{ "uniprot_canonical_ac": "P12081-1", "uniprot_ac": "P12081", "uniprot_id": "HARS1_HUMAN", "mass": { "chemical_mass": 57411.0, "monoisotopic_mass": 57411.0 }, "refseq": { "ac": "NP_001244969", "name": "histidine--tRNA ligase, cytoplasmic isoform 2", "summary": "Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene is a cytoplasmic enzyme which belongs to the class II family of aminoacyl-tRNA synthetases. The enzyme is responsible for the synthesis of histidyl-transfer RNA, which is essential for the incorporation of histidine into proteins. The gene is located in a head-to-head orientation with HARSL on chromosome five, where the homologous genes share a bidirectional promoter. The gene product is a frequent target of autoantibodies in the human autoimmune disease polymyositis/dermatomyositis. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001244969" }, "gene_names": [ { "name": "HARS1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P12081", "id": "P12081" }, { "name": "CMT2W; HARS; HRS; USH3B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001244969", "id": "NP_001244969" }, { "name": "HARS1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001244969", "id": "NP_001244969" }, { "name": "HARS", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P12081", "id": "P12081" }, { "name": "HRS", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P12081", "id": "P12081" } ], "protein_names": [ { "name": "Histidine--tRNA ligase, cytoplasmic", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P12081" }, { "name": "6.1.1.21", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P12081" }, { "name": "HisRS; histidine--tRNA ligase, cytoplasmic; histidine translase; Jo-1 antigen", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001244969", "id": "NP_001244969" }, { "name": "HisRS", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P12081" }, { "name": "Histidyl-tRNA synthetase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P12081" }, { "name": "histidine--tRNA ligase, cytoplasmic isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001244969", "id": "NP_001244969" } ], "function": [ { "annotation": "Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene is a cytoplasmic enzyme which belongs to the class II family of aminoacyl-tRNA synthetases. The enzyme is responsible for the synthesis of histidyl-transfer RNA, which is essential for the incorporation of histidine into proteins. The gene is located in a head-to-head orientation with HARSL on chromosome five, where the homologous genes share a bidirectional promoter. The gene product is a frequent target of autoantibodies in the human autoimmune disease polymyositis/dermatomyositis. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012].", "evidence": [ { "database": "RefSeq", "id": "NP_001244969", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001244969" } ] }, { "annotation": "Bi-allelic mutations in HARS1 severely impair histidyl-tRNA synthetase expression and enzymatic activity causing a novel multisystem ataxic syndrome.", "evidence": [ { "database": "RefSeq", "id": "NP_001244969", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001244969" }, { "database": "PubMed", "id": "32333447", "url": "https://glygen.org/publication/PubMed/32333447" } ] }, { "annotation": "Catalyzes the ATP-dependent ligation of histidine to the 3'-end of its cognate tRNA, via the formation of an aminoacyl-adenylate intermediate (His-AMP) (PubMed:29235198). Plays a role in axon guidance (PubMed:26072516).", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081#function" }, { "database": "PubMed", "id": "26072516", "url": "https://glygen.org/publication/PubMed/26072516" }, { "database": "PubMed", "id": "29235198", "url": "https://glygen.org/publication/PubMed/29235198" } ] }, { "annotation": "Despite the similar kinetics, differential scanning fluorimetry revealed that Y454S is less thermally stable than Wild Type HARS, and cells from Y454S patients grown at elevated temperatures demonstrate diminished levels of protein synthesis compared to those of Wild Type cells. The thermal sensitivity associated with the Y454S mutation represents a biochemical basis for understanding Usher Syndrome Type IIIB.", "evidence": [ { "database": "RefSeq", "id": "NP_001244969", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001244969" }, { "database": "PubMed", "id": "28632987", "url": "https://glygen.org/publication/PubMed/28632987" } ] }, { "annotation": "Serological risk factors for concomitant interstitial lung disease in patients with idiopathic inflammatory myopathy.", "evidence": [ { "database": "RefSeq", "id": "NP_001244969", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001244969" }, { "database": "PubMed", "id": "31982271", "url": "https://glygen.org/publication/PubMed/31982271" } ] }, { "annotation": "Serum-circulating His-tRNA synthetase inhibits organ-targeted immune responses.", "evidence": [ { "database": "RefSeq", "id": "NP_001244969", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001244969" }, { "database": "PubMed", "id": "31797905", "url": "https://glygen.org/publication/PubMed/31797905" } ] }, { "annotation": "The first biochemical analysis of Charcot-Marie-Tooth-associated HARS mutations and underscores how loss of the primary aminoacylation function can contribute to disease pathology.", "evidence": [ { "database": "RefSeq", "id": "NP_001244969", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001244969" }, { "database": "PubMed", "id": "29235198", "url": "https://glygen.org/publication/PubMed/29235198" } ] } ], "disease": [ { "disease_id": "DOID:0110162", "recommended_name": { "id": "DOID:0110162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110162", "name": "Charcot-Marie-Tooth disease, axonal type 2W", "description": "A Charcot-Marie-Tooth disease type 2 that has_material_basis_in heterozygous mutation in the HARS gene on chromosome 5q31." }, "synonyms": [ { "id": "DOID:0110162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110162", "name": "CMT2W", "description": "" }, { "id": "DOID:0110162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110162", "name": "Charcot-Marie-Tooth neuropathy type 2W", "description": "" }, { "id": "DOID:0110162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110162", "name": "autosomal dominant axonal Charcot-Marie-Tooth disease type 2W", "description": "" }, { "id": "MONDO:0014711", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014711", "name": "autosomal dominant Charcot-Marie-Tooth disease type 2W", "description": "Any Charcot-Marie-Tooth disease type 2 in which the cause of the disease is a mutation in the HARS gene." }, { "id": "MONDO:0014711", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014711", "name": "CMT2W", "description": "" }, { "id": "MONDO:0014711", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014711", "name": "Charcot-Marie-Tooth disease type 2 caused by mutation in HARS", "description": "" }, { "id": "MONDO:0014711", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014711", "name": "Charcot-Marie-Tooth disease, axonal, type 2w", "description": "" }, { "id": "MONDO:0014711", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014711", "name": "Charcot-Marie-Tooth neuropathy type 2W", "description": "" }, { "id": "MONDO:0014711", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014711", "name": "HARS Charcot-Marie-Tooth disease type 2", "description": "" }, { "id": "MONDO:0014711", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014711", "name": "autosomal dominant Charcot-Marie-Tooth disease type 2 due to HARS mutation", "description": "" }, { "id": "MONDO:0014711", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014711", "name": "autosomal dominant axonal Charcot-Marie-Tooth disease type 2W", "description": "" }, { "id": "MONDO:0014711", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014711", "name": "Charcot-Marie-Tooth disease, axonal type 2W", "description": "" }, { "id": "MONDO:0014711", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014711", "name": "Charcot-Marie-Tooth disease, axonal, autosomal dominant, type 2W", "description": "" }, { "id": "MONDO:0014711", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014711", "name": "Charcot-Marie-Tooth disease, axonal, type 2W", "description": "" }, { "id": "MONDO:0014711", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014711", "name": "Charcot-Marie-Tooth neuropathy, type 2W", "description": "" }, { "id": "MIM:616625", "resource": "MIM", "url": "https://www.omim.org/entry/616625", "name": "Charcot-Marie-Tooth disease, axonal, 2W", "description": "Charcot-Marie-Tooth disease, axonal, 2W" } ], "evidence": [ { "id": "616625", "database": "MIM", "url": "https://www.omim.org/entry/616625" } ] }, { "disease_id": "DOID:0110842", "recommended_name": { "id": "DOID:0110842", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110842", "name": "Usher syndrome type 3B", "description": "An Usher syndrome type 3 that has_material_basis_in homozygous mutation in the HARS gene on chromosome 5q31." }, "synonyms": [ { "id": "DOID:0110842", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110842", "name": "USH3B", "description": "" }, { "id": "DOID:0110842", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110842", "name": "Usher syndrome type IIIB", "description": "" }, { "id": "MONDO:0013788", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013788", "name": "Usher syndrome type 3B", "description": "Any Usher syndrome in which the cause of the disease is a mutation in the HARS gene." }, { "id": "MONDO:0013788", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013788", "name": "HARS Usher syndrome", "description": "" }, { "id": "MONDO:0013788", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013788", "name": "USH3B", "description": "" }, { "id": "MONDO:0013788", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013788", "name": "Usher syndrome caused by mutation in HARS", "description": "" }, { "id": "MONDO:0013788", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013788", "name": "Usher syndrome type IIIB", "description": "" }, { "id": "MONDO:0013788", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013788", "name": "USHER syndrome, type IIIB", "description": "" }, { "id": "MONDO:0013788", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013788", "name": "Usher syndrome, type 3B", "description": "" }, { "id": "MIM:614504", "resource": "MIM", "url": "https://www.omim.org/entry/614504", "name": "Usher syndrome 3B", "description": "Usher syndrome 3B" } ], "evidence": [ { "id": "614504", "database": "MIM", "url": "https://www.omim.org/entry/614504" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "88.76", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170445", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170445" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "90.75", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170445", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170445" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "90.71", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170445", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170445" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "84.95", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170445", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170445" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "94.97", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170445", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170445" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "94.38", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170445", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170445" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "89.82", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170445", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170445" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "91.82", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170445", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170445" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "93.95", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170445", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170445" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "81.64", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000170445", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170445" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "91.44", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170445", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170445" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "96.14", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170445", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170445" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "93.79", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000170445", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170445" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P12081", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12081" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P12081", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12081" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P12081", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12081" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P12081", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12081" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P12081", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12081" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P12081", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12081" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P12081", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12081" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P12081", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12081" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P12081", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12081" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P12081", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12081" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P12081", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12081" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P12081", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P12081" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" } ], "common_name": "Human" } ], "gene": [ { "name": "HARS1", "url": "https://www.uniprot.org/uniprot/P12081", "locus": { "chromosome": "5", "start_pos": 22482, "end_pos": 5017, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "LRG_1374", "url": "https://www.ensembl.org/id/LRG_1374" } ] } } ], "crossref": [ { "id": "ENSG00000170445", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000170445", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "6.1.1.21", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=6.1.1.21&UniProtAcc=P12081", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd00773", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00773", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd00859", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00859", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd00938", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00938", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4002", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4002", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "HARS1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=HARS1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "3035", "url": "https://www.ncbi.nlm.nih.gov/gene/3035", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "4816", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4816", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P12081", "url": "https://www.ebi.ac.uk/intact/interactors/id:P12081*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000738", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000738", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004154", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004154", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004516", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004516", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006195", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006195", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009068", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009068", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015807", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015807", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033656", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033656", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036621", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036621", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041715", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041715", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045864", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045864", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:3035", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3035", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "142810", "url": "http://www.omim.org/entry/142810", "database": "MIM", "categories": [ "Other" ] }, { "id": "614504", "url": "http://www.omim.org/entry/614504", "database": "MIM", "categories": [ "Other" ] }, { "id": "616625", "url": "http://www.omim.org/entry/616625", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P12081", "url": "https://www.nextprot.org/entry/NX_P12081", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P12081", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P12081", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "EMYSFED", "url": "https://omabrowser.org/oma/group/EMYSFED/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5476704at2759", "url": "http://www.orthodb.org/?query=5476704at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11476", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11476", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11476:SF8", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11476:SF8", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1X59", "url": "https://www.rcsb.org/structure/1X59", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2LW7", "url": "https://www.rcsb.org/structure/2LW7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4G84", "url": "https://www.rcsb.org/structure/4G84", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4G85", "url": "https://www.rcsb.org/structure/4G85", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4PHC", "url": "https://www.rcsb.org/structure/4PHC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4X5O", "url": "https://www.rcsb.org/structure/4X5O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5W6M", "url": "https://www.rcsb.org/structure/5W6M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6O76", "url": "https://www.rcsb.org/structure/6O76", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00458", "url": "http://pfam.xfam.org/family/PF00458", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF03129", "url": "http://pfam.xfam.org/family/PF03129", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13393", "url": "http://pfam.xfam.org/family/PF13393", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P12081", "url": "https://pharos.nih.gov/targets/P12081", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P12081", "url": "http://purl.obolibrary.org/obo/PR_P12081", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-379716", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001244969", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001244969", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "17313", "url": "https://www.rhea-db.org/rhea/17313", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A2R8YCI2", "url": "https://www.uniprot.org/uniprot/A0A2R8YCI2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8YCI2-1", "url": "https://www.uniprot.org/uniprot/A0A2R8YCI2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8YFR1", "url": "https://www.uniprot.org/uniprot/A0A2R8YFR1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8YFR1-1", "url": "https://www.uniprot.org/uniprot/A0A2R8YFR1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A6Q8PF07", "url": "https://www.uniprot.org/uniprot/A0A6Q8PF07", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A6Q8PF07-1", "url": "https://www.uniprot.org/uniprot/A0A6Q8PF07-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A6Q8PF47", "url": "https://www.uniprot.org/uniprot/A0A6Q8PF47", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A6Q8PF47-1", "url": "https://www.uniprot.org/uniprot/A0A6Q8PF47-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A6Q8PFF2", "url": "https://www.uniprot.org/uniprot/A0A6Q8PFF2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A6Q8PFF2-1", "url": "https://www.uniprot.org/uniprot/A0A6Q8PFF2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A6Q8PFG9", "url": "https://www.uniprot.org/uniprot/A0A6Q8PFG9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A6Q8PFG9-1", "url": "https://www.uniprot.org/uniprot/A0A6Q8PFG9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A6Q8PFN6", "url": "https://www.uniprot.org/uniprot/A0A6Q8PFN6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A6Q8PFN6-1", "url": "https://www.uniprot.org/uniprot/A0A6Q8PFN6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A6Q8PHA5", "url": "https://www.uniprot.org/uniprot/A0A6Q8PHA5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A6Q8PHA5-1", "url": "https://www.uniprot.org/uniprot/A0A6Q8PHA5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A6Q8PHE3", "url": "https://www.uniprot.org/uniprot/A0A6Q8PHE3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A6Q8PHE3-1", "url": "https://www.uniprot.org/uniprot/A0A6Q8PHE3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A6Q8PHQ0", "url": "https://www.uniprot.org/uniprot/A0A6Q8PHQ0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A6Q8PHQ0-1", "url": "https://www.uniprot.org/uniprot/A0A6Q8PHQ0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B4DDD8", "url": "https://www.uniprot.org/uniprot/B4DDD8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B4DDD8-1", "url": "https://www.uniprot.org/uniprot/B4DDD8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B4E1C5", "url": "https://www.uniprot.org/uniprot/B4E1C5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B4E1C5-1", "url": "https://www.uniprot.org/uniprot/B4E1C5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RF05", "url": "https://www.uniprot.org/uniprot/D6RF05", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RF05-1", "url": "https://www.uniprot.org/uniprot/D6RF05-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7ETE2", "url": "https://www.uniprot.org/uniprot/E7ETE2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7ETE2-1", "url": "https://www.uniprot.org/uniprot/E7ETE2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P12081-1", "url": "https://www.uniprot.org/uniprot/P12081-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P12081-2", "url": "https://www.uniprot.org/uniprot/P12081-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P12081-3", "url": "https://www.uniprot.org/uniprot/P12081-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P12081-4", "url": "https://www.uniprot.org/uniprot/P12081-4", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPLCIC", "length": 509, "header": "sp|P12081-1|HARS1_HUMAN Isoform 1 of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=2 CANONICAL=P12081-1" }, "isoforms": [ { "isoform_ac": "A0A2R8YCI2-1", "url": "", "sequence": { "sequence": "MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKMGFHRVGCAGLEFLASSDPPTSAS", "length": 84, "header": "tr|A0A2R8YCI2-1|HARS1_HUMAN Computationally mapped isoform of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=1 CANONICAL=P12081-1" }, "locus": { "chromosome": "5", "start_pos": 140691304, "end_pos": 140687862, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000643686.1", "url": "https://www.ensembl.org/id/ENST00000643686.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000493611.1", "url": "https://www.ensembl.org/id/ENSP00000493611.1" } ] } }, { "isoform_ac": "A0A2R8YFR1-1", "url": "", "sequence": { "sequence": "XQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKRRGFTMLARLVSNP", "length": 52, "header": "tr|A0A2R8YFR1-1|HARS1_HUMAN Computationally mapped isoform of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=1 CANONICAL=P12081-1" }, "locus": { "chromosome": "5", "start_pos": 140691236, "end_pos": 140683621, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000646229.1", "url": "https://www.ensembl.org/id/ENST00000646229.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000495358.1", "url": "https://www.ensembl.org/id/ENSP00000495358.1" } ] } }, { "isoform_ac": "A0A6Q8PF07-1", "url": "", "sequence": { "sequence": "MIEEEVAKLLKLKAQLGPDESKQKFVLKTPKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPLCIC", "length": 440, "header": "tr|A0A6Q8PF07-1|HARS1_HUMAN Computationally mapped isoform of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=1 CANONICAL=P12081-1" }, "locus": { "chromosome": "5", "start_pos": 140691304, "end_pos": 140674260, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000675698.1", "url": "https://www.ensembl.org/id/ENST00000675698.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000501581.1", "url": "https://www.ensembl.org/id/ENSP00000501581.1" } ] } }, { "isoform_ac": "A0A6Q8PF47-1", "url": "", "sequence": { "sequence": "MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVREVGRKAKGQRMYAILAGPCPFKT", "length": 511, "header": "tr|A0A6Q8PF47-1|HARS1_HUMAN Computationally mapped isoform of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=1 CANONICAL=P12081-1" }, "locus": { "chromosome": "5", "start_pos": 140691304, "end_pos": 140674604, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000675204.1", "url": "https://www.ensembl.org/id/ENST00000675204.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000501643.1", "url": "https://www.ensembl.org/id/ENSP00000501643.1" } ] } }, { "isoform_ac": "A0A6Q8PFF2-1", "url": "", "sequence": { "sequence": "MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPLCIC", "length": 470, "header": "tr|A0A6Q8PFF2-1|HARS1_HUMAN Computationally mapped isoform of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=1 CANONICAL=P12081-1" }, "locus": { "chromosome": "5", "start_pos": 140691304, "end_pos": 140674260, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000675366.1", "url": "https://www.ensembl.org/id/ENST00000675366.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000501747.1", "url": "https://www.ensembl.org/id/ENSP00000501747.1" } ] } }, { "isoform_ac": "A0A6Q8PFG9-1", "url": "", "sequence": { "sequence": "MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKLPRGP", "length": 248, "header": "tr|A0A6Q8PFG9-1|HARS1_HUMAN Computationally mapped isoform of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=1 CANONICAL=P12081-1" }, "locus": { "chromosome": "5", "start_pos": 140691304, "end_pos": 140677443, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000674523.1", "url": "https://www.ensembl.org/id/ENST00000674523.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000501816.1", "url": "https://www.ensembl.org/id/ENSP00000501816.1" } ] } }, { "isoform_ac": "A0A6Q8PFN6-1", "url": "", "sequence": { "sequence": "MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVGYPWWNSCSRILNYPKTSRPWRAWET", "length": 270, "header": "tr|A0A6Q8PFN6-1|HARS1_HUMAN Computationally mapped isoform of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=1 CANONICAL=P12081-1" }, "locus": { "chromosome": "5", "start_pos": 140691304, "end_pos": 140677036, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000675827.1", "url": "https://www.ensembl.org/id/ENST00000675827.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000501900.1", "url": "https://www.ensembl.org/id/ENSP00000501900.1" } ] } }, { "isoform_ac": "A0A6Q8PHA5-1", "url": "", "sequence": { "sequence": "MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPLCIC", "length": 473, "header": "tr|A0A6Q8PHA5-1|HARS1_HUMAN Computationally mapped isoform of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=1 CANONICAL=P12081-1" }, "locus": { "chromosome": "5", "start_pos": 140691304, "end_pos": 140674260, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676327.1", "url": "https://www.ensembl.org/id/ENST00000676327.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000502594.1", "url": "https://www.ensembl.org/id/ENSP00000502594.1" } ] } }, { "isoform_ac": "A0A6Q8PHE3-1", "url": "", "sequence": { "sequence": "MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPLCIC", "length": 399, "header": "tr|A0A6Q8PHE3-1|HARS1_HUMAN Computationally mapped isoform of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=1 CANONICAL=P12081-1" }, "locus": { "chromosome": "5", "start_pos": 140691304, "end_pos": 140674260, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000675851.1", "url": "https://www.ensembl.org/id/ENST00000675851.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000502624.1", "url": "https://www.ensembl.org/id/ENSP00000502624.1" } ] } }, { "isoform_ac": "A0A6Q8PHQ0-1", "url": "", "sequence": { "sequence": "MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKALEEKIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPLCIC", "length": 171, "header": "tr|A0A6Q8PHQ0-1|HARS1_HUMAN Computationally mapped isoform of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=1 CANONICAL=P12081-1" }, "locus": { "chromosome": "5", "start_pos": 140691304, "end_pos": 140674260, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000509087.2", "url": "https://www.ensembl.org/id/ENST00000509087.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000502781.1", "url": "https://www.ensembl.org/id/ENSP00000502781.1" } ] } }, { "isoform_ac": "B4DDD8-1", "url": "", "sequence": { "sequence": "MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPLCIC", "length": 435, "header": "tr|B4DDD8-1|HARS1_HUMAN Computationally mapped isoform of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=1 CANONICAL=P12081-1" }, "locus": { "chromosome": "5", "start_pos": 140691304, "end_pos": 140674260, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000415192.6", "url": "https://www.ensembl.org/id/ENST00000415192.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000411085.2", "url": "https://www.ensembl.org/id/ENSP00000411085.2" } ] } }, { "isoform_ac": "B4E1C5-1", "url": "", "sequence": { "sequence": "MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPLCIC", "length": 395, "header": "tr|B4E1C5-1|HARS1_HUMAN Computationally mapped isoform of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=1 CANONICAL=P12081-1" }, "locus": { "chromosome": "5", "start_pos": 140691304, "end_pos": 140674260, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000431330.7", "url": "https://www.ensembl.org/id/ENST00000431330.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000393244.2", "url": "https://www.ensembl.org/id/ENSP00000393244.2" } ] } }, { "isoform_ac": "D6RF05-1", "url": "", "sequence": { "sequence": "MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPK", "length": 60, "header": "tr|D6RF05-1|HARS1_HUMAN Computationally mapped isoform of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=1 CANONICAL=P12081-1" }, "locus": { "chromosome": "5", "start_pos": 140691304, "end_pos": 140690855, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000512396.6", "url": "https://www.ensembl.org/id/ENST00000512396.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000421576.1", "url": "https://www.ensembl.org/id/ENSP00000421576.1" } ] } }, { "isoform_ac": "E7ETE2-1", "url": "", "sequence": { "sequence": "MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVREVDVRREDLVEEIKRRTGQPLCIC", "length": 512, "header": "tr|E7ETE2-1|HARS1_HUMAN Computationally mapped isoform of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=2 CANONICAL=P12081-1" }, "locus": { "chromosome": "5", "start_pos": 140691304, "end_pos": 140674260, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000507746.7", "url": "https://www.ensembl.org/id/ENST00000507746.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000425889.2", "url": "https://www.ensembl.org/id/ENSP00000425889.2" } ] } }, { "isoform_ac": "P12081-1", "url": "", "sequence": { "sequence": "MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPLCIC", "length": 509, "header": "sp|P12081-1|HARS1_HUMAN Isoform 1 of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=2 CANONICAL=P12081-1" }, "locus": { "chromosome": "5", "start_pos": 140691304, "end_pos": 140674260, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000504156.7", "url": "https://www.ensembl.org/id/ENST00000504156.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000425634.1", "url": "https://www.ensembl.org/id/ENSP00000425634.1" } ] } }, { "isoform_ac": "P12081-2", "url": "", "sequence": { "sequence": "MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPLCIC", "length": 469, "header": "sp|P12081-2|HARS1_HUMAN Isoform 2 of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=2 CANONICAL=P12081-1" }, "locus": { "chromosome": "5", "start_pos": 140691304, "end_pos": 140674260, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000438307.6", "url": "https://www.ensembl.org/id/ENST00000438307.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000411511.2", "url": "https://www.ensembl.org/id/ENSP00000411511.2" } ] } }, { "isoform_ac": "P12081-3", "url": "", "sequence": { "sequence": "MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPLCIC", "length": 449, "header": "sp|P12081-3|HARS1_HUMAN Isoform 3 of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=2 CANONICAL=P12081-1" }, "locus": { "chromosome": "5", "start_pos": 140691304, "end_pos": 140674260, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000307633.7", "url": "https://www.ensembl.org/id/ENST00000307633.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000304668.3", "url": "https://www.ensembl.org/id/ENSP00000304668.3" } ] } }, { "isoform_ac": "P12081-4", "url": "", "sequence": { "sequence": "MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPLCIC", "length": 489, "header": "sp|P12081-4|HARS1_HUMAN Isoform 4 of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=2 CANONICAL=P12081-1" }, "locus": { "chromosome": "5", "start_pos": 140691304, "end_pos": 140674260, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000457527.6", "url": "https://www.ensembl.org/id/ENST00000457527.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000387893.2", "url": "https://www.ensembl.org/id/ENSP00000387893.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P12081", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P12081" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "34229054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34229054" } ] } ], "phosphorylation": [ { "start_pos": 356, "end_pos": 356, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "P12081", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12081" } ], "site_lbl": "Ser356" }, { "start_pos": 363, "end_pos": 363, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P12081", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12081" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Tyr363" }, { "start_pos": 66, "end_pos": 66, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" } ], "site_lbl": "Ser66" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Isolation of two cDNAs encoding functional human cytoplasmic cysteinyl-tRNA synthetase.", "journal": "Biological chemistry", "date": "2001", "authors": "Davidson E, Caffarella J, Vitseva O, Hou YM, King MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-379716", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716" } ], "reference": [ { "type": "PubMed", "id": "11347887", "url": "https://glygen.org/publication/PubMed/11347887" } ] }, { "title": "The appended C-domain of human methionyl-tRNA synthetase has a tRNA-sequestering function.", "journal": "Biochemistry", "date": "2001", "authors": "Kaminska M, Shalak V, Mirande M", "evidence": [ { "database": "Reactome", "id": "R-HSA-379716", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716" } ], "reference": [ { "type": "PubMed", "id": "11714285", "url": "https://glygen.org/publication/PubMed/11714285" } ] }, { "title": "Interaction network of human aminoacyl-tRNA synthetases and subunits of elongation factor 1 complex.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Sang Lee J, Gyu Park S, Park H, Seol W, Lee S, Kim S", "evidence": [ { "database": "Reactome", "id": "R-HSA-379716", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716" } ], "reference": [ { "type": "PubMed", "id": "11829477", "url": "https://glygen.org/publication/PubMed/11829477" } ] }, { "title": "Cloning and expression of human phenylalanyl-tRNA synthetase in Escherichia coli: comparative study of purified recombinant enzymes.", "journal": "Protein expression and purification", "date": "2002", "authors": "Moor N, Linshiz G, Safro M", "evidence": [ { "database": "Reactome", "id": "R-HSA-379716", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716" } ], "reference": [ { "type": "PubMed", "id": "11858721", "url": "https://glygen.org/publication/PubMed/11858721" } ] }, { "title": "Glycyl tRNA synthetase mutations in Charcot-Marie-Tooth disease type 2D and distal spinal muscular atrophy type V.", "journal": "American journal of human genetics", "date": "2003", "authors": "Antonellis A, Ellsworth RE, Sambuughin N, Puls I, Abel A, Lee-Lin SQ, Jordanova A, Kremensky I, Christodoulou K, Middleton LT, Sivakumar K, Ionasescu V, Funalot B, Vance JM, Goldfarb LG, Fischbeck KH, Green ED", "evidence": [ { "database": "Reactome", "id": "R-HSA-379716", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716" } ], "reference": [ { "type": "PubMed", "id": "12690580", "url": "https://glygen.org/publication/PubMed/12690580" } ] }, { "title": "An interferon-induced protein with release factor activity is a tryptophanyl-tRNA synthetase.", "journal": "FEBS letters", "date": "1992", "authors": "Bange FC, Flohr T, Buwitt U, Bottger EC", "evidence": [ { "database": "Reactome", "id": "R-HSA-379716", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716" } ], "reference": [ { "type": "PubMed", "id": "1373391", "url": "https://glygen.org/publication/PubMed/1373391" } ] }, { "title": "Crystal structure of human tryptophanyl-tRNA synthetase catalytic fragment: insights into substrate recognition, tRNA binding, and angiogenesis activity.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Yu Y, Liu Y, Shen N, Xu X, Xu F, Jia J, Jin Y, Arnold E, Ding J", "evidence": [ { "database": "Reactome", "id": "R-HSA-379716", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716" } ], "reference": [ { "type": "PubMed", "id": "14660560", "url": "https://glygen.org/publication/PubMed/14660560" } ] }, { "title": "Crystal structures that suggest late development of genetic code components for differentiating aromatic side chains.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Yang XL, Otero FJ, Skene RJ, McRee DE, Schimmel P, Ribas de Pouplana L", "evidence": [ { "database": "Reactome", "id": "R-HSA-379716", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716" } ], "reference": [ { "type": "PubMed", "id": "14671330", "url": "https://glygen.org/publication/PubMed/14671330" } ] }, { "title": "Human histidyl-tRNA synthetase: recognition of amino acid signature regions in class 2a aminoacyl-tRNA synthetases.", "journal": "Nucleic Acids Res.", "date": "1992", "authors": "Raben N, Borriello F, Amin J, Horwitz R, Fraser D, Plotz P", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" } ], "reference": [ { "type": "PubMed", "id": "1549469", "url": "https://glygen.org/publication/PubMed/1549469" } ] }, { "title": "The C-terminal appended domain of human cytosolic leucyl-tRNA synthetase is indispensable in its interaction with arginyl-tRNA synthetase in the multi-tRNA synthetase complex.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Ling C, Yao YN, Zheng YG, Wei H, Wang L, Wu XF, Wang ED", "evidence": [ { "database": "Reactome", "id": "R-HSA-379716", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716" } ], "reference": [ { "type": "PubMed", "id": "16055448", "url": "https://glygen.org/publication/PubMed/16055448" } ] }, { "title": "Disrupted function and axonal distribution of mutant tyrosyl-tRNA synthetase in dominant intermediate Charcot-Marie-Tooth neuropathy.", "journal": "Nature genetics", "date": "2006", "authors": "Jordanova A, Irobi J, Thomas FP, Van Dijck P, Meerschaert K, Dewil M, Dierick I, Jacobs A, De Vriendt E, Guergueltcheva V, Rao CV, Tournev I, Gondim FA, D'Hooghe M, Van Gerwen V, Callaerts P, Van Den Bosch L, Timmermans JP, Robberecht W, Gettemans J, Thevelein JM, De Jonghe P, Kremensky I, Timmerman V", "evidence": [ { "database": "Reactome", "id": "R-HSA-379716", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716" } ], "reference": [ { "type": "PubMed", "id": "16429158", "url": "https://glygen.org/publication/PubMed/16429158" } ] }, { "title": "Editing-defective tRNA synthetase causes protein misfolding and neurodegeneration.", "journal": "Nature", "date": "2006", "authors": "Lee JW, Beebe K, Nangle LA, Jang J, Longo-Guess CM, Cook SA, Davisson MT, Sundberg JP, Schimmel P, Ackerman SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-379716", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716" } ], "reference": [ { "type": "PubMed", "id": "16906134", "url": "https://glygen.org/publication/PubMed/16906134" } ] }, { "title": "Interferon induces tryptophanyl-tRNA synthetase expression in human fibroblasts.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Rubin BY, Anderson SL, Xing L, Powell RJ, Tate WP", "evidence": [ { "database": "Reactome", "id": "R-HSA-379716", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716" } ], "reference": [ { "type": "PubMed", "id": "1761529", "url": "https://glygen.org/publication/PubMed/1761529" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P12081-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12081-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Genetic mapping and exome sequencing identify variants associated with five novel diseases.", "journal": "PloS one", "date": "2012", "authors": "Puffenberger EG, Jinks RN, Sougnez C, Cibulskis K, Willert RA, Achilly NP, Cassidy RP, Fiorentini CJ, Heiken KF, Lawrence JJ, Mahoney MH, Miller CJ, Nair DT, Politi KA, Worcester KN, Setton RA, Dipiazza R, Sherman EA, Eastman JT, Francklyn C, Robey-Bond S, Rider NL, Gabriel S, Morton DH, Strauss KA", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" } ], "reference": [ { "type": "PubMed", "id": "22279524", "url": "https://glygen.org/publication/PubMed/22279524" } ] }, { "title": "A loss-of-function variant in the human histidyl-tRNA synthetase (HARS) gene is neurotoxic in vivo.", "journal": "Human mutation", "date": "2013", "authors": "Vester A, Velez-Ruiz G, McLaughlin HM, Lupski JR, Talbot K, Vance JM, Zuchner S, Roda RH, Fischbeck KH, Biesecker LG, Nicholson G, Beg AA, Antonellis A", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" } ], "reference": [ { "type": "PubMed", "id": "22930593", "url": "https://glygen.org/publication/PubMed/22930593" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "P12081", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P12081" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" }, { "database": "iPTMnet", "id": "P12081", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P12081" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Comparison of histidine recognition in human and trypanosomatid histidyl-tRNA synthetases.", "journal": "Biochimie", "date": "2014", "authors": "Koh CY, Wetzel AB, de van der Schueren WJ, Hol WG", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" } ], "reference": [ { "type": "PubMed", "id": "25151410", "url": "https://glygen.org/publication/PubMed/25151410" } ] }, { "title": "Loss of function mutations in HARS cause a spectrum of inherited peripheral neuropathies.", "journal": "Brain : a journal of neurology", "date": "2015", "authors": "Safka Brozkova D, Deconinck T, Griffin LB, Ferbert A, Haberlova J, Mazanec R, Lassuthova P, Roth C, Pilunthanakul T, Rautenstrauss B, Janecke AR, Zavadakova P, Chrast R, Rivolta C, Zuchner S, Antonellis A, Beg AA, De Jonghe P, Senderek J, Seeman P, Baets J", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" } ], "reference": [ { "type": "PubMed", "id": "26072516", "url": "https://glygen.org/publication/PubMed/26072516" } ] }, { "title": "The Usher Syndrome Type IIIB Histidyl-tRNA Synthetase Mutation Confers Temperature Sensitivity.", "journal": "Biochemistry", "date": "2017", "authors": "Abbott JA, Guth E, Kim C, Regan C, Siu VM, Rupar CA, Demeler B, Francklyn CS, Robey-Bond SM", "evidence": [ { "database": "RefSeq", "id": "NP_001244969", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001244969" } ], "reference": [ { "type": "PubMed", "id": "28632987", "url": "https://glygen.org/publication/PubMed/28632987" } ] }, { "title": "Substrate interaction defects in histidyl-tRNA synthetase linked to dominant axonal peripheral neuropathy.", "journal": "Human mutation", "date": "2018", "authors": "Abbott JA, Meyer-Schuman R, Lupo V, Feely S, Mademan I, Oprescu SN, Griffin LB, Alberti MA, Casasnovas C, Aharoni S, Basel-Vanagaite L, Zuchner S, De Jonghe P, Baets J, Shy ME, Espinos C, Demeler B, Antonellis A, Francklyn C", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" }, { "database": "RefSeq", "id": "NP_001244969", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001244969" } ], "reference": [ { "type": "PubMed", "id": "29235198", "url": "https://glygen.org/publication/PubMed/29235198" } ] }, { "title": "Serum-circulating His-tRNA synthetase inhibits organ-targeted immune responses.", "journal": "Cellular & molecular immunology", "date": "2021", "authors": "Adams RA, Fernandes-Cerqueira C, Notarnicola A, Mertsching E, Xu Z, Lo WS, Ogilvie K, Chiang KP, Ampudia J, Rosengren S, Cubitt A, King DJ, Mendlein JD, Yang XL, Nangle LA, Lundberg IE, Jakobsson PJ, Schimmel P", "evidence": [ { "database": "RefSeq", "id": "NP_001244969", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001244969" } ], "reference": [ { "type": "PubMed", "id": "31797905", "url": "https://glygen.org/publication/PubMed/31797905" } ] }, { "title": "Serological risk factors for concomitant interstitial lung disease in patients with idiopathic inflammatory myopathy.", "journal": "Journal of clinical neuroscience : official journal of the Neurosurgical Society of Australasia", "date": "2020", "authors": "Huang HL, Lin WC, Yeh CC, Sun YT", "evidence": [ { "database": "RefSeq", "id": "NP_001244969", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001244969" } ], "reference": [ { "type": "PubMed", "id": "31982271", "url": "https://glygen.org/publication/PubMed/31982271" } ] }, { "title": "Engineering a Proximity-Directed O-GlcNAc Transferase for Selective Protein O-GlcNAcylation in Cells.", "journal": "ACS chemical biology", "date": "2020", "authors": "Ramirez DH, Aonbangkhen C, Wu HY, Naftaly JA, Tang S, O'Meara TR, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P12081", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P12081" } ], "reference": [ { "type": "PubMed", "id": "32119511", "url": "https://glygen.org/publication/PubMed/32119511" } ] }, { "title": "Bi-allelic mutations in HARS1 severely impair histidyl-tRNA synthetase expression and enzymatic activity causing a novel multisystem ataxic syndrome.", "journal": "Human mutation", "date": "2020", "authors": "Galatolo D, Kuo ME, Mullen P, Meyer-Schuman R, Doccini S, Battini R, Lieto M, Tessa A, Filla A, Francklyn C, Antonellis A, Santorelli FM", "evidence": [ { "database": "RefSeq", "id": "NP_001244969", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001244969" } ], "reference": [ { "type": "PubMed", "id": "32333447", "url": "https://glygen.org/publication/PubMed/32333447" } ] }, { "title": "Tandem Bioorthogonal Labeling Uncovers Endogenous Cotranslationally O-GlcNAc Modified Nascent Proteins.", "journal": "Journal of the American Chemical Society", "date": "2020", "authors": "Zhu Y, Willems LI, Salas D, Cecioni S, Wu WB, Foster LJ, Vocadlo DJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "P12081", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P12081" } ], "reference": [ { "type": "PubMed", "id": "32870666", "url": "https://glygen.org/publication/PubMed/32870666" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P12081", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P12081" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P12081", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P12081" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Synthesis of Na2S2O4 mediated cleavable affinity tag for labeling of O-GlcNAc modified proteins via azide-alkyne cycloaddition.", "journal": "Bioorganic & medicinal chemistry letters", "date": "2021", "authors": "Wang J, Dou B, Zheng L, Cao W, Zeng X, Wen Y, Ma J, Li X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P12081", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P12081" } ], "reference": [ { "type": "PubMed", "id": "34229054", "url": "https://glygen.org/publication/PubMed/34229054" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P12081", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P12081" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "Isolation, structure and expression of mammalian genes for histidyl-tRNA synthetase.", "journal": "Nucleic Acids Res.", "date": "1987", "authors": "Tsui F W, Siminovitch L", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" } ], "reference": [ { "type": "PubMed", "id": "3554142", "url": "https://glygen.org/publication/PubMed/3554142" } ] }, { "title": "Studies on human erythrocyte inorganic pyrophosphatase.", "journal": "Annals of human genetics", "date": "1974", "authors": "Fisher RA, Turner BM, Dorkin HL, Harris H", "evidence": [ { "database": "Reactome", "id": "R-HSA-379716", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716" } ], "reference": [ { "type": "PubMed", "id": "4130389", "url": "https://glygen.org/publication/PubMed/4130389" } ] }, { "title": "Purification and some properties of inorganic pyrophosphatase from human erythrocytes.", "journal": "The Journal of biological chemistry", "date": "1967", "authors": "Pynes GD, Younathan ES", "evidence": [ { "database": "Reactome", "id": "R-HSA-379716", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716" } ], "reference": [ { "type": "PubMed", "id": "6022858", "url": "https://glygen.org/publication/PubMed/6022858" } ] }, { "title": "Purification and kinetic properties of human erythrocyte Mg2+-dependent inorganic pyrophosphatase.", "journal": "Biochimica et biophysica acta", "date": "1978", "authors": "Thuillier L", "evidence": [ { "database": "Reactome", "id": "R-HSA-379716", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716" } ], "reference": [ { "type": "PubMed", "id": "656444", "url": "https://glygen.org/publication/PubMed/656444" } ] }, { "title": "Purification and subunit structure studies of human placental threonyl-tRNA synthetase.", "journal": "International journal of peptide and protein research", "date": "1982", "authors": "Pan F, Lee HH, Pai SH, Lo KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-379716", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716" } ], "reference": [ { "type": "PubMed", "id": "7118399", "url": "https://glygen.org/publication/PubMed/7118399" } ] }, { "title": "Human alanyl-tRNA synthetase: conservation in evolution of catalytic core and microhelix recognition.", "journal": "Biochemistry", "date": "1995", "authors": "Shiba K, Ripmaster T, Suzuki N, Nichols R, Plotz P, Noda T, Schimmel P", "evidence": [ { "database": "Reactome", "id": "R-HSA-379716", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716" } ], "reference": [ { "type": "PubMed", "id": "7654687", "url": "https://glygen.org/publication/PubMed/7654687" } ] }, { "title": "A novel gene oriented in a head-to-head configuration with the human histidyl-tRNA synthetase (HRS) gene encodes an mRNA that predicts a polypeptide homologous to HRS.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1995", "authors": "O'Hanlon TP, Raben N, Miller FW", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" } ], "reference": [ { "type": "PubMed", "id": "7755634", "url": "https://glygen.org/publication/PubMed/7755634" } ] }, { "title": "Human cytoplasmic isoleucyl-tRNA synthetase: selective divergence of the anticodon-binding domain and acquisition of a new structural unit.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Shiba K, Suzuki N, Shigesada K, Namba Y, Schimmel P, Noda T", "evidence": [ { "database": "Reactome", "id": "R-HSA-379716", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716" } ], "reference": [ { "type": "PubMed", "id": "8052601", "url": "https://glygen.org/publication/PubMed/8052601" } ] }, { "title": "Evolution of the Glx-tRNA synthetase family: the glutaminyl enzyme as a case of horizontal gene transfer.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Lamour V, Quevillon S, Diriong S, N'Guyen VC, Lipinski M, Mirande M", "evidence": [ { "database": "Reactome", "id": "R-HSA-379716", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716" } ], "reference": [ { "type": "PubMed", "id": "8078941", "url": "https://glygen.org/publication/PubMed/8078941" } ] }, { "title": "The human EPRS locus (formerly the QARS locus): a gene encoding a class I and a class II aminoacyl-tRNA synthetase.", "journal": "Genomics", "date": "1994", "authors": "Kaiser E, Hu B, Becher S, Eberhard D, Schray B, Baack M, Hameister H, Knippers R", "evidence": [ { "database": "Reactome", "id": "R-HSA-379716", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716" } ], "reference": [ { "type": "PubMed", "id": "8188258", "url": "https://glygen.org/publication/PubMed/8188258" } ] }, { "title": "Transcriptional analyses of the gene region that encodes human histidyl-tRNA synthetase: identification of a novel bidirectional regulatory element.", "journal": "Gene", "date": "1993", "authors": "Tsui HW, Mok S, de Souza L, Martin A, Tsui FW", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" } ], "reference": [ { "type": "PubMed", "id": "8406012", "url": "https://glygen.org/publication/PubMed/8406012" } ] }, { "title": "Cloning, sequencing and expression of a cDNA encoding mammalian valyl-tRNA synthetase.", "journal": "Gene", "date": "1993", "authors": "Vilalta A, Donovan D, Wood L, Vogeli G, Yang DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-379716", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716" } ], "reference": [ { "type": "PubMed", "id": "8428657", "url": "https://glygen.org/publication/PubMed/8428657" } ] }, { "title": "Expression of human aspartyl-tRNA synthetase in Escherichia coli. Functional analysis of the N-terminal putative amphiphilic helix.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Escalante C, Yang DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-379716", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716" } ], "reference": [ { "type": "PubMed", "id": "8449960", "url": "https://glygen.org/publication/PubMed/8449960" } ] }, { "title": "Human lysyl-tRNA synthetase accepts nucleotide 73 variants and rescues Escherichia coli double-defective mutant.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Shiba K, Stello T, Motegi H, Noda T, Musier-Forsyth K, Schimmel P", "evidence": [ { "database": "Reactome", "id": "R-HSA-379716", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716" } ], "reference": [ { "type": "PubMed", "id": "9278442", "url": "https://glygen.org/publication/PubMed/9278442" } ] }, { "title": "Human cytosolic asparaginyl-tRNA synthetase: cDNA sequence, functional expression in Escherichia coli and characterization as human autoantigen.", "journal": "Nucleic acids research", "date": "1998", "authors": "Beaulande M, Tarbouriech N, Hartlein M", "evidence": [ { "database": "Reactome", "id": "R-HSA-379716", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716" } ], "reference": [ { "type": "PubMed", "id": "9421509", "url": "https://glygen.org/publication/PubMed/9421509" } ] }, { "title": "Genomic organization, cDNA sequence, bacterial expression, and purification of human seryl-tRNA synthase.", "journal": "European journal of biochemistry", "date": "1997", "authors": "Vincent C, Tarbouriech N, Hartlein M", "evidence": [ { "database": "Reactome", "id": "R-HSA-379716", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716" } ], "reference": [ { "type": "PubMed", "id": "9431993", "url": "https://glygen.org/publication/PubMed/9431993" } ] } ], "pathway": [ { "id": "hsa:3035", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3035", "resource": "KEGG Pathway" }, { "id": "R-HSA-379716", "name": "Cytosolic tRNA aminoacylation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379716", "resource": "Reactome", "description": "Cytosolic tRNA aminoacylation" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A8J8YFS5-1", "protein_name": "Histidine--tRNA ligase, cytoplasmic", "gene_name": "Hars1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MADRAALEELVRLQGAHVRGLKEQKASAEQIEEEVTKLLKLKAQLGHDEGKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLTGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGQFDPMIPDAECLKIMCEILSSLQIGNFQVKVNDRRILDGMFAVCGVPDSKFRTICSSVDKLDKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQAVEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQMPTQAGEEPLGVGSIAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQKLEASEEKVRTTETQVLVASAQKKLLEERLKLISELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIRRRTSQPLSM", "length": 501 }, "evidence": [ { "id": "P12081", "url": "https://omabrowser.org/oma/group/P12081/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P07263-1", "protein_name": "Histidine--tRNA ligase, mitochondrial", "gene_name": "HTS1", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MLSRSLNKVVTSIKSSSIIRMSSATAAATSAPTANAANALKASKAPKKGKLQVSLKTPKGTKDWADSDMVIREAIFSTLSGLFKKHGGVTIDTPVFELREILAGKYGEDSKLIYNLEDQGGELCSLRYDLTVPFARYVAMNNIQSIKRYHIAKVYRRDQPAMTKGRMREFYQCDFDVAGTFESMVPDSECLSILVEGLTSLGIKDFKIKLNHRKILDGIFQIAGVKDEDVRKISSAVDKLDKSPWEAVKKEMTEEKGQSEETADKIGEYVKLNGSLKEIHAVLSADANITSNEKAKQGLDDIATLMKYTEAFDIDSFISFDLSLARGLDYYTGLIYEVVTSASAPPENASELKKKAKSAEDASEFVGVGSIAAGGRYDNLVNMFSEASGKKSTQIPCVGISFGVERIFSLIKQRINSSTTIKPTATQVFVMAFGGGKDWTGYLPERMKVTKQLWDAGIEAEYVYKAKANPRKQFDAAEKAGCHIAVILGKEEYLEGKLRVKRLGQEFADDDGELVSAADIVPIVQEKLSQIHEDGLNEVTRLIKGL", "length": 546 }, "evidence": [ { "id": "P12081", "url": "https://omabrowser.org/oma/group/P12081/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q61035-1", "protein_name": "Histidine--tRNA ligase, cytoplasmic", "gene_name": "Hars1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MADRAALEELVRLQGAHVRGLKEQKASAEQIEEEVTKLLKLKAQLGQDEGKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLTGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGQFDPMIPDAECLKIMCEILSSLQIGNFLVKVNDRRILDGMFAVCGVPDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQAVEGLGDLKLLFEYLILFGIDDKISFDLSLARGLDYYTGVIYEAVLLQMPTQAGEEPLGVGSIAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEASEEKVRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVASREEVDVRREDLVEEIRRRTNQPLSTC", "length": 509 }, "evidence": [ { "id": "45925646", "url": "http://www.informatics.jax.org/homology/45925646", "database": "MGI" }, { "id": "P12081", "url": "https://omabrowser.org/oma/group/P12081/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q8IQX8-1", "protein_name": "histidine--tRNA ligase", "gene_name": "HisRS", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MSDTREQILEQIKVQGDLVRQLKAAKESKEKTAPSGGGRVSSSGVPAQRQQQQQPQKQQQAQVQQQQHEQLHQIDEEVARLLALKATLGGDAAPTNQKFTLKTPKGTRDYGPQQMTLRQGVLDKIVQVFKRHGGEAIDTPVFELKEVLTGKYGEDSKLIYDLKDQGGEILSMRYDLTVPLARYLAMNKISSIKRYHIAKVYRRDNPAMTKGRYREFYQCDFDIAGTYDPMLPDAECVKIVSEILDTLDIGDYVIKLNHRQLLDGMFQACGVPADSFRTICSAVDKLDKSPWADVRKEMVDEKGLDEAAADRIGEYVRLSGGAELVEQLLANEKLKAVPNAVKGLEGMKQLLKYCSIFGLDKRVSFDLSLARGLDYYTGVIYEGVLKGESATVASPAKTSQQNGEQANEPATVGSVAGGGRYDNLVGMFDPRGKAVPCVGVSIGVERIFSVLEARAAASGLKLRTSDVEVYVASAHKGLHEQRLKVLNLLWDAGVKAEHSYKLNPKLLVQLQHCEEHQIPLVVVLGDAELAQGLVKLREVTTREETNVKLEDLAAEIRRRQQASA", "length": 564 }, "evidence": [ { "id": "P12081", "url": "https://omabrowser.org/oma/group/P12081/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" } ], "pmid": "" }, { "name": "histidine-tRNA ligase activity", "id": "GO:0004821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004821", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" } ], "pmid": "" }, { "name": "aminoacyl-tRNA ligase activity", "id": "GO:0004812", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004812", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" } ], "pmid": "" }, { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "tRNA aminoacylation for protein translation", "id": "GO:0006418", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006418", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" } ], "pmid": "" }, { "name": "histidyl-tRNA aminoacylation", "id": "GO:0006427", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006427", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" } ], "pmid": "" }, { "name": "translation", "id": "GO:0006412", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006412", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" } ], "pmid": "" }, { "name": "mitochondrial translation", "id": "GO:0032543", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032543", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" } ], "pmid": "" }, { "name": "nucleic acid metabolic process", "id": "GO:0090304", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090304", "evidence": [ { "database": "UniProtKB", "id": "P12081", "url": "https://www.uniprot.org/uniprot/P12081" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "17313", "name": "", "equation": "ATP + L-histidine + tRNA(His) = AMP + diphosphate + H(+) + L-histidyl-tRNA(His)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D4AD01-1", "A0A8J8YFS5-1", "A0A8I6ALV4-1", "P49590-1", "P12081-1", "Q61035-1", "Q99KK9-1", "P07263-1", "Q55D12-1", "Q86AS6-1", "Q8IQX8-1" ], "evidence": [ { "id": "17313", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/17313" } ] }, { "id": "R-HSA-379844", "name": "histidine + tRNA(His) + ATP => His-tRNA(His) + AMP + pyrophosphate", "equation": "", "summary": "HARS (cytosolic histidyl tRNA synthetase) catalyzes the reaction of histidine, tRNA(His), and ATP to form His-tRNA(His), AMP, and pyrophosphate (Lee et al. 2002).", "cellular_location": "cytosol", "input_participant_list": [ "R-HSA-379758" ], "output_participant_list": [ "R-HSA-379786" ], "enzyme_list": [ "P12081-1" ], "evidence": [ { "id": "R-HSA-379844", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-379844" } ] } ], "reaction_participants": [ { "participant_id": "R-HSA-379758", "participant_name": "tRNA(His) [cytosol]", "crossref": [ { "id": "29178", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-HSA-379786", "participant_name": "His-tRNA(His) [cytosol]", "crossref": [ { "id": "29155", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A8I6ALV4", "gene_name": "ENSRNOG00000064147", "activity": [ { "ec_number": "6.1.1.21", "activity": "ATP + L-histidine + tRNA(His) = AMP + diphosphate + H(+) + L-histidyl-tRNA(His).", "evidence": [ { "id": "A0A8I6ALV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6ALV4" } ] }, { "ec_number": "6.1.1.21", "activity": "", "evidence": [ { "id": "A0A8I6ALV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6ALV4" } ] } ] }, { "uniprot_ac": "A0A8J8YFS5", "gene_name": "Hars1", "activity": [ { "ec_number": "6.1.1.21", "activity": "ATP + L-histidine + tRNA(His) = AMP + diphosphate + H(+) + L-histidyl-tRNA(His).", "evidence": [ { "id": "A0A8J8YFS5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8J8YFS5" } ] }, { "ec_number": "6.1.1.21", "activity": "", "evidence": [ { "id": "A0A8J8YFS5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8J8YFS5" } ] } ] }, { "uniprot_ac": "D4AD01", "gene_name": "Zmat2", "activity": [ { "ec_number": "6.1.1.21", "activity": "ATP + L-histidine + tRNA(His) = AMP + diphosphate + H(+) + L-histidyl-tRNA(His).", "evidence": [ { "id": "D4AD01", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AD01" } ] }, { "ec_number": "6.1.1.21", "activity": "", "evidence": [ { "id": "D4AD01", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AD01" } ] } ] }, { "uniprot_ac": "P07263", "gene_name": "HTS1", "activity": [ { "ec_number": "6.1.1.21", "activity": "ATP + L-histidine + tRNA(His) = AMP + diphosphate + H(+) + L-histidyl-tRNA(His).", "evidence": [ { "id": "P07263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07263" } ] }, { "ec_number": "6.1.1.21", "activity": "", "evidence": [ { "id": "P07263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07263" } ] } ] }, { "uniprot_ac": "P12081", "gene_name": "HARS1", "activity": [ { "ec_number": "6.1.1.21", "activity": "ATP + L-histidine + tRNA(His) = AMP + diphosphate + H(+) + L-histidyl-tRNA(His).", "evidence": [ { "id": "P12081", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12081" } ] }, { "ec_number": "6.1.1.21", "activity": "", "evidence": [ { "id": "P12081", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12081" } ] } ] }, { "uniprot_ac": "P49590", "gene_name": "HARS2", "activity": [ { "ec_number": "6.1.1.21", "activity": "ATP + L-histidine + tRNA(His) = AMP + diphosphate + H(+) + L-histidyl-tRNA(His).", "evidence": [ { "id": "P49590", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49590" } ] }, { "ec_number": "6.1.1.21", "activity": "", "evidence": [ { "id": "P49590", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49590" } ] } ] }, { "uniprot_ac": "Q55D12", "gene_name": "mhisS", "activity": [ { "ec_number": "6.1.1.21", "activity": "ATP + L-histidine + tRNA(His) = AMP + diphosphate + H(+) + L-histidyl-tRNA(His).", "evidence": [ { "id": "Q55D12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55D12" } ] }, { "ec_number": "6.1.1.21", "activity": "", "evidence": [ { "id": "Q55D12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55D12" } ] } ] }, { "uniprot_ac": "Q61035", "gene_name": "Hars1", "activity": [ { "ec_number": "6.1.1.21", "activity": "ATP + L-histidine + tRNA(His) = AMP + diphosphate + H(+) + L-histidyl-tRNA(His).", "evidence": [ { "id": "Q61035", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61035" } ] }, { "ec_number": "6.1.1.21", "activity": "", "evidence": [ { "id": "Q61035", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61035" } ] } ] }, { "uniprot_ac": "Q86AS6", "gene_name": "hisS", "activity": [ { "ec_number": "6.1.1.21", "activity": "ATP + L-histidine + tRNA(His) = AMP + diphosphate + H(+) + L-histidyl-tRNA(His).", "evidence": [ { "id": "Q86AS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86AS6" } ] }, { "ec_number": "6.1.1.21", "activity": "", "evidence": [ { "id": "Q86AS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86AS6" } ] } ] }, { "uniprot_ac": "Q8IQX8", "gene_name": "HisRS", "activity": [ { "ec_number": "6.1.1.21", "activity": "ATP + L-histidine + tRNA(His) = AMP + diphosphate + H(+) + L-histidyl-tRNA(His).", "evidence": [ { "id": "Q8IQX8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IQX8" } ] }, { "ec_number": "6.1.1.21", "activity": "", "evidence": [ { "id": "Q8IQX8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IQX8" } ] } ] }, { "uniprot_ac": "Q99KK9", "gene_name": "Hars2", "activity": [ { "ec_number": "6.1.1.21", "activity": "ATP + L-histidine + tRNA(His) = AMP + diphosphate + H(+) + L-histidyl-tRNA(His).", "evidence": [ { "id": "Q99KK9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99KK9" } ] }, { "ec_number": "6.1.1.21", "activity": "", "evidence": [ { "id": "Q99KK9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99KK9" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 66, 356, 363 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 47 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }