{ "uniprot_canonical_ac": "P12019-1", "uniprot_ac": "P12019", "uniprot_id": "PDE1_DICDI", "mass": { "chemical_mass": 51093.0, "monoisotopic_mass": 51093.0 }, "refseq": { "ac": "XP_637948", "name": "cAMP phosphodiesterase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_637948" }, "gene_names": [ { "name": "pdsA", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P12019", "id": "P12019" }, { "name": "DDB_G0285995", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P12019", "id": "P12019" }, { "name": "pde1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P12019", "id": "P12019" }, { "name": "pdeA", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P12019", "id": "P12019" }, { "name": "pdsA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_637948", "id": "XP_637948" } ], "protein_names": [ { "name": "cAMP/cGMP-dependent 3',5'-cAMP/cGMP phosphodiesterase A", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P12019" }, { "name": "3',5'-cyclic-nucleotide phosphodiesterase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P12019" }, { "name": "3':5'-CNP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P12019" }, { "name": "3.1.4.35", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P12019" }, { "name": "3.1.4.53", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P12019" }, { "name": "DdPDE1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P12019" }, { "name": "PDEase A", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P12019" }, { "name": "Phosphodiesterase 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P12019" }, { "name": "cAMP phosphodiesterase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_637948", "id": "XP_637948" }, { "name": "cAMP/cGMP-dependent 3',5'-cAMP/cGMP phosphodiesterase 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P12019" }, { "name": "cGMP phosphodiesterase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_637948", "id": "XP_637948" } ], "function": [ { "annotation": "Phosphodiesterase which displays a preference for cAMP over cGMP. Involved in the degradation of extracellular cAMP. Maintains the responsiveness of cells to the chemoattractant cAMP during the aggregation phase of development.", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019#function" }, { "database": "PubMed", "id": "12429832", "url": "https://glygen.org/publication/PubMed/12429832" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "common_name": "Cellular slime molds" } ], "gene": [ { "name": "pdsA", "url": "https://www.uniprot.org/uniprot/P12019", "locus": {} } ], "crossref": [ { "id": "cd07735", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07735", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "DDB_G0285995", "url": "http://dictybase.org/gene/DDB_G0285995", "database": "dictyBase", "categories": [ "Organism-specific" ] }, { "id": "8625393", "url": "https://www.ncbi.nlm.nih.gov/gene/8625393", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000396", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000396", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024225", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024225", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036866", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036866", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0285995", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0285995", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "CHDNLIS", "url": "https://omabrowser.org/oma/group/CHDNLIS/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR28283", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28283", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR28283:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28283:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02112", "url": "http://pfam.xfam.org/family/PF02112", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P12019", "url": "http://purl.obolibrary.org/obo/PR_P12019", "database": "PRO", "categories": [ "Protein" ] }, { "id": "XP_637948", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_637948", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "16957", "url": "https://www.rhea-db.org/rhea/16957", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "25277", "url": "https://www.rhea-db.org/rhea/25277", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P12019-1", "url": "https://www.uniprot.org/uniprot/P12019-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MALNKKLISLLLLIFIILNIVNSHQQEDCDDDDEDIGISAERSERRSVKNSNDGSNFYNLNDYYTPENWNYYSGSFATKDCRDASYITIPLGTTGGLDEGNLSSFLLTKKGSNLFIALDAGTVWQGVRRLTTFKYFNTLFNITYPSWAVLPEQRTSWFLKNHVMSYFIGHSHLDHVGGLILVSPEDYLAKNWIDVQPPINNGIMGLIRKLGFKPTDFTSSSILQKKTIMGLPSTINSISTNLFNNQVWPNLPSFGRYQYFSLASGIEYPFTELVPYNATTMSLVANEFPFSVKVKPFELCHDNLISTSFLFTDSISGEQIAFFSDTGVPSSVACDWEGKIYAVWKQIKIDKLKAIYIETSFPNNTPDSAMFGHLRPRDVMKLMDQLLVQSIQTSPPMTNLKHVKLIIEHIKPQVAEDPNGWTTQRVIYQQLKEANNNGVRIIIPNQGDPICI", "length": 452, "header": "sp|P12019-1|PDE1_DICDI Isoform 1 of cAMP/cGMP-dependent 3',5'-cAMP/cGMP phosphodiesterase A OS=Dictyostelium discoideum OX=44689 GN=pdsA PE=1 SV=2 CANONICAL=P12019-1" }, "isoforms": [ { "isoform_ac": "P12019-1", "url": "", "sequence": { "sequence": "MALNKKLISLLLLIFIILNIVNSHQQEDCDDDDEDIGISAERSERRSVKNSNDGSNFYNLNDYYTPENWNYYSGSFATKDCRDASYITIPLGTTGGLDEGNLSSFLLTKKGSNLFIALDAGTVWQGVRRLTTFKYFNTLFNITYPSWAVLPEQRTSWFLKNHVMSYFIGHSHLDHVGGLILVSPEDYLAKNWIDVQPPINNGIMGLIRKLGFKPTDFTSSSILQKKTIMGLPSTINSISTNLFNNQVWPNLPSFGRYQYFSLASGIEYPFTELVPYNATTMSLVANEFPFSVKVKPFELCHDNLISTSFLFTDSISGEQIAFFSDTGVPSSVACDWEGKIYAVWKQIKIDKLKAIYIETSFPNNTPDSAMFGHLRPRDVMKLMDQLLVQSIQTSPPMTNLKHVKLIIEHIKPQVAEDPNGWTTQRVIYQQLKEANNNGVRIIIPNQGDPICI", "length": 452, "header": "sp|P12019-1|PDE1_DICDI Isoform 1 of cAMP/cGMP-dependent 3',5'-cAMP/cGMP phosphodiesterase A OS=Dictyostelium discoideum OX=44689 GN=pdsA PE=1 SV=2 CANONICAL=P12019-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "P12019", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12019#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 141, "start_aa": "Asn", "end_pos": 141, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn141", "evidence": [ { "id": "P12019", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12019#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 277, "start_aa": "Asn", "end_pos": 277, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn277", "evidence": [ { "id": "P12019", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12019#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Identification and characterization of two unusual cGMP-stimulated phoshodiesterases in dictyostelium.", "journal": "Molecular biology of the cell", "date": "2002-11", "authors": "Bosgraaf Leonard, Russcher Henk, Snippe Helena, Bader Sonya, Wind Joyce, Van Haastert Peter J M", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "reference": [ { "type": "PubMed", "id": "12429832", "url": "https://glygen.org/publication/PubMed/12429832" } ] }, { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Eichinger L, Pachebat J A, Gl\u00f6ckner G, Rajandream M-A, Sucgang R, Berriman M, Song J, Olsen R, Szafranski K, Xu Q, Tunggal B, Kummerfeld S, Madera M, Konfortov B A, Rivero F, Bankier A T, Lehmann R, Hamlin N, Davies R, Gaudet P, Fey P, Pilcher K, Chen G, Saunders D, Sodergren E, Davis P, Kerhornou A, Nie X, Hall N, Anjard C, Hemphill L, Bason N, Farbrother P, Desany B, Just E, Morio T, Rost R, Churcher C, Cooper J, Haydock S, van Driessche N, Cronin A, Goodhead I, Muzny D, Mourier T, Pain A, Lu M, Harper D, Lindsay R, Hauser H, James K, Quiles M, Madan Babu M, Saito T, Buchrieser C, Wardroper A, Felder M, Thangavelu M, Johnson D, Knights A, Loulseged H, Mungall K, Oliver K, Price C, Quail M A, Urushihara H, Hernandez J, Rabbinowitsch E, Steffen D, Sanders M, Ma J, Kohara Y, Sharp S, Simmonds M, Spiegler S, Tivey A, Sugano S, White B, Walker D, Woodward J, Winckler T, Tanaka Y, Shaulsky G, Schleicher M, Weinstock G, Rosenthal A, Cox E C, Chisholm R L, Gibbs R, Loomis W F, Platzer M, Kay R R, Williams J, Dear P H, Noegel A A, Barrell B, Kuspa A", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] }, { "title": "Seven Dictyostelium discoideum phosphodiesterases degrade three pools of cAMP and cGMP.", "journal": "Biochem. J.", "date": "2007", "authors": "Bader Sonya, Kortholt Arjan, Van Haastert Peter J M", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "reference": [ { "type": "PubMed", "id": "17040207", "url": "https://glygen.org/publication/PubMed/17040207" } ] }, { "title": "Precedence temporal networks to represent temporal relationships in gene expression data.", "journal": "J. Biomed. Inform.", "date": "2007", "authors": "Sacchi Lucia, Larizza Cristiana, Magni Paolo, Bellazzi Riccardo", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "reference": [ { "type": "PubMed", "id": "17644489", "url": "https://glygen.org/publication/PubMed/17644489" } ] }, { "title": "Dictyostelium transcriptional responses to Pseudomonas aeruginosa: common and specific effects from PAO1 and PA14 strains.", "journal": "BMC Microbiol.", "date": "2008", "authors": "Carilla-Latorre Sergio, Calvo-Garrido Javier, Bloomfield Gareth, Skelton Jason, Kay Robert R, Ivens Alasdair, Martinez Jos\u00e9 L, Escalante Ricardo", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "reference": [ { "type": "PubMed", "id": "18590548", "url": "https://glygen.org/publication/PubMed/18590548" } ] }, { "title": "The cyclic nucleotide phosphodiesterase gene of Dictyostelium discoideum utilizes alternate promoters and splicing for the synthesis of multiple mRNAs.", "journal": "Mol. Cell. Biol.", "date": "1989", "authors": "Podgorski G J, Franke J, Faure M, Kessin R H", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "reference": [ { "type": "PubMed", "id": "2779573", "url": "https://glygen.org/publication/PubMed/2779573" } ] }, { "title": "Isolation of a cDNA encoding a portion of the cyclic nucleotide phosphodiesterase of Dictyostelium discoideum.", "journal": "J. Gen. Microbiol.", "date": "1986", "authors": "Podgorski G J, Franke J, Kessin R H", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "reference": [ { "type": "PubMed", "id": "3020155", "url": "https://glygen.org/publication/PubMed/3020155" } ] }, { "title": "Molecular cloning and developmental expression of the cyclic nucleotide phosphodiesterase gene of Dictyostelium discoideum.", "journal": "J. Biol. Chem.", "date": "1986", "authors": "Lacombe M L, Podgorski G J, Franke J, Kessin R H", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "reference": [ { "type": "PubMed", "id": "3023365", "url": "https://glygen.org/publication/PubMed/3023365" } ] } ], "pathway": [ { "id": "ddi:DDB_G0285995", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0285995", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 10, "go_terms": [ { "name": "adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway", "id": "GO:0007193", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007193", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "pmid": "" }, { "name": "response to cAMP", "id": "GO:0051591", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051591", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "pmid": "" }, { "name": "response to dithiothreitol", "id": "GO:0072720", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072720", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "pmid": "" }, { "name": "cAMP catabolic process", "id": "GO:0006198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006198", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "pmid": "" }, { "name": "response to catechin", "id": "GO:1902168", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902168", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "pmid": "" }, { "name": "extracellular regulation of signal transduction", "id": "GO:1900115", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900115", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "pmid": "" }, { "name": "negative regulation of glucose mediated signaling pathway", "id": "GO:1902660", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902660", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "pmid": "" }, { "name": "aggregation involved in sorocarp development", "id": "GO:0031152", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031152", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "pmid": "" }, { "name": "slug development involved in sorocarp development", "id": "GO:0031153", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031153", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "pmid": "" }, { "name": "response to differentiation-inducing factor 1", "id": "GO:1903013", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903013", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "cAMP binding", "id": "GO:0030552", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030552", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "pmid": "" }, { "name": "cGMP binding", "id": "GO:0030553", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030553", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "pmid": "" }, { "name": "3',5'-cyclic-GMP phosphodiesterase activity", "id": "GO:0047555", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047555", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "pmid": "" }, { "name": "3',5'-cyclic-nucleotide phosphodiesterase activity", "id": "GO:0004114", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004114", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "pmid": "" }, { "name": "3',5'-cyclic-AMP phosphodiesterase activity", "id": "GO:0004115", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004115", "evidence": [ { "database": "UniProtKB", "id": "P12019", "url": "https://www.uniprot.org/uniprot/P12019" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 101, "end_pos": 103, "annotation": "n_glycosylation_sequon" }, { "start_pos": 141, "end_pos": 143, "annotation": "n_glycosylation_sequon" }, { "start_pos": 277, "end_pos": 279, "annotation": "n_glycosylation_sequon" }, { "start_pos": 363, "end_pos": 365, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "16957", "name": "", "equation": "3',5'-cyclic GMP + H2O = GMP + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8VID6-1", "P61250-1", "O54735-1", "Q8QZV1-1", "M0R4R9-1", "Q9QYJ6-1", "Q63421-1", "A0A8I6A416-1", "Q01066-1", "Q62865-1", "Q01062-1", "Q63085-1", "P18545-1", "Q13956-1", "O76083-1", "P51160-1", "P16499-1", "Q9HCR9-1", "O76074-1", "P35913-1", "Q9Y233-3", "Q14123-1", "O00408-1", "Q13370-1", "P54750-1", "Q01064-1", "Q14432-1", "Q01065-1", "P09174-1", "P61249-1", "Q91ZQ1-1", "P27664-1", "P23440-1", "Q8CG03-1", "O70628-1", "P0C1Q2-1", "Q8CA95-1", "Q61481-4", "Q61409-1", "Q9Z0X4-1", "Q922S4-1", "Q64338-3", "B0G0Y8-1", "P12019-1", "Q54HY0-1", "Q8MLZ3-1", "Q8MM62-1", "B7YZV4-1", "Q9I7S6-1", "Q9VFI9-1", "Q9VJ79-1" ], "evidence": [ { "id": "16957", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/16957" } ] }, { "id": "25277", "name": "", "equation": "3',5'-cyclic AMP + H2O = AMP + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8VID6-1", "O08593-1", "P14644-1", "Q63421-1", "P54748-1", "P14270-5", "P14646-3", "Q9QYJ6-1", "A0A8I6A416-1", "Q01066-1", "Q62865-1", "Q01062-1", "Q924C3-1", "Q63085-1", "Q07343-1", "Q08499-1", "O60658-1", "O95263-1", "Q08493-1", "Q13946-1", "Q9NP56-1", "Q9HCR9-1", "P27815-1", "Q14123-1", "Q9Y233-3", "O00408-1", "Q13370-1", "P22413-1", "P54750-1", "Q01064-1", "Q14432-1", "Q01063-1", "Q01065-1", "E9Q4S1-1", "Q9QXQ1-1", "O88502-1", "O89084-1", "P0C1Q2-1", "P70453-1", "Q3UEI1-1", "Q64338-3", "Q8CA95-1", "B1AWC9-1", "Q61481-4", "Q61409-1", "Q9Z0X4-1", "P06802-1", "Q922S4-1", "P06776-1", "P12019-1", "Q23917-1", "Q54HY0-1", "Q86H13-1", "Q8MM62-1", "Q9W4T4-1", "Q6NNF2-1", "B7YZV4-1", "Q9VJ79-1" ], "evidence": [ { "id": "25277", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/25277" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A8I6A416", "gene_name": "Pde1a", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "A0A8I6A416", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6A416" } ] } ] }, { "uniprot_ac": "B0G0Y8", "gene_name": "pde3", "activity": [ { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "B0G0Y8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B0G0Y8" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "B0G0Y8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B0G0Y8" } ] } ] }, { "uniprot_ac": "B1AWC9", "gene_name": "Pde4b", "activity": [ { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "B1AWC9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B1AWC9" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "B1AWC9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B1AWC9" } ] }, { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "B1AWC9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B1AWC9" } ] } ] }, { "uniprot_ac": "B7YZV4", "gene_name": "Pde1c", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "B7YZV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B7YZV4" } ] }, { "ec_number": "3.1.4.17", "activity": "a nucleoside 3',5'-cyclic phosphate + H2O = a nucleoside 5'-phosphate + H(+).", "evidence": [ { "id": "B7YZV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B7YZV4" } ] }, { "ec_number": "3.1.4.17", "activity": "", "evidence": [ { "id": "B7YZV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B7YZV4" } ] } ] }, { "uniprot_ac": "E9Q4S1", "gene_name": "Pde8b", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "E9Q4S1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q4S1" } ] }, { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "E9Q4S1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q4S1" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "E9Q4S1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q4S1" } ] } ] }, { "uniprot_ac": "M0R4R9", "gene_name": "Pde6g", "activity": [ { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "M0R4R9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0R4R9" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "M0R4R9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0R4R9" } ] } ] }, { "uniprot_ac": "O00408", "gene_name": "PDE2A", "activity": [ { "ec_number": "3.1.4.17", "activity": "a nucleoside 3',5'-cyclic phosphate + H2O = a nucleoside 5'-phosphate + H(+).", "evidence": [ { "id": "O00408", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00408" } ] }, { "ec_number": "3.1.4.17", "activity": "", "evidence": [ { "id": "O00408", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00408" } ] }, { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "O00408", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00408" } ] } ] }, { "uniprot_ac": "O08593", "gene_name": "Pde7a", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "O08593", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08593" } ] }, { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "O08593", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08593" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "O08593", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08593" } ] } ] }, { "uniprot_ac": "O54735", "gene_name": "Pde5a", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "O54735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54735" } ] }, { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "O54735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54735" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "O54735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54735" } ] } ] }, { "uniprot_ac": "O60658", "gene_name": "PDE8A", "activity": [ { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "O60658", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60658" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "O60658", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60658" } ] } ] }, { "uniprot_ac": "O70628", "gene_name": "Pde9a", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "O70628", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70628" } ] }, { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "O70628", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70628" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "O70628", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70628" } ] } ] }, { "uniprot_ac": "O76074", "gene_name": "PDE5A", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "O76074", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O76074" } ] }, { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "O76074", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O76074" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "O76074", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O76074" } ] } ] }, { "uniprot_ac": "O76083", "gene_name": "PDE9A", "activity": [ { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "O76083", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O76083" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "O76083", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O76083" } ] } ] }, { "uniprot_ac": "O88502", "gene_name": "Pde8a", "activity": [ { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "O88502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88502" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "O88502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88502" } ] } ] }, { "uniprot_ac": "O89084", "gene_name": "Pde4a", "activity": [ { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "O89084", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O89084" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "O89084", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O89084" } ] } ] }, { "uniprot_ac": "O95263", "gene_name": "PDE8B", "activity": [ { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "O95263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95263" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "O95263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95263" } ] } ] }, { "uniprot_ac": "P06776", "gene_name": "PDE2", "activity": [ { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "P06776", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06776" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "P06776", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06776" } ] } ] }, { "uniprot_ac": "P06802", "gene_name": "Enpp1", "activity": [ { "ec_number": "3.1.4.1", "activity": "Hydrolytically removes 5'-nucleotides successively from the 3'-hydroxy termini of 3'-hydroxy-terminated oligonucleotides.", "evidence": [ { "id": "P06802", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06802" } ] }, { "ec_number": "3.6.1.9", "activity": "CTP + H2O = CMP + diphosphate + H(+).", "evidence": [ { "id": "P06802", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06802" } ] } ] }, { "uniprot_ac": "P09174", "gene_name": "Pde6g", "activity": [ { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "P09174", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09174" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "P09174", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09174" } ] } ] }, { "uniprot_ac": "P0C1Q2", "gene_name": "Pde11a", "activity": [ { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "P0C1Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C1Q2" } ] }, { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "P0C1Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C1Q2" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "P0C1Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C1Q2" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "P0C1Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C1Q2" } ] }, { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "P0C1Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C1Q2" } ] } ] }, { "uniprot_ac": "P12019", "gene_name": "pdsA", "activity": [ { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "P12019", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12019" } ] }, { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "P12019", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12019" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "P12019", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12019" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "P12019", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12019" } ] } ] }, { "uniprot_ac": "P14270", "gene_name": "Pde4d", "activity": [ { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "P14270", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14270" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "P14270", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14270" } ] } ] }, { "uniprot_ac": "P14644", "gene_name": "Pde4c", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "P14644", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14644" } ] }, { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "P14644", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14644" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "P14644", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14644" } ] } ] }, { "uniprot_ac": "P14646", "gene_name": "Pde4b", "activity": [ { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "P14646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14646" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "P14646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14646" } ] } ] }, { "uniprot_ac": "P16499", "gene_name": "PDE6A", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "P16499", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16499" } ] }, { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "P16499", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16499" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "P16499", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16499" } ] } ] }, { "uniprot_ac": "P18545", "gene_name": "PDE6G", "activity": [ { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "P18545", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18545" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "P18545", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18545" } ] } ] }, { "uniprot_ac": "P22413", "gene_name": "ENPP1", "activity": [ { "ec_number": "3.1.4.1", "activity": "Hydrolytically removes 5'-nucleotides successively from the 3'-hydroxy termini of 3'-hydroxy-terminated oligonucleotides.", "evidence": [ { "id": "P22413", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22413" } ] }, { "ec_number": "3.6.1.9", "activity": "CTP + H2O = CMP + diphosphate + H(+).", "evidence": [ { "id": "P22413", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22413" } ] } ] }, { "uniprot_ac": "P23440", "gene_name": "Pde6b", "activity": [ { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "P23440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23440" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "P23440", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23440" } ] } ] }, { "uniprot_ac": "P27664", "gene_name": "Pde6a", "activity": [ { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "P27664", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27664" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "P27664", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27664" } ] }, { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "P27664", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27664" } ] } ] }, { "uniprot_ac": "P27815", "gene_name": "PDE4A", "activity": [ { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "P27815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27815" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "P27815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27815" } ] } ] }, { "uniprot_ac": "P35913", "gene_name": "PDE6B", "activity": [ { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "P35913", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35913" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "P35913", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35913" } ] } ] }, { "uniprot_ac": "P51160", "gene_name": "PDE6C", "activity": [ { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "P51160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51160" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "P51160", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51160" } ] } ] }, { "uniprot_ac": "P54748", "gene_name": "Pde4a", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "P54748", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54748" } ] }, { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "P54748", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54748" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "P54748", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54748" } ] } ] }, { "uniprot_ac": "P54750", "gene_name": "PDE1A", "activity": [ { "ec_number": "3.1.4.17", "activity": "a nucleoside 3',5'-cyclic phosphate + H2O = a nucleoside 5'-phosphate + H(+).", "evidence": [ { "id": "P54750", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54750" } ] }, { "ec_number": "3.1.4.17", "activity": "", "evidence": [ { "id": "P54750", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54750" } ] } ] }, { "uniprot_ac": "P61249", "gene_name": "Pde6h", "activity": [ { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "P61249", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61249" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "P61249", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61249" } ] } ] }, { "uniprot_ac": "P61250", "gene_name": "Pde6h", "activity": [ { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "P61250", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61250" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "P61250", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61250" } ] } ] }, { "uniprot_ac": "P70453", "gene_name": "Pde7a", "activity": [ { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "P70453", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70453" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "P70453", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70453" } ] } ] }, { "uniprot_ac": "Q01062", "gene_name": "Pde2a", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q01062", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01062" } ] }, { "ec_number": "3.1.4.17", "activity": "a nucleoside 3',5'-cyclic phosphate + H2O = a nucleoside 5'-phosphate + H(+).", "evidence": [ { "id": "Q01062", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01062" } ] }, { "ec_number": "3.1.4.17", "activity": "", "evidence": [ { "id": "Q01062", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01062" } ] } ] }, { "uniprot_ac": "Q01063", "gene_name": "Pde4d", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q01063", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01063" } ] }, { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "Q01063", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01063" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "Q01063", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01063" } ] } ] }, { "uniprot_ac": "Q01064", "gene_name": "PDE1B", "activity": [ { "ec_number": "3.1.4.17", "activity": "a nucleoside 3',5'-cyclic phosphate + H2O = a nucleoside 5'-phosphate + H(+).", "evidence": [ { "id": "Q01064", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01064" } ] }, { "ec_number": "3.1.4.17", "activity": "", "evidence": [ { "id": "Q01064", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01064" } ] }, { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q01064", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01064" } ] } ] }, { "uniprot_ac": "Q01065", "gene_name": "Pde1b", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q01065", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01065" } ] }, { "ec_number": "3.1.4.17", "activity": "a nucleoside 3',5'-cyclic phosphate + H2O = a nucleoside 5'-phosphate + H(+).", "evidence": [ { "id": "Q01065", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01065" } ] }, { "ec_number": "3.1.4.17", "activity": "", "evidence": [ { "id": "Q01065", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01065" } ] } ] }, { "uniprot_ac": "Q01066", "gene_name": "Pde1b", "activity": [ { "ec_number": "3.1.4.17", "activity": "a nucleoside 3',5'-cyclic phosphate + H2O = a nucleoside 5'-phosphate + H(+).", "evidence": [ { "id": "Q01066", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01066" } ] }, { "ec_number": "3.1.4.17", "activity": "", "evidence": [ { "id": "Q01066", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01066" } ] }, { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q01066", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01066" } ] } ] }, { "uniprot_ac": "Q07343", "gene_name": "PDE4B", "activity": [ { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "Q07343", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07343" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "Q07343", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07343" } ] } ] }, { "uniprot_ac": "Q08493", "gene_name": "PDE4C", "activity": [ { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "Q08493", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08493" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "Q08493", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08493" } ] }, { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q08493", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08493" } ] } ] }, { "uniprot_ac": "Q08499", "gene_name": "PDE4D", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q08499", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08499" } ] }, { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "Q08499", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08499" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "Q08499", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08499" } ] } ] }, { "uniprot_ac": "Q13370", "gene_name": "PDE3B", "activity": [ { "ec_number": "3.1.4.17", "activity": "a nucleoside 3',5'-cyclic phosphate + H2O = a nucleoside 5'-phosphate + H(+).", "evidence": [ { "id": "Q13370", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13370" } ] }, { "ec_number": "3.1.4.17", "activity": "", "evidence": [ { "id": "Q13370", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13370" } ] } ] }, { "uniprot_ac": "Q13946", "gene_name": "PDE7A", "activity": [ { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "Q13946", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13946" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "Q13946", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13946" } ] } ] }, { "uniprot_ac": "Q13956", "gene_name": "PDE6H", "activity": [ { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "Q13956", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13956" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "Q13956", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13956" } ] } ] }, { "uniprot_ac": "Q14123", "gene_name": "PDE1C", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q14123", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14123" } ] }, { "ec_number": "3.1.4.17", "activity": "a nucleoside 3',5'-cyclic phosphate + H2O = a nucleoside 5'-phosphate + H(+).", "evidence": [ { "id": "Q14123", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14123" } ] }, { "ec_number": "3.1.4.17", "activity": "", "evidence": [ { "id": "Q14123", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14123" } ] } ] }, { "uniprot_ac": "Q14432", "gene_name": "PDE3A", "activity": [ { "ec_number": "3.1.4.17", "activity": "a nucleoside 3',5'-cyclic phosphate + H2O = a nucleoside 5'-phosphate + H(+).", "evidence": [ { "id": "Q14432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14432" } ] }, { "ec_number": "3.1.4.17", "activity": "", "evidence": [ { "id": "Q14432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14432" } ] } ] }, { "uniprot_ac": "Q23917", "gene_name": "regA", "activity": [ { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "Q23917", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q23917" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "Q23917", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q23917" } ] } ] }, { "uniprot_ac": "Q3UEI1", "gene_name": "Pde4c", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q3UEI1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UEI1" } ] }, { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "Q3UEI1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UEI1" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "Q3UEI1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UEI1" } ] } ] }, { "uniprot_ac": "Q54HY0", "gene_name": "pde7", "activity": [ { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "Q54HY0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54HY0" } ] }, { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "Q54HY0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54HY0" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "Q54HY0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54HY0" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "Q54HY0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54HY0" } ] } ] }, { "uniprot_ac": "Q61409", "gene_name": "Pde3b", "activity": [ { "ec_number": "3.1.4.17", "activity": "a nucleoside 3',5'-cyclic phosphate + H2O = a nucleoside 5'-phosphate + H(+).", "evidence": [ { "id": "Q61409", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61409" } ] }, { "ec_number": "3.1.4.17", "activity": "", "evidence": [ { "id": "Q61409", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61409" } ] }, { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q61409", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61409" } ] } ] }, { "uniprot_ac": "Q61481", "gene_name": "Pde1a", "activity": [ { "ec_number": "3.1.4.17", "activity": "a nucleoside 3',5'-cyclic phosphate + H2O = a nucleoside 5'-phosphate + H(+).", "evidence": [ { "id": "Q61481", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61481" } ] }, { "ec_number": "3.1.4.17", "activity": "", "evidence": [ { "id": "Q61481", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61481" } ] } ] }, { "uniprot_ac": "Q62865", "gene_name": "Pde3a", "activity": [ { "ec_number": "3.1.4.17", "activity": "a nucleoside 3',5'-cyclic phosphate + H2O = a nucleoside 5'-phosphate + H(+).", "evidence": [ { "id": "Q62865", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62865" } ] }, { "ec_number": "3.1.4.17", "activity": "", "evidence": [ { "id": "Q62865", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62865" } ] } ] }, { "uniprot_ac": "Q63085", "gene_name": "Pde3b", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q63085", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63085" } ] }, { "ec_number": "3.1.4.17", "activity": "a nucleoside 3',5'-cyclic phosphate + H2O = a nucleoside 5'-phosphate + H(+).", "evidence": [ { "id": "Q63085", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63085" } ] }, { "ec_number": "3.1.4.17", "activity": "", "evidence": [ { "id": "Q63085", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63085" } ] } ] }, { "uniprot_ac": "Q63421", "gene_name": "Pde1c", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q63421", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63421" } ] }, { "ec_number": "3.1.4.17", "activity": "a nucleoside 3',5'-cyclic phosphate + H2O = a nucleoside 5'-phosphate + H(+).", "evidence": [ { "id": "Q63421", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63421" } ] }, { "ec_number": "3.1.4.17", "activity": "", "evidence": [ { "id": "Q63421", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63421" } ] } ] }, { "uniprot_ac": "Q64338", "gene_name": "Pde1c", "activity": [ { "ec_number": "3.1.4.17", "activity": "a nucleoside 3',5'-cyclic phosphate + H2O = a nucleoside 5'-phosphate + H(+).", "evidence": [ { "id": "Q64338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64338" } ] }, { "ec_number": "3.1.4.17", "activity": "", "evidence": [ { "id": "Q64338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64338" } ] } ] }, { "uniprot_ac": "Q6NNF2", "gene_name": "Pde8", "activity": [ { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "Q6NNF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NNF2" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "Q6NNF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NNF2" } ] } ] }, { "uniprot_ac": "Q86H13", "gene_name": "Pde4", "activity": [ { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "Q86H13", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86H13" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "Q86H13", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86H13" } ] } ] }, { "uniprot_ac": "Q8CA95", "gene_name": "Pde10a", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q8CA95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CA95" } ] }, { "ec_number": "3.1.4.17", "activity": "a nucleoside 3',5'-cyclic phosphate + H2O = a nucleoside 5'-phosphate + H(+).", "evidence": [ { "id": "Q8CA95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CA95" } ] }, { "ec_number": "3.1.4.17", "activity": "", "evidence": [ { "id": "Q8CA95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CA95" } ] } ] }, { "uniprot_ac": "Q8CG03", "gene_name": "Pde5a", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q8CG03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CG03" } ] }, { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "Q8CG03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CG03" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "Q8CG03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CG03" } ] } ] }, { "uniprot_ac": "Q8MLZ3", "gene_name": "pdeD", "activity": [ { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "Q8MLZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8MLZ3" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "Q8MLZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8MLZ3" } ] } ] }, { "uniprot_ac": "Q8MM62", "gene_name": "pdeE", "activity": [ { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "Q8MM62", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8MM62" } ] }, { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "Q8MM62", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8MM62" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "Q8MM62", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8MM62" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "Q8MM62", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8MM62" } ] } ] }, { "uniprot_ac": "Q8QZV1", "gene_name": "Pde9a", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q8QZV1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8QZV1" } ] }, { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "Q8QZV1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8QZV1" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "Q8QZV1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8QZV1" } ] } ] }, { "uniprot_ac": "Q8VID6", "gene_name": "Pde11a", "activity": [ { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "Q8VID6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VID6" } ] }, { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "Q8VID6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VID6" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "Q8VID6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VID6" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "Q8VID6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VID6" } ] } ] }, { "uniprot_ac": "Q91ZQ1", "gene_name": "Pde6c", "activity": [ { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "Q91ZQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZQ1" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "Q91ZQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZQ1" } ] } ] }, { "uniprot_ac": "Q922S4", "gene_name": "Pde2a", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q922S4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922S4" } ] }, { "ec_number": "3.1.4.17", "activity": "a nucleoside 3',5'-cyclic phosphate + H2O = a nucleoside 5'-phosphate + H(+).", "evidence": [ { "id": "Q922S4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922S4" } ] }, { "ec_number": "3.1.4.17", "activity": "", "evidence": [ { "id": "Q922S4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922S4" } ] } ] }, { "uniprot_ac": "Q924C3", "gene_name": "Enpp1", "activity": [ { "ec_number": "3.1.4.1", "activity": "Hydrolytically removes 5'-nucleotides successively from the 3'-hydroxy termini of 3'-hydroxy-terminated oligonucleotides.", "evidence": [ { "id": "Q924C3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q924C3" } ] }, { "ec_number": "3.6.1.9", "activity": "CTP + H2O = CMP + diphosphate + H(+).", "evidence": [ { "id": "Q924C3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q924C3" } ] } ] }, { "uniprot_ac": "Q9HCR9", "gene_name": "PDE11A", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q9HCR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HCR9" } ] }, { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "Q9HCR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HCR9" } ] }, { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "Q9HCR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HCR9" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "Q9HCR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HCR9" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "Q9HCR9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HCR9" } ] } ] }, { "uniprot_ac": "Q9I7S6", "gene_name": "Pde9", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q9I7S6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9I7S6" } ] }, { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "Q9I7S6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9I7S6" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "Q9I7S6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9I7S6" } ] } ] }, { "uniprot_ac": "Q9NP56", "gene_name": "PDE7B", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q9NP56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NP56" } ] }, { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "Q9NP56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NP56" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "Q9NP56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NP56" } ] } ] }, { "uniprot_ac": "Q9QXQ1", "gene_name": "Pde7b", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q9QXQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXQ1" } ] }, { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "Q9QXQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXQ1" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "Q9QXQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXQ1" } ] } ] }, { "uniprot_ac": "Q9QYJ6", "gene_name": "Pde10a", "activity": [ { "ec_number": "3.1.4.17", "activity": "a nucleoside 3',5'-cyclic phosphate + H2O = a nucleoside 5'-phosphate + H(+).", "evidence": [ { "id": "Q9QYJ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYJ6" } ] }, { "ec_number": "3.1.4.17", "activity": "", "evidence": [ { "id": "Q9QYJ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYJ6" } ] }, { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q9QYJ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYJ6" } ] } ] }, { "uniprot_ac": "Q9VFI9", "gene_name": "Pde6", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q9VFI9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VFI9" } ] }, { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "Q9VFI9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VFI9" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "Q9VFI9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VFI9" } ] } ] }, { "uniprot_ac": "Q9VJ79", "gene_name": "Pde11", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q9VJ79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ79" } ] }, { "ec_number": "3.1.4.35", "activity": "3',5'-cyclic GMP + H2O = GMP + H(+).", "evidence": [ { "id": "Q9VJ79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ79" } ] }, { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "Q9VJ79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ79" } ] }, { "ec_number": "3.1.4.35", "activity": "", "evidence": [ { "id": "Q9VJ79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ79" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "Q9VJ79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ79" } ] } ] }, { "uniprot_ac": "Q9W4T4", "gene_name": "dnc", "activity": [ { "ec_number": "3.1.4.53", "activity": "3',5'-cyclic AMP + H2O = AMP + H(+).", "evidence": [ { "id": "Q9W4T4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W4T4" } ] }, { "ec_number": "3.1.4.53", "activity": "", "evidence": [ { "id": "Q9W4T4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W4T4" } ] }, { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q9W4T4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W4T4" } ] } ] }, { "uniprot_ac": "Q9Y233", "gene_name": "PDE10A", "activity": [ { "ec_number": "3.1.4.17", "activity": "a nucleoside 3',5'-cyclic phosphate + H2O = a nucleoside 5'-phosphate + H(+).", "evidence": [ { "id": "Q9Y233", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y233" } ] }, { "ec_number": "3.1.4.17", "activity": "", "evidence": [ { "id": "Q9Y233", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y233" } ] } ] }, { "uniprot_ac": "Q9Z0X4", "gene_name": "Pde3a", "activity": [ { "ec_number": "3.1.4.17", "activity": "a nucleoside 3',5'-cyclic phosphate + H2O = a nucleoside 5'-phosphate + H(+).", "evidence": [ { "id": "Q9Z0X4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0X4" } ] }, { "ec_number": "3.1.4.17", "activity": "", "evidence": [ { "id": "Q9Z0X4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0X4" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [ 101, 141, 277 ], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 101, "end_pos": 103 }, { "start_pos": 141, "end_pos": 143 }, { "start_pos": 277, "end_pos": 279 }, { "start_pos": 363, "end_pos": 365 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }