{ "uniprot_canonical_ac": "P11976-1", "uniprot_ac": "P11976", "uniprot_id": "PSTA_DICDI", "mass": { "chemical_mass": 109370.0, "monoisotopic_mass": 109370.0 }, "refseq": { "ac": "XP_646785", "name": "extracellular matrix protein ST310", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_646785" }, "gene_names": [ { "name": "ecmB", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P11976", "id": "P11976" }, { "name": "DDB_G0269132", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P11976", "id": "P11976" }, { "name": "ecmB", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_646785", "id": "XP_646785" } ], "protein_names": [ { "name": "Prestalk protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P11976" }, { "name": "Extracellular matrix protein ST310", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P11976" }, { "name": "extracellular matrix protein ST310", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_646785", "id": "XP_646785" } ], "function": [ { "annotation": "Component of the stalk tube, the matrix that encases stalk cells.", "evidence": [ { "database": "UniProtKB", "id": "P11976", "url": "https://www.uniprot.org/uniprot/P11976#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "P11976", "url": "https://www.uniprot.org/uniprot/P11976" } ], "common_name": "Cellular slime molds" } ], "gene": [ { "name": "ecmB", "url": "https://www.uniprot.org/uniprot/P11976", "locus": {} } ], "crossref": [ { "id": "DDB_G0269132", "url": "http://dictybase.org/gene/DDB_G0269132", "database": "dictyBase", "categories": [ "Organism-specific" ] }, { "id": "8617758", "url": "https://www.ncbi.nlm.nih.gov/gene/8617758", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001673", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001673", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0269132", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0269132", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "CTEDKCT", "url": "https://omabrowser.org/oma/group/CTEDKCT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR31797", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR31797", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR31797:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR31797:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00526", "url": "http://pfam.xfam.org/family/PF00526", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_P11976", "url": "http://purl.obolibrary.org/obo/PR_P11976", "database": "PRO", "categories": [ "Protein" ] }, { "id": "XP_646785", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_646785", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P11976", "url": "https://www.uniprot.org/uniprot/P11976", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P11976-1", "url": "https://www.uniprot.org/uniprot/P11976-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNKIYLILILFTFVGIILANVEKAEVSCTCDENCNDGNKCTLDKCNNGCCSNTPININDNDECTVDTCNPKTGISHTPVNCDDGNSCTADSCLCGKGCQHVPIACDDNNACTVDSCSNSTGCCHTPLSCDDNNPCTVDSCSNSTGCCHTPINVDDHNACTEDKCTQSGGVTHTPIACDDKNACTVDSCSNSTGCCHTPLSCDDNNACTVDSCSNSTGCVHTPINVDDHNACTEDKCTQSGGVTHTPIACDDKNACTADSCSNSTGCCHTPITCDDNNACTVDSCSNSTGCCHTPINVDDNNACTEDKCTQSGGVTHTPIACDDKNACTVDSCSNSTGCVHTPLACDDKNPCTVDSCSNSTGCCHTPINVDDNNACTEDKCTQSGGVTHTPINCDDNNKCTVDSCSNSTGCCHTPMSCDDNNPCTVDSCSNSTGCVHTPINVDDNNACTEDKCTQNGGVTHTPIACDDKNACTVDSCSNSTGCCHTPLKCDDNNACTVDSCSNSTGCVHTPINVDDNNACTEDKCTQSGGVTHTPISCDDKNPCTIDSCSNSTGCVHTPMSCDDRNPCTSDFCSWEKGCQHVALSCNDFNACTMDSCSNSTGCTHTPIACDDKNACTVDSCSNSTGCVHTPLTCDDNNPCTVDSCSNSTGCCHTPINVDDHNACTEDKCTQSGGVTHTPIACDDKNACTVDSCSNSTGCCHTPLSCDDNNACTVDSCSNSTGCVHTPINVDDNNACTEDKCTQNGGVTHTPIACDDKNACTVDSCSNSTGCCHTPLKCDDNNPCTVDSCSNSTGCVHTPMNVDDNNACTEDKCTQNGGVTHTPIRCDDLNSCTADSCSNSTGCVHTPINCDDNNKCTADSCSNSTGCCHTPISCDDNNPCTVDSCSNSTGCCHTPINVDDNNPCTEDKCTQSGGVTHTPIGCNDNNACTVDSCSNSTGCTHTPMKCDDNNPCTIDSCSNSTGCVHTPMNCDDGNFCTLDSCCSTGCTHTPIIIDDNNPCTVDSCCNSTGVVHTPVDCNDNNVLTCDYCSIKQGGKCIHVPMTQCKTFGKCGDDL", "length": 1053, "header": "sp|P11976-1|PSTA_DICDI Isoform 1 of Prestalk protein OS=Dictyostelium discoideum OX=44689 GN=ecmB PE=2 SV=2 CANONICAL=P11976-1" }, "isoforms": [ { "isoform_ac": "P11976-1", "url": "", "sequence": { "sequence": "MNKIYLILILFTFVGIILANVEKAEVSCTCDENCNDGNKCTLDKCNNGCCSNTPININDNDECTVDTCNPKTGISHTPVNCDDGNSCTADSCLCGKGCQHVPIACDDNNACTVDSCSNSTGCCHTPLSCDDNNPCTVDSCSNSTGCCHTPINVDDHNACTEDKCTQSGGVTHTPIACDDKNACTVDSCSNSTGCCHTPLSCDDNNACTVDSCSNSTGCVHTPINVDDHNACTEDKCTQSGGVTHTPIACDDKNACTADSCSNSTGCCHTPITCDDNNACTVDSCSNSTGCCHTPINVDDNNACTEDKCTQSGGVTHTPIACDDKNACTVDSCSNSTGCVHTPLACDDKNPCTVDSCSNSTGCCHTPINVDDNNACTEDKCTQSGGVTHTPINCDDNNKCTVDSCSNSTGCCHTPMSCDDNNPCTVDSCSNSTGCVHTPINVDDNNACTEDKCTQNGGVTHTPIACDDKNACTVDSCSNSTGCCHTPLKCDDNNACTVDSCSNSTGCVHTPINVDDNNACTEDKCTQSGGVTHTPISCDDKNPCTIDSCSNSTGCVHTPMSCDDRNPCTSDFCSWEKGCQHVALSCNDFNACTMDSCSNSTGCTHTPIACDDKNACTVDSCSNSTGCVHTPLTCDDNNPCTVDSCSNSTGCCHTPINVDDHNACTEDKCTQSGGVTHTPIACDDKNACTVDSCSNSTGCCHTPLSCDDNNACTVDSCSNSTGCVHTPINVDDNNACTEDKCTQNGGVTHTPIACDDKNACTVDSCSNSTGCCHTPLKCDDNNPCTVDSCSNSTGCVHTPMNVDDNNACTEDKCTQNGGVTHTPIRCDDLNSCTADSCSNSTGCVHTPINCDDNNKCTADSCSNSTGCCHTPISCDDNNPCTVDSCSNSTGCCHTPINVDDNNPCTEDKCTQSGGVTHTPIGCNDNNACTVDSCSNSTGCTHTPMKCDDNNPCTIDSCSNSTGCVHTPMNCDDGNFCTLDSCCSTGCTHTPIIIDDNNPCTVDSCCNSTGVVHTPVDCNDNNVLTCDYCSIKQGGKCIHVPMTQCKTFGKCGDDL", "length": 1053, "header": "sp|P11976-1|PSTA_DICDI Isoform 1 of Prestalk protein OS=Dictyostelium discoideum OX=44689 GN=ecmB PE=2 SV=2 CANONICAL=P11976-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Eichinger L, Pachebat J A, Gl\u00f6ckner G, Rajandream M-A, Sucgang R, Berriman M, Song J, Olsen R, Szafranski K, Xu Q, Tunggal B, Kummerfeld S, Madera M, Konfortov B A, Rivero F, Bankier A T, Lehmann R, Hamlin N, Davies R, Gaudet P, Fey P, Pilcher K, Chen G, Saunders D, Sodergren E, Davis P, Kerhornou A, Nie X, Hall N, Anjard C, Hemphill L, Bason N, Farbrother P, Desany B, Just E, Morio T, Rost R, Churcher C, Cooper J, Haydock S, van Driessche N, Cronin A, Goodhead I, Muzny D, Mourier T, Pain A, Lu M, Harper D, Lindsay R, Hauser H, James K, Quiles M, Madan Babu M, Saito T, Buchrieser C, Wardroper A, Felder M, Thangavelu M, Johnson D, Knights A, Loulseged H, Mungall K, Oliver K, Price C, Quail M A, Urushihara H, Hernandez J, Rabbinowitsch E, Steffen D, Sanders M, Ma J, Kohara Y, Sharp S, Simmonds M, Spiegler S, Tivey A, Sugano S, White B, Walker D, Woodward J, Winckler T, Tanaka Y, Shaulsky G, Schleicher M, Weinstock G, Rosenthal A, Cox E C, Chisholm R L, Gibbs R, Loomis W F, Platzer M, Kay R R, Williams J, Dear P H, Noegel A A, Barrell B, Kuspa A", "evidence": [ { "database": "UniProtKB", "id": "P11976", "url": "https://www.uniprot.org/uniprot/P11976" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] }, { "title": "Developmental regulation of DNase I-hypersensitive sites in Dictyostelium discoideum.", "journal": "Mol. Cell. Biol.", "date": "1987", "authors": "Ayres K, Neuman W, Rowekamp W G, Chung S", "evidence": [ { "database": "UniProtKB", "id": "P11976", "url": "https://www.uniprot.org/uniprot/P11976" } ], "reference": [ { "type": "PubMed", "id": "3600646", "url": "https://glygen.org/publication/PubMed/3600646" } ] }, { "title": "Structural and functional characterization of a Dictyostelium gene encoding a DIF inducible, prestalk-enriched mRNA sequence.", "journal": "Nucleic Acids Res.", "date": "1987", "authors": "Ceccarelli A, McRobbie S J, Jermyn K A, Duffy K, Early A, Williams J G", "evidence": [ { "database": "UniProtKB", "id": "P11976", "url": "https://www.uniprot.org/uniprot/P11976" } ], "reference": [ { "type": "PubMed", "id": "3658700", "url": "https://glygen.org/publication/PubMed/3658700" } ] } ], "pathway": [ { "id": "ddi:DDB_G0269132", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0269132", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P11976", "url": "https://www.uniprot.org/uniprot/P11976" } ], "pmid": "" }, { "name": "extracellular matrix", "id": "GO:0031012", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031012", "evidence": [ { "database": "UniProtKB", "id": "P11976", "url": "https://www.uniprot.org/uniprot/P11976" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "extracellular matrix organization", "id": "GO:0030198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030198", "evidence": [ { "database": "UniProtKB", "id": "P11976", "url": "https://www.uniprot.org/uniprot/P11976" } ], "pmid": "" }, { "name": "culmination involved in sorocarp development", "id": "GO:0031154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031154", "evidence": [ { "database": "UniProtKB", "id": "P11976", "url": "https://www.uniprot.org/uniprot/P11976" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "structural molecule activity", "id": "GO:0005198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005198", "evidence": [ { "database": "UniProtKB", "id": "P11976", "url": "https://www.uniprot.org/uniprot/P11976" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 1005, "end_pos": 1007, "annotation": "n_glycosylation_sequon" }, { "start_pos": 118, "end_pos": 120, "annotation": "n_glycosylation_sequon" }, { "start_pos": 142, "end_pos": 144, "annotation": "n_glycosylation_sequon" }, { "start_pos": 190, "end_pos": 192, "annotation": "n_glycosylation_sequon" }, { "start_pos": 214, "end_pos": 216, "annotation": "n_glycosylation_sequon" }, { "start_pos": 262, "end_pos": 264, "annotation": "n_glycosylation_sequon" }, { "start_pos": 286, "end_pos": 288, "annotation": "n_glycosylation_sequon" }, { "start_pos": 334, "end_pos": 336, "annotation": "n_glycosylation_sequon" }, { "start_pos": 358, "end_pos": 360, "annotation": "n_glycosylation_sequon" }, { "start_pos": 406, "end_pos": 408, "annotation": "n_glycosylation_sequon" }, { "start_pos": 430, "end_pos": 432, "annotation": "n_glycosylation_sequon" }, { "start_pos": 478, "end_pos": 480, "annotation": "n_glycosylation_sequon" }, { "start_pos": 502, "end_pos": 504, "annotation": "n_glycosylation_sequon" }, { "start_pos": 550, "end_pos": 552, "annotation": "n_glycosylation_sequon" }, { "start_pos": 598, "end_pos": 600, "annotation": "n_glycosylation_sequon" }, { "start_pos": 622, "end_pos": 624, "annotation": "n_glycosylation_sequon" }, { "start_pos": 646, "end_pos": 648, "annotation": "n_glycosylation_sequon" }, { "start_pos": 694, "end_pos": 696, "annotation": "n_glycosylation_sequon" }, { "start_pos": 718, "end_pos": 720, "annotation": "n_glycosylation_sequon" }, { "start_pos": 766, "end_pos": 768, "annotation": "n_glycosylation_sequon" }, { "start_pos": 790, "end_pos": 792, "annotation": "n_glycosylation_sequon" }, { "start_pos": 838, "end_pos": 840, "annotation": "n_glycosylation_sequon" }, { "start_pos": 862, "end_pos": 864, "annotation": "n_glycosylation_sequon" }, { "start_pos": 886, "end_pos": 888, "annotation": "n_glycosylation_sequon" }, { "start_pos": 934, "end_pos": 936, "annotation": "n_glycosylation_sequon" }, { "start_pos": 958, "end_pos": 960, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 1005, "end_pos": 1007 }, { "start_pos": 118, "end_pos": 120 }, { "start_pos": 142, "end_pos": 144 }, { "start_pos": 190, "end_pos": 192 }, { "start_pos": 214, "end_pos": 216 }, { "start_pos": 262, "end_pos": 264 }, { "start_pos": 286, "end_pos": 288 }, { "start_pos": 334, "end_pos": 336 }, { "start_pos": 358, "end_pos": 360 }, { "start_pos": 406, "end_pos": 408 }, { "start_pos": 430, "end_pos": 432 }, { "start_pos": 478, "end_pos": 480 }, { "start_pos": 502, "end_pos": 504 }, { "start_pos": 550, "end_pos": 552 }, { "start_pos": 598, "end_pos": 600 }, { "start_pos": 622, "end_pos": 624 }, { "start_pos": 646, "end_pos": 648 }, { "start_pos": 694, "end_pos": 696 }, { "start_pos": 718, "end_pos": 720 }, { "start_pos": 766, "end_pos": 768 }, { "start_pos": 790, "end_pos": 792 }, { "start_pos": 838, "end_pos": 840 }, { "start_pos": 862, "end_pos": 864 }, { "start_pos": 886, "end_pos": 888 }, { "start_pos": 934, "end_pos": 936 }, { "start_pos": 958, "end_pos": 960 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }