
"ec_number": "3.1.3.48",
"activity": "",
"evidence": [
{
"id": "Q12923",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q12923"
}
]
}
]
},
{
"uniprot_ac": "Q13464",
"gene_name": "ROCK1",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q13464",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13464"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "Q13464",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13464"
}
]
}
]
},
{
"uniprot_ac": "Q6P8J7",
"gene_name": "Ckmt2",
"activity": [
{
"ec_number": "2.7.3.2",
"activity": "ATP + creatine = ADP + H(+) + N-phosphocreatine.",
"evidence": [
{
"id": "Q6P8J7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6P8J7"
}
]
},
{
"ec_number": "2.7.3.2",
"activity": "",
"evidence": [
{
"id": "Q6P8J7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6P8J7"
}
]
}
]
},
{
"uniprot_ac": "Q9NQI0",
"gene_name": "DDX4",
"activity": [
{
"ec_number": "3.6.4.13",
"activity": "ATP + H2O = ADP + H(+) + phosphate.",
"evidence": [
{
"id": "Q9NQI0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9NQI0"
}
]
},
{
"ec_number": "3.6.4.13",
"activity": "",
"evidence": [
{
"id": "Q9NQI0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9NQI0"
}
]
}
]
}
],
"biomarkers": [],
"synthesized_glycans": [],
"cluster_types": [
{
"name": "isoformset.uniprotkb",
"label": "Isoforms"
},
{
"name": "homologset.mgi",
"label": "MGI Homologs"
},
{
"name": "homologset.oma",
"label": "OMA Homologs"
}
],
"sequence_features": {
"n_linked_sites": [],
"o_linked_sites": [],
"snv_sites": [],
"glycation_sites": [],
"phosphorylation_sites": [
4,
35,
125,
199,
309,
322
],
"sequon_annotation_sites": [
{
"start_pos": 222,
"end_pos": 224
}
]
},
"section_stats": [
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 1
},
{
"field": "total_sites",
"count": 1
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 1
},
{
"field": "o_linked_glycan_sites",
"count": 1
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment"
]
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 1
},
{
"field": "total_sites",
"count": 1
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 1
},
{
"field": "o_linked_glycan_sites",
"count": 1
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment"
]
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 6
},
{
"field": "total_sites",
"count": 6
}
],
"sort_fields": [
"start_pos",
"end_pos",
"kinase_uniprot_canonical_ac",
"kinase_gene_name",
"residue",
"comment",
"site_lbl"
]
},
{
"table_id": "snv",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_non_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "publication",
"table_stats": [
{
"field": "total",
"count": 48
}
],
"sort_fields": [
"title",
"journal",
"date",
"authors"
]
}
]
}