{ "uniprot_canonical_ac": "P11940-1", "uniprot_ac": "P11940", "uniprot_id": "PABP1_HUMAN", "mass": { "chemical_mass": 70671.0, "monoisotopic_mass": 70671.0 }, "refseq": { "ac": "NP_002559", "name": "polyadenylate-binding protein 1", "summary": "This gene encodes a poly(A) binding protein. The protein shuttles between the nucleus and cytoplasm and binds to the 3' poly(A) tail of eukaryotic messenger RNAs via RNA-recognition motifs. The binding of this protein to poly(A) promotes ribosome recruitment and translation initiation; it is also required for poly(A) shortening which is the first step in mRNA decay. The gene is part of a small gene family including three protein-coding genes and several pseudogenes.[provided by RefSeq, Aug 2010].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002559" }, "gene_names": [ { "name": "PABPC1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P11940", "id": "P11940" }, { "name": "PAB1; PABP; PABP1; PABPC2; PABPL1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002559", "id": "NP_002559" }, { "name": "PAB1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P11940", "id": "P11940" }, { "name": "PABP1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P11940", "id": "P11940" }, { "name": "PABPC1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002559", "id": "NP_002559" }, { "name": "PABPC2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P11940", "id": "P11940" }, { "name": "PABP", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P11940", "id": "P11940" }, { "name": "hCG_15683", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P11940", "id": "P11940" } ], "protein_names": [ { "name": "Polyadenylate-binding protein 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P11940" }, { "name": "PABP-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P11940" }, { "name": "Poly(A)-binding protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P11940" }, { "name": "poly(A) binding protein, cytoplasmic 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002559", "id": "NP_002559" }, { "name": "polyadenylate-binding protein 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002559", "id": "NP_002559" } ], "function": [ { "annotation": "(Microbial infection) Positively regulates the replication of dengue virus (DENV).", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940#function" }, { "database": "PubMed", "id": "26735137", "url": "https://glygen.org/publication/PubMed/26735137" } ] }, { "annotation": "A complex with poly(A)-binding protein and EWS facilitates the transcriptional function of oncogenic ETS transcription factors in prostate cells.", "evidence": [ { "database": "RefSeq", "id": "NP_002559", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002559" }, { "database": "PubMed", "id": "37956771", "url": "https://glygen.org/publication/PubMed/37956771" } ] }, { "annotation": "Binds the poly(A) tail of mRNA, including that of its own transcript, and regulates processes of mRNA metabolism such as pre-mRNA splicing and mRNA stability (PubMed:11051545, PubMed:17212783, PubMed:25480299). Its function in translational initiation regulation can either be enhanced by PAIP1 or repressed by PAIP2 (PubMed:11051545, PubMed:20573744). Can probably bind to cytoplasmic RNA sequences other than poly(A) in vivo. Binds to N6-methyladenosine (m6A)-containing mRNAs and contributes to MYC stability by binding to m6A-containing MYC mRNAs (PubMed:32245947). Involved in translationally coupled mRNA turnover (PubMed:11051545). Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain (PubMed:11051545). Involved in regulation of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons; for the recognition of premature termination codons (PTC) and initiation of NMD a competitive interaction between UPF1 and PABPC1 with the ribosome-bound release factors is proposed (PubMed:18447585). By binding to long poly(A) tails, may protect them from uridylation by ZCCHC6/ZCCHC11 and hence contribute to mRNA stability (PubMed:25480299).", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940#function" }, { "database": "PubMed", "id": "17212783", "url": "https://glygen.org/publication/PubMed/17212783" }, { "database": "PubMed", "id": "25480299", "url": "https://glygen.org/publication/PubMed/25480299" }, { "database": "PubMed", "id": "20573744", "url": "https://glygen.org/publication/PubMed/20573744" }, { "database": "PubMed", "id": "18447585", "url": "https://glygen.org/publication/PubMed/18447585" }, { "database": "PubMed", "id": "32245947", "url": "https://glygen.org/publication/PubMed/32245947" }, { "database": "PubMed", "id": "11051545", "url": "https://glygen.org/publication/PubMed/11051545" } ] }, { "annotation": "Binds the poly(A) tail of mRNA.", "evidence": [ { "database": "UniProtKB", "id": "A0A7I2V4N4", "url": "https://www.uniprot.org/uniprot/A0A7I2V4N4#function" }, { "database": "UniProtKB", "id": "RU362004", "url": "https://www.uniprot.org/uniprot/RU362004#function" }, { "database": "UniProtKB", "id": "E7EQV3", "url": "https://www.uniprot.org/uniprot/E7EQV3#function" }, { "database": "UniProtKB", "id": "A0A7I2YQ88", "url": "https://www.uniprot.org/uniprot/A0A7I2YQ88#function" }, { "database": "UniProtKB", "id": "E7ERJ7", "url": "https://www.uniprot.org/uniprot/E7ERJ7#function" }, { "database": "UniProtKB", "id": "A0A7I2YQE4", "url": "https://www.uniprot.org/uniprot/A0A7I2YQE4#function" }, { "database": "UniProtKB", "id": "A0A087WTT1", "url": "https://www.uniprot.org/uniprot/A0A087WTT1#function" }, { "database": "UniProtKB", "id": "H0YAR2", "url": "https://www.uniprot.org/uniprot/H0YAR2#function" } ] }, { "annotation": "Nonsense-mediated decay-sensitive mRNA can be stabilized by tethering the cytoplasmic poly(A) binding protein 1, PABPC1, at a premature termination codon-proximal position.", "evidence": [ { "database": "RefSeq", "id": "NP_002559", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002559" }, { "database": "PubMed", "id": "18230761", "url": "https://glygen.org/publication/PubMed/18230761" } ] }, { "annotation": "The poly(A) nuclease interacts with the C-terminal domain of polyadenylate-binding protein domain from poly(A)-binding protein", "evidence": [ { "database": "RefSeq", "id": "NP_002559", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002559" }, { "database": "PubMed", "id": "17595167", "url": "https://glygen.org/publication/PubMed/17595167" } ] }, { "annotation": "This gene encodes a poly(A) binding protein. The protein shuttles between the nucleus and cytoplasm and binds to the 3' poly(A) tail of eukaryotic messenger RNAs via RNA-recognition motifs. The binding of this protein to poly(A) promotes ribosome recruitment and translation initiation; it is also required for poly(A) shortening which is the first step in mRNA decay. The gene is part of a small gene family including three protein-coding genes and several pseudogenes.[provided by RefSeq, Aug 2010].", "evidence": [ { "database": "RefSeq", "id": "NP_002559", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002559" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs199922140", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199922140" }, { "id": "rs199922140", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199922140" }, { "id": "rs199922140", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs199922140" }, { "id": "rs1587163082", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1587163082" }, { "id": "rs1587163082", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1587163082" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 114, "end_pos": 114, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NKA->NKT).", "chr_id": "8", "chr_pos": "100718134", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A114", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs202060459", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs202060459" }, { "id": "rs202060459", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs202060459" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 319, "end_pos": 319, "sequence_org": "T", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "8", "chr_pos": "100712378", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T319", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs1306469527", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1306469527" }, { "id": "rs1306469527", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1306469527" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 321, "end_pos": 321, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "8", "chr_pos": "100712373", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T321", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1407275734", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1407275734" }, { "id": "rs1407275734", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1407275734" }, { "id": "rs1407275734", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1407275734" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 321, "end_pos": 321, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->N).", "chr_id": "8", "chr_pos": "100712372", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T321", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1367431990", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1367431990" }, { "id": "rs1367431990", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1367431990" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 3, "end_pos": 3, "sequence_org": "P", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPS->NLS).", "chr_id": "8", "chr_pos": "100706772", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P3", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1563617987", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1563617987" }, { "id": "rs1563617987", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1563617987" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 3, "end_pos": 3, "sequence_org": "P", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPS->NRS).", "chr_id": "8", "chr_pos": "100721576", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P3", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1331177906", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1331177906" }, { "id": "rs1331177906", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1331177906" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 420, "end_pos": 420, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NRA->NRT).", "chr_id": "8", "chr_pos": "100709211", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A420", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1313986975", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1313986975" }, { "id": "rs1313986975", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1313986975" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 451, "end_pos": 451, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NMP->NMS).", "chr_id": "8", "chr_pos": "100706983", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P451", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs779435514", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779435514" }, { "id": "rs779435514", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779435514" }, { "id": "rs779435514", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs779435514" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 629, "end_pos": 629, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SAT->NAT).", "chr_id": "8", "chr_pos": "100704323", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S629", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs751188307", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751188307" }, { "id": "rs751188307", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751188307" }, { "id": "rs751188307", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs751188307#frequency_tab" }, { "id": "rs751188307", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751188307" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 635, "end_pos": 635, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "8", "chr_pos": "100704306", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T635", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs188860673", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs188860673" }, { "id": "rs188860673", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs188860673" }, { "id": "rs188860673", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs188860673" }, { "id": "rs188860673", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs188860673#frequency_tab" }, { "id": "rs188860673", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs188860673" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 635, "end_pos": 635, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "8", "chr_pos": "100704305", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T635", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 455, "end_pos": 455, "sequence_org": "R", "sequence_mut": "A", "comment": "Greatly reduces methylation by CARM1 (in vitro); when associated with A-460.", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" }, { "database": "PubMed", "id": "11850402", "url": "https://glygen.org/publication/PubMed/11850402" } ] }, { "start_pos": 460, "end_pos": 460, "sequence_org": "R", "sequence_mut": "A", "comment": "Greatly reduces methylation by CARM1 (in vitro); when associated with A-455.", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" }, { "database": "PubMed", "id": "11850402", "url": "https://glygen.org/publication/PubMed/11850402" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "99.17", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000070756", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000070756" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "99.79", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000070756", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000070756" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "99.51", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000070756", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000070756" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "99.36", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000070756", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000070756" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.67", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000070756", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000070756" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "99.76", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000070756", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000070756" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "99.05", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000070756", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000070756" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "99.8", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000070756", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000070756" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "99.53", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000070756", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000070756" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "99.38", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000070756", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000070756" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "99.21", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000070756", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000070756" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "99.68", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000070756", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000070756" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "99.73", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000070756", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000070756" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P11940", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11940" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P11940", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11940" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P11940", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11940" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P11940", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11940" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P11940", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11940" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P11940", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11940" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P11940", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11940" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P11940", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11940" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P11940", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11940" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P11940", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11940" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P11940", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11940" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P11940", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11940" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "common_name": "Human" } ], "gene": [ { "name": "PABPC1", "url": "https://www.uniprot.org/uniprot/P11940", "locus": { "chromosome": "8", "start_pos": 100685816, "end_pos": 100722809, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000070756", "url": "https://www.ensembl.org/id/ENSG00000070756" } ] } } ], "crossref": [ { "id": "ENSG00000070756", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000070756", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd12378", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12378", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd12379", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12379", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd12380", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12380", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd12381", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12381", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL1293286", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1293286", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "PABPC1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PABPC1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "26986", "url": "https://www.ncbi.nlm.nih.gov/gene/26986", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "8554", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=8554", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "A0A087WTT1", "url": "https://www.ebi.ac.uk/intact/interactors/id:A0A087WTT1*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "E7ERJ7", "url": "https://www.ebi.ac.uk/intact/interactors/id:E7ERJ7*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "P11940", "url": "https://www.ebi.ac.uk/intact/interactors/id:P11940*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000504", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000504", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002004", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002004", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003954", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003954", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006515", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006515", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012677", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012677", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034364", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034364", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035979", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035979", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036053", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036053", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045305", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045305", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:26986", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:26986", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "604679", "url": "http://www.omim.org/entry/604679", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P11940", "url": "https://www.nextprot.org/entry/NX_P11940", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P11940", "url": "https://oglcnac.org/atlas/detail/P11940", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P11940", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11940", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "QKDMRIR", "url": "https://omabrowser.org/oma/group/QKDMRIR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "21912at2759", "url": "http://www.orthodb.org/?query=21912at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24012", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24012", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24012:SF409", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24012:SF409", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24012:SF455", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24012:SF455", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46276", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46276", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46276:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46276:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR48024", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48024", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR48024:SF29", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48024:SF29", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR48027", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48027", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR48027:SF9", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48027:SF9", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1CVJ", "url": "https://www.rcsb.org/structure/1CVJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1G9L", "url": "https://www.rcsb.org/structure/1G9L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1JGN", "url": "https://www.rcsb.org/structure/1JGN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1JH4", "url": "https://www.rcsb.org/structure/1JH4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2K8G", "url": "https://www.rcsb.org/structure/2K8G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2RQG", "url": "https://www.rcsb.org/structure/2RQG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2RQH", "url": "https://www.rcsb.org/structure/2RQH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2X04", "url": "https://www.rcsb.org/structure/2X04", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KTP", "url": "https://www.rcsb.org/structure/3KTP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KTR", "url": "https://www.rcsb.org/structure/3KTR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KUI", "url": "https://www.rcsb.org/structure/3KUI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KUJ", "url": "https://www.rcsb.org/structure/3KUJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KUR", "url": "https://www.rcsb.org/structure/3KUR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KUS", "url": "https://www.rcsb.org/structure/3KUS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KUT", "url": "https://www.rcsb.org/structure/3KUT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3PKN", "url": "https://www.rcsb.org/structure/3PKN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3PTH", "url": "https://www.rcsb.org/structure/3PTH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4F02", "url": "https://www.rcsb.org/structure/4F02", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4F25", "url": "https://www.rcsb.org/structure/4F25", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4F26", "url": "https://www.rcsb.org/structure/4F26", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5DX1", "url": "https://www.rcsb.org/structure/5DX1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5DX8", "url": "https://www.rcsb.org/structure/5DX8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5DXA", "url": "https://www.rcsb.org/structure/5DXA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LGP", "url": "https://www.rcsb.org/structure/5LGP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LGQ", "url": "https://www.rcsb.org/structure/5LGQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LGR", "url": "https://www.rcsb.org/structure/5LGR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LGS", "url": "https://www.rcsb.org/structure/5LGS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7BN3", "url": "https://www.rcsb.org/structure/7BN3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00076", "url": "http://pfam.xfam.org/family/PF00076", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00658", "url": "http://pfam.xfam.org/family/PF00658", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P11940", "url": "https://pharos.nih.gov/targets/P11940", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P11940", "url": "http://purl.obolibrary.org/obo/PR_P11940", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-156827", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156827", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-450408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450408", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-72649", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72649", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9010553", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9010553", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-975956", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975956", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9820841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9820841", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9820865", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9820865", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_002559", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002559", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A087WTT1", "url": "https://www.uniprot.org/uniprot/A0A087WTT1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WTT1-1", "url": "https://www.uniprot.org/uniprot/A0A087WTT1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3J9", "url": "https://www.uniprot.org/uniprot/A0A7I2V3J9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3J9-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3J9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4N4", "url": "https://www.uniprot.org/uniprot/A0A7I2V4N4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4N4-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V4N4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V649", "url": "https://www.uniprot.org/uniprot/A0A7I2V649", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V649-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V649-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQ88", "url": "https://www.uniprot.org/uniprot/A0A7I2YQ88", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQ88-1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQ88-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQ90", "url": "https://www.uniprot.org/uniprot/A0A7I2YQ90", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQ90-1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQ90-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQE4", "url": "https://www.uniprot.org/uniprot/A0A7I2YQE4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQE4-1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQE4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RFD8", "url": "https://www.uniprot.org/uniprot/E5RFD8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RFD8-1", "url": "https://www.uniprot.org/uniprot/E5RFD8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RGC4", "url": "https://www.uniprot.org/uniprot/E5RGC4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RGC4-1", "url": "https://www.uniprot.org/uniprot/E5RGC4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RGH3", "url": "https://www.uniprot.org/uniprot/E5RGH3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RGH3-1", "url": "https://www.uniprot.org/uniprot/E5RGH3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RH24", "url": "https://www.uniprot.org/uniprot/E5RH24", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RH24-1", "url": "https://www.uniprot.org/uniprot/E5RH24-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RHG7", "url": "https://www.uniprot.org/uniprot/E5RHG7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RHG7-1", "url": "https://www.uniprot.org/uniprot/E5RHG7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RJB9", "url": "https://www.uniprot.org/uniprot/E5RJB9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RJB9-1", "url": "https://www.uniprot.org/uniprot/E5RJB9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RJM8", "url": "https://www.uniprot.org/uniprot/E5RJM8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RJM8-1", "url": "https://www.uniprot.org/uniprot/E5RJM8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EQV3", "url": "https://www.uniprot.org/uniprot/E7EQV3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EQV3-1", "url": "https://www.uniprot.org/uniprot/E7EQV3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7ERJ7", "url": "https://www.uniprot.org/uniprot/E7ERJ7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7ERJ7-1", "url": "https://www.uniprot.org/uniprot/E7ERJ7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YAP2", "url": "https://www.uniprot.org/uniprot/H0YAP2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YAP2-1", "url": "https://www.uniprot.org/uniprot/H0YAP2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YAR2", "url": "https://www.uniprot.org/uniprot/H0YAR2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YAR2-1", "url": "https://www.uniprot.org/uniprot/H0YAR2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YAS6", "url": "https://www.uniprot.org/uniprot/H0YAS6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YAS6-1", "url": "https://www.uniprot.org/uniprot/H0YAS6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YAS7", "url": "https://www.uniprot.org/uniprot/H0YAS7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YAS7-1", "url": "https://www.uniprot.org/uniprot/H0YAS7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YAW6", "url": "https://www.uniprot.org/uniprot/H0YAW6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YAW6-1", "url": "https://www.uniprot.org/uniprot/H0YAW6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YB75", "url": "https://www.uniprot.org/uniprot/H0YB75", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YB75-1", "url": "https://www.uniprot.org/uniprot/H0YB75-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YB86", "url": "https://www.uniprot.org/uniprot/H0YB86", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YB86-1", "url": "https://www.uniprot.org/uniprot/H0YB86-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YBN4", "url": "https://www.uniprot.org/uniprot/H0YBN4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YBN4-1", "url": "https://www.uniprot.org/uniprot/H0YBN4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YC10", "url": "https://www.uniprot.org/uniprot/H0YC10", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YC10-1", "url": "https://www.uniprot.org/uniprot/H0YC10-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P11940-1", "url": "https://www.uniprot.org/uniprot/P11940-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P11940-2", "url": "https://www.uniprot.org/uniprot/P11940-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV", "length": 636, "header": "sp|P11940-1|PABP1_HUMAN Isoform 1 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2 CANONICAL=P11940-1" }, "isoforms": [ { "isoform_ac": "A0A087WTT1-1", "url": "", "sequence": { "sequence": "MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV", "length": 588, "header": "tr|A0A087WTT1-1|A0A087WTT1_HUMAN Computationally mapped isoform of Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2 CANONICAL=P11940-1" }, "locus": { "chromosome": "8", "start_pos": 100721583, "end_pos": 100704301, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000610907.2", "url": "https://www.ensembl.org/id/ENST00000610907.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000478108.2", "url": "https://www.ensembl.org/id/ENSP00000478108.2" } ] } }, { "isoform_ac": "A0A7I2V3J9-1", "url": "", "sequence": { "sequence": "MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADGERRAPRSAGRAGGHEARAAAAGGVGRRARGGGREGMSPRDGRREGAGVPGAAFPEPAGTRAAGSHTPGYFLLCDHFLGLRRSQTLG", "length": 151, "header": "tr|A0A7I2V3J9-1|A0A7I2V3J9_HUMAN Computationally mapped isoform of Poly(A) binding protein cytoplasmic 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1 CANONICAL=P11940-1" }, "locus": {} }, { "isoform_ac": "A0A7I2V4N4-1", "url": "", "sequence": { "sequence": "MTRREAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV", "length": 577, "header": "tr|A0A7I2V4N4-1|A0A7I2V4N4_HUMAN Computationally mapped isoform of Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1 CANONICAL=P11940-1" }, "locus": { "chromosome": "8", "start_pos": 100721128, "end_pos": 100704301, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677765.1", "url": "https://www.ensembl.org/id/ENST00000677765.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503838.1", "url": "https://www.ensembl.org/id/ENSP00000503838.1" } ] } }, { "isoform_ac": "A0A7I2V649-1", "url": "", "sequence": { "sequence": "MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV", "length": 590, "header": "tr|A0A7I2V649-1|A0A7I2V649_HUMAN Computationally mapped isoform of Poly(A) binding protein cytoplasmic 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1 CANONICAL=P11940-1" }, "locus": { "chromosome": "8", "start_pos": 100721583, "end_pos": 100704301, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677787.1", "url": "https://www.ensembl.org/id/ENST00000677787.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504835.1", "url": "https://www.ensembl.org/id/ENSP00000504835.1" } ] } }, { "isoform_ac": "A0A7I2YQ88-1", "url": "", "sequence": { "sequence": "MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV", "length": 633, "header": "tr|A0A7I2YQ88-1|PABP1_HUMAN Computationally mapped isoform of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1 CANONICAL=P11940-1" }, "locus": { "chromosome": "8", "start_pos": 100721583, "end_pos": 100704301, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677140.1", "url": "https://www.ensembl.org/id/ENST00000677140.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503044.1", "url": "https://www.ensembl.org/id/ENSP00000503044.1" } ] } }, { "isoform_ac": "A0A7I2YQ90-1", "url": "", "sequence": { "sequence": "MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV", "length": 604, "header": "tr|A0A7I2YQ90-1|A0A7I2YQ90_HUMAN Computationally mapped isoform of Poly(A) binding protein cytoplasmic 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1 CANONICAL=P11940-1" }, "locus": { "chromosome": "8", "start_pos": 100721583, "end_pos": 100704301, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679197.1", "url": "https://www.ensembl.org/id/ENST00000679197.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503058.1", "url": "https://www.ensembl.org/id/ENSP00000503058.1" } ] } }, { "isoform_ac": "A0A7I2YQE4-1", "url": "", "sequence": { "sequence": "MNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV", "length": 565, "header": "tr|A0A7I2YQE4-1|A0A7I2YQE4_HUMAN Computationally mapped isoform of Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1 CANONICAL=P11940-1" }, "locus": { "chromosome": "8", "start_pos": 100718260, "end_pos": 100704301, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677380.1", "url": "https://www.ensembl.org/id/ENST00000677380.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503421.1", "url": "https://www.ensembl.org/id/ENSP00000503421.1" } ] } }, { "isoform_ac": "E5RFD8-1", "url": "", "sequence": { "sequence": "MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQ", "length": 61, "header": "tr|E5RFD8-1|E5RFD8_HUMAN Computationally mapped isoform of Poly(A) binding protein cytoplasmic 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1 CANONICAL=P11940-1" }, "locus": { "chromosome": "8", "start_pos": 100721583, "end_pos": 100721401, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000521067.1", "url": "https://www.ensembl.org/id/ENST00000521067.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000428937.1", "url": "https://www.ensembl.org/id/ENSP00000428937.1" } ] } }, { "isoform_ac": "E5RGC4-1", "url": "", "sequence": { "sequence": "MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVC", "length": 43, "header": "tr|E5RGC4-1|PABP1_HUMAN Computationally mapped isoform of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1 CANONICAL=P11940-1" }, "locus": { "chromosome": "8", "start_pos": 100721583, "end_pos": 100704301, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000520804", "url": "https://www.ensembl.org/id/ENST00000520804" }, { "database": "Ensembl Peptide", "id": "ENSP00000428749", "url": "https://www.ensembl.org/id/ENSP00000428749" } ] } }, { "isoform_ac": "E5RGH3-1", "url": "", "sequence": { "sequence": "MITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAER", "length": 108, "header": "tr|E5RGH3-1|PABP1_HUMAN Computationally mapped isoform of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1 CANONICAL=P11940-1" }, "locus": { "chromosome": "8", "start_pos": 100721448, "end_pos": 100717817, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000518196.5", "url": "https://www.ensembl.org/id/ENST00000518196.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000430159.1", "url": "https://www.ensembl.org/id/ENSP00000430159.1" } ] } }, { "isoform_ac": "E5RH24-1", "url": "", "sequence": { "sequence": "MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDT", "length": 118, "header": "tr|E5RH24-1|E5RH24_HUMAN Computationally mapped isoform of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1 CANONICAL=P11940-1" }, "locus": { "chromosome": "8", "start_pos": 100721583, "end_pos": 100704301, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000520142", "url": "https://www.ensembl.org/id/ENST00000520142" }, { "database": "Ensembl Peptide", "id": "ENSP00000430012", "url": "https://www.ensembl.org/id/ENSP00000430012" } ] } }, { "isoform_ac": "E5RHG7-1", "url": "", "sequence": { "sequence": "MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFD", "length": 75, "header": "tr|E5RHG7-1|E5RHG7_HUMAN Computationally mapped isoform of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1 CANONICAL=P11940-1" }, "locus": { "chromosome": "8", "start_pos": 100721583, "end_pos": 100704301, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000522720", "url": "https://www.ensembl.org/id/ENST00000522720" }, { "database": "Ensembl Peptide", "id": "ENSP00000429790", "url": "https://www.ensembl.org/id/ENSP00000429790" } ] } }, { "isoform_ac": "E5RJB9-1", "url": "", "sequence": { "sequence": "MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCK", "length": 129, "header": "tr|E5RJB9-1|E5RJB9_HUMAN Computationally mapped isoform of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1 CANONICAL=P11940-1" }, "locus": { "chromosome": "8", "start_pos": 100721583, "end_pos": 100704301, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000521865", "url": "https://www.ensembl.org/id/ENST00000521865" }, { "database": "Ensembl Peptide", "id": "ENSP00000429119", "url": "https://www.ensembl.org/id/ENSP00000429119" } ] } }, { "isoform_ac": "E5RJM8-1", "url": "", "sequence": { "sequence": "MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPIL", "length": 38, "header": "tr|E5RJM8-1|E5RJM8_HUMAN Computationally mapped isoform of Poly(A) binding protein cytoplasmic 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1 CANONICAL=P11940-1" }, "locus": { "chromosome": "8", "start_pos": 100721583, "end_pos": 100721470, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000519363.1", "url": "https://www.ensembl.org/id/ENST00000519363.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000429032.1", "url": "https://www.ensembl.org/id/ENSP00000429032.1" } ] } }, { "isoform_ac": "E7EQV3-1", "url": "", "sequence": { "sequence": "MITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV", "length": 591, "header": "tr|E7EQV3-1|PABP1_HUMAN Computationally mapped isoform of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1 CANONICAL=P11940-1" }, "locus": { "chromosome": "8", "start_pos": 100721448, "end_pos": 100704301, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000519004.5", "url": "https://www.ensembl.org/id/ENST00000519004.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000429594.1", "url": "https://www.ensembl.org/id/ENSP00000429594.1" } ] } }, { "isoform_ac": "E7ERJ7-1", "url": "", "sequence": { "sequence": "MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV", "length": 604, "header": "tr|E7ERJ7-1|PABP1_HUMAN Computationally mapped isoform of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1 CANONICAL=P11940-1" }, "locus": { "chromosome": "8", "start_pos": 100721583, "end_pos": 100704301, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000522387.5", "url": "https://www.ensembl.org/id/ENST00000522387.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000429395.1", "url": "https://www.ensembl.org/id/ENSP00000429395.1" } ] } }, { "isoform_ac": "H0YAP2-1", "url": "", "sequence": { "sequence": "XDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKKKPLKQLQK", "length": 131, "header": "tr|H0YAP2-1|H0YAP2_HUMAN Computationally mapped isoform of Poly(A) binding protein cytoplasmic 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1 CANONICAL=P11940-1" }, "locus": { "chromosome": "8", "start_pos": 100715496, "end_pos": 100709645, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000519622.5", "url": "https://www.ensembl.org/id/ENST00000519622.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000427805.1", "url": "https://www.ensembl.org/id/ENSP00000427805.1" } ] } }, { "isoform_ac": "H0YAR2-1", "url": "", "sequence": { "sequence": "MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPNTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV", "length": 599, "header": "tr|H0YAR2-1|H0YAR2_HUMAN Computationally mapped isoform of Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2 CANONICAL=P11940-1" }, "locus": { "chromosome": "8", "start_pos": 100721583, "end_pos": 100704301, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000519100.6", "url": "https://www.ensembl.org/id/ENST00000519100.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000427914.2", "url": "https://www.ensembl.org/id/ENSP00000427914.2" } ] } }, { "isoform_ac": "H0YAS6-1", "url": "", "sequence": { "sequence": "XASSQVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV", "length": 169, "header": "tr|H0YAS6-1|H0YAS6_HUMAN Computationally mapped isoform of Poly(A) binding protein cytoplasmic 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1 CANONICAL=P11940-1" }, "locus": { "chromosome": "8", "start_pos": 100706931, "end_pos": 100704300, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000520868.5", "url": "https://www.ensembl.org/id/ENST00000520868.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000428021.1", "url": "https://www.ensembl.org/id/ENSP00000428021.1" } ] } }, { "isoform_ac": "H0YAS7-1", "url": "", "sequence": { "sequence": "PRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQMLAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV", "length": 136, "header": "tr|H0YAS7-1|H0YAS7_HUMAN Computationally mapped isoform of Poly(A) binding protein cytoplasmic 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1 CANONICAL=P11940-1" }, "locus": { "chromosome": "8", "start_pos": 100706779, "end_pos": 100704301, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000517990.5", "url": "https://www.ensembl.org/id/ENST00000517990.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000428030.1", "url": "https://www.ensembl.org/id/ENSP00000428030.1" } ] } }, { "isoform_ac": "H0YAW6-1", "url": "", "sequence": { "sequence": "XNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQ", "length": 187, "header": "tr|H0YAW6-1|PABP1_HUMAN Computationally mapped isoform of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1 CANONICAL=P11940-1" }, "locus": { "chromosome": "8", "start_pos": 100712761, "end_pos": 100706651, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000517403.5", "url": "https://www.ensembl.org/id/ENST00000517403.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000428190.1", "url": "https://www.ensembl.org/id/ENSP00000428190.1" } ] } }, { "isoform_ac": "H0YB75-1", "url": "", "sequence": { "sequence": "IRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV", "length": 183, "header": "tr|H0YB75-1|H0YB75_HUMAN Computationally mapped isoform of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1 CANONICAL=P11940-1" }, "locus": { "chromosome": "8", "start_pos": 100721583, "end_pos": 100704301, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000522658", "url": "https://www.ensembl.org/id/ENST00000522658" }, { "database": "Ensembl Peptide", "id": "ENSP00000428840", "url": "https://www.ensembl.org/id/ENSP00000428840" } ] } }, { "isoform_ac": "H0YB86-1", "url": "", "sequence": { "sequence": "XRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPCCSCTRSGTFDCFHVGICPSSRAKANVG", "length": 165, "header": "tr|H0YB86-1|PABP1_HUMAN Computationally mapped isoform of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1 CANONICAL=P11940-1" }, "locus": { "chromosome": "8", "start_pos": 100712404, "end_pos": 100705054, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000523636.5", "url": "https://www.ensembl.org/id/ENST00000523636.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000428948.1", "url": "https://www.ensembl.org/id/ENSP00000428948.1" } ] } }, { "isoform_ac": "H0YBN4-1", "url": "", "sequence": { "sequence": "XSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDES", "length": 174, "header": "tr|H0YBN4-1|H0YBN4_HUMAN Computationally mapped isoform of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=8 CANONICAL=P11940-1" }, "locus": { "chromosome": "8", "start_pos": 100721583, "end_pos": 100704301, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000523555", "url": "https://www.ensembl.org/id/ENST00000523555" }, { "database": "Ensembl Peptide", "id": "ENSP00000429892", "url": "https://www.ensembl.org/id/ENSP00000429892" } ] } }, { "isoform_ac": "H0YC10-1", "url": "", "sequence": { "sequence": "XMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV", "length": 42, "header": "tr|H0YC10-1|H0YC10_HUMAN Computationally mapped isoform of Poly(A) binding protein cytoplasmic 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1 CANONICAL=P11940-1" }, "locus": { "chromosome": "8", "start_pos": 100704960, "end_pos": 100704300, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000518293.5", "url": "https://www.ensembl.org/id/ENST00000518293.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000430716.1", "url": "https://www.ensembl.org/id/ENSP00000430716.1" } ] } }, { "isoform_ac": "P11940-1", "url": "", "sequence": { "sequence": "MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV", "length": 636, "header": "sp|P11940-1|PABP1_HUMAN Isoform 1 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2 CANONICAL=P11940-1" }, "locus": { "chromosome": "8", "start_pos": 100721583, "end_pos": 100704301, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000318607.10", "url": "https://www.ensembl.org/id/ENST00000318607.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000313007.5", "url": "https://www.ensembl.org/id/ENSP00000313007.5" } ] } }, { "isoform_ac": "P11940-2", "url": "", "sequence": { "sequence": "MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV", "length": 547, "header": "sp|P11940-2|PABP1_HUMAN Isoform 2 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2 CANONICAL=P11940-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 315, "start_aa": "Ser", "end_pos": 315, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser315", "evidence": [ { "id": "P11940", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11940" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30444036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30444036" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "P11940", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11940" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 319, "start_aa": "Thr", "end_pos": 319, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr319", "evidence": [ { "id": "P11940", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11940" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30444036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30444036" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "P11940", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11940" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 321, "start_aa": "Thr", "end_pos": 321, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr321", "evidence": [ { "id": "P11940", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11940" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 485, "start_aa": "Thr", "end_pos": 485, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr485", "evidence": [ { "id": "P11940", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11940" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30444036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30444036" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 635, "start_aa": "Thr", "end_pos": 635, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr635", "evidence": [ { "id": "P11940", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11940" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30444036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30444036" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "32870666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32870666" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "P11940", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11940" } ] } ], "phosphorylation": [ { "start_pos": 315, "end_pos": 315, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P11940", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11940" }, { "database": "PubMed", "id": "27920218", "url": "" }, { "database": "phospho.ELM", "id": "P11940", "url": "http://phospho.elm.eu.org/byAccession/P11940.html" } ], "site_lbl": "Ser315" }, { "start_pos": 319, "end_pos": 319, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P11940", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11940" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ], "site_lbl": "Thr319" }, { "start_pos": 342, "end_pos": 342, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11940", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11940" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P11940", "url": "http://phospho.elm.eu.org/byAccession/P11940.html" } ], "site_lbl": "Ser342" }, { "start_pos": 364, "end_pos": 364, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11940", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11940" }, { "database": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" }, { "database": "phospho.ELM", "id": "P11940", "url": "http://phospho.elm.eu.org/byAccession/P11940.html" } ], "site_lbl": "Tyr364" }, { "start_pos": 51, "end_pos": 51, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11940", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11940" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "P11940", "url": "http://phospho.elm.eu.org/byAccession/P11940.html" } ], "site_lbl": "Ser51" }, { "start_pos": 54, "end_pos": 54, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11940", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11940" }, { "database": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "P11940", "url": "http://phospho.elm.eu.org/byAccession/P11940.html" } ], "site_lbl": "Tyr54" }, { "start_pos": 591, "end_pos": 591, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11940", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11940" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser591" }, { "start_pos": 599, "end_pos": 599, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11940", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11940" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P11940", "url": "http://phospho.elm.eu.org/byAccession/P11940.html" } ], "site_lbl": "Ser599" }, { "start_pos": 96, "end_pos": 96, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11940", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11940" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "P11940", "url": "http://phospho.elm.eu.org/byAccession/P11940.html" } ], "site_lbl": "Ser96" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Control of mRNA decay by heat shock-ubiquitin-proteasome pathway.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Laroia G, Cuesta R, Brewer G, Schneider RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-450408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450408" } ], "reference": [ { "type": "PubMed", "id": "10205060", "url": "https://glygen.org/publication/PubMed/10205060" } ] }, { "title": "Recognition of polyadenylate RNA by the poly(A)-binding protein.", "journal": "Cell", "date": "1999", "authors": "Deo RC, Bonanno JB, Sonenberg N, Burley SK", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "10499800", "url": "https://glygen.org/publication/PubMed/10499800" } ] }, { "title": "Assembly of AUF1 oligomers on U-rich RNA targets by sequential dimer association.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Wilson GM, Sun Y, Lu H, Brewer G", "evidence": [ { "database": "Reactome", "id": "R-HSA-450408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450408" } ], "reference": [ { "type": "PubMed", "id": "10559216", "url": "https://glygen.org/publication/PubMed/10559216" } ] }, { "title": "Isolation and characterization of human orthologs of yeast CCR4-NOT complex subunits.", "journal": "Nucleic acids research", "date": "2000", "authors": "Albert TK, Lemaire M, van Berkum NL, Gentz R, Collart MA, Timmers HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "10637334", "url": "https://glygen.org/publication/PubMed/10637334" } ] }, { "title": "Interaction between a poly(A)-specific ribonuclease and the 5' cap influences mRNA deadenylation rates in vitro.", "journal": "Molecular cell", "date": "2000", "authors": "Gao M, Fritz DT, Ford LP, Wilusz J", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "10882133", "url": "https://glygen.org/publication/PubMed/10882133" } ] }, { "title": "A mechanism for translationally coupled mRNA turnover: interaction between the poly(A) tail and a c-fos RNA coding determinant via a protein complex.", "journal": "Cell", "date": "2000-09-29", "authors": "Grosset C, Chen C Y, Xu N, Sonenberg N, Jacquemin-Sablon H, Shyu A B", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "11051545", "url": "https://glygen.org/publication/PubMed/11051545" } ] }, { "title": "Translational repression by a novel partner of human poly(A) binding protein, Paip2.", "journal": "Mol. Cell", "date": "2001", "authors": "Khaleghpour K, Svitkin Y V, Craig A W, DeMaria C T, Deo R C, Burley S K, Sonenberg N", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "11172725", "url": "https://glygen.org/publication/PubMed/11172725" } ] }, { "title": "The cap-to-tail guide to mRNA turnover.", "journal": "Nature reviews. Molecular cell biology", "date": "2001", "authors": "Wilusz CJ, Wormington M, Peltz SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "11283721", "url": "https://glygen.org/publication/PubMed/11283721" } ] }, { "title": "Structure and function of the C-terminal PABC domain of human poly(A)-binding protein.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2001", "authors": "Kozlov G, Trempe JF, Khaleghpour K, Kahvejian A, Ekiel I, Gehring K", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "11287632", "url": "https://glygen.org/publication/PubMed/11287632" } ] }, { "title": "Cloning of a novel phosphatidylinositol kinase-related kinase: characterization of the human SMG-1 RNA surveillance protein.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Denning G, Jamieson L, Maquat LE, Thompson EA, Fields AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "11331269", "url": "https://glygen.org/publication/PubMed/11331269" } ] }, { "title": "Dual interactions of the translational repressor Paip2 with poly(A) binding protein.", "journal": "Mol. Cell. Biol.", "date": "2001", "authors": "Khaleghpour K, Kahvejian A, De Crescenzo G, Roy G, Svitkin Y V, Imataka H, O'Connor-McCourt M, Sonenberg N", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "11438674", "url": "https://glygen.org/publication/PubMed/11438674" } ] }, { "title": "The exon-exon junction complex provides a binding platform for factors involved in mRNA export and nonsense-mediated mRNA decay.", "journal": "The EMBO journal", "date": "2001", "authors": "Le Hir H, Gatfield D, Izaurralde E, Moore MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "11532962", "url": "https://glygen.org/publication/PubMed/11532962" } ] }, { "title": "Human SMG-1, a novel phosphatidylinositol 3-kinase-related protein kinase, associates with components of the mRNA surveillance complex and is involved in the regulation of nonsense-mediated mRNA decay.", "journal": "Genes & development", "date": "2001", "authors": "Yamashita A, Ohnishi T, Kashima I, Taya Y, Ohno S", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "11544179", "url": "https://glygen.org/publication/PubMed/11544179" } ] }, { "title": "Communication of the position of exon-exon junctions to the mRNA surveillance machinery by the protein RNPS1.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Lykke-Andersen J, Shu MD, Steitz JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "11546874", "url": "https://glygen.org/publication/PubMed/11546874" } ] }, { "title": "Evidence for a pioneer round of mRNA translation: mRNAs subject to nonsense-mediated decay in mammalian cells are bound by CBP80 and CBP20.", "journal": "Cell", "date": "2001", "authors": "Ishigaki Y, Li X, Serin G, Maquat LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "11551508", "url": "https://glygen.org/publication/PubMed/11551508" } ] }, { "title": "Ubiquitin-dependent mechanism regulates rapid turnover of AU-rich cytokine mRNAs.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Laroia G, Sarkar B, Schneider RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-450408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450408" } ], "reference": [ { "type": "PubMed", "id": "11842200", "url": "https://glygen.org/publication/PubMed/11842200" } ] }, { "title": "PABP1 identified as an arginine methyltransferase substrate using high-density protein arrays.", "journal": "EMBO reports", "date": "2002", "authors": "Lee J, Bedford MT", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "11850402", "url": "https://glygen.org/publication/PubMed/11850402" } ] }, { "title": "CCR4, a 3'-5' poly(A) RNA and ssDNA exonuclease, is the catalytic component of the cytoplasmic deadenylase.", "journal": "The EMBO journal", "date": "2002", "authors": "Chen J, Chiang YC, Denis CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "11889047", "url": "https://glygen.org/publication/PubMed/11889047" } ] }, { "title": "Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.", "journal": "RNA", "date": "2002", "authors": "Jurica MS, Licklider LJ, Gygi SR, Grigorieff N, Moore MJ", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "11991638", "url": "https://glygen.org/publication/PubMed/11991638" } ] }, { "title": "Paip1 interacts with poly(A) binding protein through two independent binding motifs.", "journal": "Mol. Cell. Biol.", "date": "2002", "authors": "Roy Guylaine, De Crescenzo Gregory, Khaleghpour Kianoush, Kahvejian Avak, O'Connor-McCourt Maureen, Sonenberg Nahum", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "11997512", "url": "https://glygen.org/publication/PubMed/11997512" } ] }, { "title": "Alternate exon insertion controls selective ubiquitination and degradation of different AUF1 protein isoforms.", "journal": "Nucleic acids research", "date": "2002", "authors": "Laroia G, Schneider RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-450408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450408" } ], "reference": [ { "type": "PubMed", "id": "12136087", "url": "https://glygen.org/publication/PubMed/12136087" } ] }, { "title": "Identification of a human decapping complex associated with hUpf proteins in nonsense-mediated decay.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Lykke-Andersen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "12417715", "url": "https://glygen.org/publication/PubMed/12417715" } ] }, { "title": "Characterization of human Smg5/7a: a protein with similarities to Caenorhabditis elegans SMG5 and SMG7 that functions in the dephosphorylation of Upf1.", "journal": "RNA (New York, N.Y.)", "date": "2003", "authors": "Chiu SY, Serin G, Ohara O, Maquat LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "12554878", "url": "https://glygen.org/publication/PubMed/12554878" } ] }, { "title": "Affinity purification of ARE-binding proteins identifies polyA-binding protein 1 as a potential substrate in MK2-induced mRNA stabilization.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Bollig F, Winzen R, Gaestel M, Kostka S, Resch K, Holtmann H", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "12565831", "url": "https://glygen.org/publication/PubMed/12565831" } ] }, { "title": "Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Sampath P, Mazumder B, Seshadri V, Fox PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-156827", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156827" } ], "reference": [ { "type": "PubMed", "id": "12588972", "url": "https://glygen.org/publication/PubMed/12588972" } ] }, { "title": "Y14 and hUpf3b form an NMD-activating complex.", "journal": "Molecular cell", "date": "2003", "authors": "Gehring NH, Neu-Yilik G, Schell T, Hentze MW, Kulozik AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "12718880", "url": "https://glygen.org/publication/PubMed/12718880" } ] }, { "title": "Regulation of A + U-rich element-directed mRNA turnover involving reversible phosphorylation of AUF1.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Wilson GM, Lu J, Sutphen K, Sun Y, Huynh Y, Brewer G", "evidence": [ { "database": "Reactome", "id": "R-HSA-450408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450408" } ], "reference": [ { "type": "PubMed", "id": "12819195", "url": "https://glygen.org/publication/PubMed/12819195" } ] }, { "title": "Rapid deadenylation triggered by a nonsense codon precedes decay of the RNA body in a mammalian cytoplasmic nonsense-mediated decay pathway.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Chen CY, Shyu AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "12832468", "url": "https://glygen.org/publication/PubMed/12832468" } ] }, { "title": "Properties of a HeLa cell 3' exonuclease specific for degrading poly(A) tails of mammalian mRNA.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Astrom J, Astrom A, Virtanen A", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "1355481", "url": "https://glygen.org/publication/PubMed/1355481" } ] }, { "title": "Nonsense-mediated mRNA decay in mammalian cells involves decapping, deadenylating, and exonucleolytic activities.", "journal": "Molecular cell", "date": "2003", "authors": "Lejeune F, Li X, Maquat LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "14527413", "url": "https://glygen.org/publication/PubMed/14527413" } ] }, { "title": "Regulated release of L13a from the 60S ribosomal subunit as a mechanism of transcript-specific translational control.", "journal": "Cell", "date": "2003", "authors": "Mazumder B, Sampath P, Seshadri V, Maitra RK, DiCorleto PE, Fox PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-156827", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156827" } ], "reference": [ { "type": "PubMed", "id": "14567916", "url": "https://glygen.org/publication/PubMed/14567916" } ] }, { "title": "Identification of a human cytoplasmic poly(A) nuclease complex stimulated by poly(A)-binding protein.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Uchida N, Hoshino S, Katada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "14583602", "url": "https://glygen.org/publication/PubMed/14583602" } ] }, { "title": "Phosphorylation of hUPF1 induces formation of mRNA surveillance complexes containing hSMG-5 and hSMG-7.", "journal": "Molecular cell", "date": "2003", "authors": "Ohnishi T, Yamashita A, Kashima I, Schell T, Anders KR, Grimson A, Hachiya T, Hentze MW, Anderson P, Ohno S", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "14636577", "url": "https://glygen.org/publication/PubMed/14636577" } ] }, { "title": "Proteomic characterization of the human centrosome by protein correlation profiling.", "journal": "Nature", "date": "2003", "authors": "Andersen Jens S, Wilkinson Christopher J, Mayor Thibault, Mortensen Peter, Nigg Erich A, Mann Matthias", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "14654843", "url": "https://glygen.org/publication/PubMed/14654843" } ] }, { "title": "Premature termination codons enhance mRNA decapping in human cells.", "journal": "Nucleic acids research", "date": "2004", "authors": "Couttet P, Grange T", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "14742663", "url": "https://glygen.org/publication/PubMed/14742663" } ] }, { "title": "The enzymes and control of eukaryotic mRNA turnover.", "journal": "Nature structural & molecular biology", "date": "2004", "authors": "Parker R, Song H", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "14749774", "url": "https://glygen.org/publication/PubMed/14749774" } ] }, { "title": "An eIF4AIII-containing complex required for mRNA localization and nonsense-mediated mRNA decay.", "journal": "Nature", "date": "2004", "authors": "Palacios IM, Gatfield D, St Johnston D, Izaurralde E", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "14973490", "url": "https://glygen.org/publication/PubMed/14973490" } ] }, { "title": "eIF4AIII binds spliced mRNA in the exon junction complex and is essential for nonsense-mediated decay.", "journal": "Nature structural & molecular biology", "date": "2004", "authors": "Shibuya T, Tange TO, Sonenberg N, Moore MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "15034551", "url": "https://glygen.org/publication/PubMed/15034551" } ] }, { "title": "Concurrent versus individual binding of HuR and AUF1 to common labile target mRNAs.", "journal": "The EMBO journal", "date": "2004", "authors": "Lal A, Mazan-Mamczarz K, Kawai T, Yang X, Martindale JL, Gorospe M", "evidence": [ { "database": "Reactome", "id": "R-HSA-450408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450408" } ], "reference": [ { "type": "PubMed", "id": "15257295", "url": "https://glygen.org/publication/PubMed/15257295" } ] }, { "title": "UNR, a new partner of poly(A)-binding protein, plays a key role in translationally coupled mRNA turnover mediated by the c-fos major coding-region determinant.", "journal": "Genes Dev.", "date": "2004", "authors": "Chang TC, Yamashita A, Chen CY, Yamashita Y, Zhu W, Durdan S, Kahvejian A, Sonenberg N, Shyu AB", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "15314026", "url": "https://glygen.org/publication/PubMed/15314026" } ] }, { "title": "Messenger RNA decay in mammalian cells: the exonuclease perspective.", "journal": "Cell biochemistry and biophysics", "date": "2004", "authors": "Fritz DT, Bergman N, Kilpatrick WJ, Wilusz CJ, Wilusz J", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "15475613", "url": "https://glygen.org/publication/PubMed/15475613" } ] }, { "title": "SMG7 acts as a molecular link between mRNA surveillance and mRNA decay.", "journal": "Molecular cell", "date": "2004", "authors": "Unterholzner L, Izaurralde E", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "15546618", "url": "https://glygen.org/publication/PubMed/15546618" } ] }, { "title": "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.", "journal": "Nature biotechnology", "date": "2005", "authors": "Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ", "evidence": [ { "database": "iPTMnet", "id": "P11940-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11940-1" } ], "reference": [ { "type": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" } ] }, { "title": "SMG7 is a 14-3-3-like adaptor in the nonsense-mediated mRNA decay pathway.", "journal": "Molecular cell", "date": "2005", "authors": "Fukuhara N, Ebert J, Unterholzner L, Lindner D, Izaurralde E, Conti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "15721257", "url": "https://glygen.org/publication/PubMed/15721257" } ] }, { "title": "From birth to death: the complex lives of eukaryotic mRNAs.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Moore MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "16141059", "url": "https://glygen.org/publication/PubMed/16141059" } ] }, { "title": "CBP80 promotes interaction of Upf1 with Upf2 during nonsense-mediated mRNA decay in mammalian cells.", "journal": "Nature structural & molecular biology", "date": "2005", "authors": "Hosoda N, Kim YK, Lejeune F, Maquat LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "16186820", "url": "https://glygen.org/publication/PubMed/16186820" } ] }, { "title": "Exon-junction complex components specify distinct routes of nonsense-mediated mRNA decay with differential cofactor requirements.", "journal": "Molecular cell", "date": "2005", "authors": "Gehring NH, Kunz JB, Neu-Yilik G, Breit S, Viegas MH, Hentze MW, Kulozik AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "16209946", "url": "https://glygen.org/publication/PubMed/16209946" } ] }, { "title": "Concerted action of poly(A) nucleases and decapping enzyme in mammalian mRNA turnover.", "journal": "Nature structural & molecular biology", "date": "2005", "authors": "Yamashita A, Chang TC, Yamashita Y, Zhu W, Zhong Z, Chen CY, Shyu AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "16284618", "url": "https://glygen.org/publication/PubMed/16284618" } ] }, { "title": "The autoregulatory translational control element of poly(A)-binding protein mRNA forms a heteromeric ribonucleoprotein complex.", "journal": "Nucleic Acids Res.", "date": "2005", "authors": "Patel Gopal P, Ma Shuhua, Bag Jnanankur", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "16356927", "url": "https://glygen.org/publication/PubMed/16356927" } ] }, { "title": "Binding of a novel SMG-1-Upf1-eRF1-eRF3 complex (SURF) to the exon junction complex triggers Upf1 phosphorylation and nonsense-mediated mRNA decay.", "journal": "Genes & development", "date": "2006", "authors": "Kashima I, Yamashita A, Izumi N, Kataoka N, Morishita R, Hoshino S, Ohno M, Dreyfuss G, Ohno S", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "16452507", "url": "https://glygen.org/publication/PubMed/16452507" } ] }, { "title": "Assembly of AUF1 with eIF4G-poly(A) binding protein complex suggests a translation function in AU-rich mRNA decay.", "journal": "RNA (New York, N.Y.)", "date": "2006", "authors": "Lu JY, Bergman N, Sadri N, Schneider RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-450408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450408" } ], "reference": [ { "type": "PubMed", "id": "16556936", "url": "https://glygen.org/publication/PubMed/16556936" } ] }, { "title": "Functions of hUpf3a and hUpf3b in nonsense-mediated mRNA decay and translation.", "journal": "RNA (New York, N.Y.)", "date": "2006", "authors": "Kunz JB, Neu-Yilik G, Hentze MW, Kulozik AE, Gehring NH", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "16601204", "url": "https://glygen.org/publication/PubMed/16601204" } ] }, { "title": "EJC-independent degradation of nonsense immunoglobulin-mu mRNA depends on 3' UTR length.", "journal": "Nature structural & molecular biology", "date": "2006", "authors": "Buhler M, Steiner S, Mohn F, Paillusson A, Muhlemann O", "evidence": [ { "database": "Reactome", "id": "R-HSA-975956", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975956" } ], "reference": [ { "type": "PubMed", "id": "16622410", "url": "https://glygen.org/publication/PubMed/16622410" } ] }, { "title": "Regulation of poly(A) binding protein function in translation: Characterization of the Paip2 homolog, Paip2B.", "journal": "RNA", "date": "2006", "authors": "Berlanga JJ, Baass A, Sonenberg N", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "16804161", "url": "https://glygen.org/publication/PubMed/16804161" } ] }, { "title": "Opposing polymerase-deadenylase activities regulate cytoplasmic polyadenylation.", "journal": "Molecular cell", "date": "2006", "authors": "Kim JH, Richter JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "17052452", "url": "https://glygen.org/publication/PubMed/17052452" } ] }, { "title": "Structures of the PIN domains of SMG6 and SMG5 reveal a nuclease within the mRNA surveillance complex.", "journal": "The EMBO journal", "date": "2006", "authors": "Glavan F, Behm-Ansmant I, Izaurralde E, Conti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "17053788", "url": "https://glygen.org/publication/PubMed/17053788" } ] }, { "title": "IMP1 interacts with poly(A)-binding protein (PABP) and the autoregulatory translational control element of PABP-mRNA through the KH III-IV domain.", "journal": "The FEBS journal", "date": "2006-12", "authors": "Patel Gopal P, Bag Jnanankur", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "17212783", "url": "https://glygen.org/publication/PubMed/17212783" } ] }, { "title": "The highways and byways of mRNA decay.", "journal": "Nature reviews. Molecular cell biology", "date": "2007", "authors": "Garneau NL, Wilusz J, Wilusz CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "17245413", "url": "https://glygen.org/publication/PubMed/17245413" } ] }, { "title": "NFX1-123 and poly(A) binding proteins synergistically augment activation of telomerase in human papillomavirus type 16 E6-expressing cells.", "journal": "J. Virol.", "date": "2007", "authors": "Katzenellenbogen RA, Egelkrout EM, Vliet-Gregg P, Gewin LC, Gafken PR, Galloway DA", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "17267499", "url": "https://glygen.org/publication/PubMed/17267499" } ] }, { "title": "Molecular composition of IMP1 ribonucleoprotein granules.", "journal": "Mol. Cell. Proteomics", "date": "2007", "authors": "Jonson L, Vikesaa J, Krogh A, Nielsen LK, Hansen Tv, Borup R, Johnsen AH, Christiansen J, Nielsen FC", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "17289661", "url": "https://glygen.org/publication/PubMed/17289661" } ] }, { "title": "The nonsense-mediated decay RNA surveillance pathway.", "journal": "Annual review of biochemistry", "date": "2007", "authors": "Chang YF, Imam JS, Wilkinson MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "17352659", "url": "https://glygen.org/publication/PubMed/17352659" } ] }, { "title": "An alternative branch of the nonsense-mediated decay pathway.", "journal": "The EMBO journal", "date": "2007", "authors": "Chan WK, Huang L, Gudikote JP, Chang YF, Imam JS, MacLean JA 2nd, Wilkinson MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "17363904", "url": "https://glygen.org/publication/PubMed/17363904" } ] }, { "title": "Poly(A) nuclease interacts with the C-terminal domain of polyadenylate-binding protein domain from poly(A)-binding protein.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Siddiqui N, Mangus DA, Chang TC, Palermino JM, Shyu AB, Gehring K", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" }, { "database": "RefSeq", "id": "NP_002559", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002559" } ], "reference": [ { "type": "PubMed", "id": "17595167", "url": "https://glygen.org/publication/PubMed/17595167" } ] }, { "title": "Communication with the exon-junction complex and activation of nonsense-mediated decay by human Upf proteins occur in the cytoplasm.", "journal": "Molecular cell", "date": "2007", "authors": "Singh G, Jakob S, Kleedehn MG, Lykke-Andersen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "17803942", "url": "https://glygen.org/publication/PubMed/17803942" } ] }, { "title": "Inhibition of nonsense-mediated mRNA decay (NMD) by a new chemical molecule reveals the dynamic of NMD factors in P-bodies.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Durand S, Cougot N, Mahuteau-Betzer F, Nguyen CH, Grierson DS, Bertrand E, Tazi J, Lejeune F", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "17893241", "url": "https://glygen.org/publication/PubMed/17893241" } ] }, { "title": "Proteomic and functional analysis of Argonaute-containing mRNA-protein complexes in human cells.", "journal": "EMBO Rep.", "date": "2007", "authors": "Hock J, Weinmann L, Ender C, Rudel S, Kremmer E, Raabe M, Urlaub H, Meister G", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "17932509", "url": "https://glygen.org/publication/PubMed/17932509" } ] }, { "title": "NMD factors UPF2 and UPF3 bridge UPF1 to the exon junction complex and stimulate its RNA helicase activity.", "journal": "Nature structural & molecular biology", "date": "2008", "authors": "Chamieh H, Ballut L, Bonneau F, Le Hir H", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "18066079", "url": "https://glygen.org/publication/PubMed/18066079" } ] }, { "title": "Proximity of the poly(A)-binding protein to a premature termination codon inhibits mammalian nonsense-mediated mRNA decay.", "journal": "RNA (New York, N.Y.)", "date": "2008", "authors": "Silva AL, Ribeiro P, Inacio A, Liebhaber SA, Romao L", "evidence": [ { "database": "Reactome", "id": "R-HSA-975956", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975956" }, { "database": "RefSeq", "id": "NP_002559", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002559" } ], "reference": [ { "type": "PubMed", "id": "18230761", "url": "https://glygen.org/publication/PubMed/18230761" } ] }, { "title": "Interactions between UPF1, eRFs, PABP and the exon junction complex suggest an integrated model for mammalian NMD pathways.", "journal": "The EMBO journal", "date": "2008", "authors": "Ivanov PV, Gehring NH, Kunz JB, Hentze MW, Kulozik AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-975956", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975956" } ], "reference": [ { "type": "PubMed", "id": "18256688", "url": "https://glygen.org/publication/PubMed/18256688" } ] }, { "title": "Upf1 phosphorylation triggers translational repression during nonsense-mediated mRNA decay.", "journal": "Cell", "date": "2008", "authors": "Isken O, Kim YK, Hosoda N, Mayeur GL, Hershey JW, Maquat LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "18423202", "url": "https://glygen.org/publication/PubMed/18423202" } ] }, { "title": "Posttranscriptional gene regulation by spatial rearrangement of the 3' untranslated region.", "journal": "PLoS biology", "date": "2008", "authors": "Eberle AB, Stalder L, Mathys H, Orozco RZ, Muhlemann O", "evidence": [ { "database": "Reactome", "id": "R-HSA-975956", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975956" } ], "reference": [ { "type": "PubMed", "id": "18447580", "url": "https://glygen.org/publication/PubMed/18447580" } ] }, { "title": "A competition between stimulators and antagonists of Upf complex recruitment governs human nonsense-mediated mRNA decay.", "journal": "PLoS biology", "date": "2008", "authors": "Singh G, Rebbapragada I, Lykke-Andersen J", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" }, { "database": "Reactome", "id": "R-HSA-975956", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975956" } ], "reference": [ { "type": "PubMed", "id": "18447585", "url": "https://glygen.org/publication/PubMed/18447585" } ] }, { "title": "The meaning of nonsense.", "journal": "Trends in cell biology", "date": "2008", "authors": "Stalder L, Muhlemann O", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "18524595", "url": "https://glygen.org/publication/PubMed/18524595" } ] }, { "title": "Chaperone Hsp27, a novel subunit of AUF1 protein complexes, functions in AU-rich element-mediated mRNA decay.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Sinsimer KS, Gratacos FM, Knapinska AM, Lu J, Krause CD, Wierzbowski AV, Maher LR, Scrudato S, Rivera YM, Gupta S, Turrin DK, De La Cruz MP, Pestka S, Brewer G", "evidence": [ { "database": "Reactome", "id": "R-HSA-450408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450408" } ], "reference": [ { "type": "PubMed", "id": "18573886", "url": "https://glygen.org/publication/PubMed/18573886" } ] }, { "title": "The DEAD-box RNA helicase DDX3 associates with export messenger ribonucleoproteins as well as tip-associated protein and participates in translational control.", "journal": "Mol. Biol. Cell", "date": "2008", "authors": "Lai MC, Lee YH, Tarn WY", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "18596238", "url": "https://glygen.org/publication/PubMed/18596238" } ] }, { "title": "Deadenylation is prerequisite for P-body formation and mRNA decay in mammalian cells.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Zheng D, Ezzeddine N, Chen CY, Zhu W, He X, Shyu AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "18625844", "url": "https://glygen.org/publication/PubMed/18625844" } ] }, { "title": "Recognition and elimination of nonsense mRNA.", "journal": "Biochimica et biophysica acta", "date": "2008", "authors": "Muhlemann O, Eberle AB, Stalder L, Zamudio Orozco R", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "18657639", "url": "https://glygen.org/publication/PubMed/18657639" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" }, { "database": "iPTMnet", "id": "P11940-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11940-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Nuclear localization of cytoplasmic poly(A)-binding protein upon rotavirus infection involves the interaction of NSP3 with eIF4G and RoXaN.", "journal": "J. Virol.", "date": "2008", "authors": "Harb M, Becker MM, Vitour D, Baron CH, Vende P, Brown SC, Bolte S, Arold ST, Poncet D", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "18799579", "url": "https://glygen.org/publication/PubMed/18799579" } ] }, { "title": "SMG6 is the catalytic endonuclease that cleaves mRNAs containing nonsense codons in metazoan.", "journal": "RNA (New York, N.Y.)", "date": "2008", "authors": "Huntzinger E, Kashima I, Fauser M, Sauliere J, Izaurralde E", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "18974281", "url": "https://glygen.org/publication/PubMed/18974281" } ] }, { "title": "Control of c-myc mRNA stability by IGF2BP1-associated cytoplasmic RNPs.", "journal": "RNA", "date": "2009", "authors": "Weidensdorfer D, Stohr N, Baude A, Lederer M, Kohn M, Schierhorn A, Buchmeier S, Wahle E, Huttelmaier S", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "19029303", "url": "https://glygen.org/publication/PubMed/19029303" } ] }, { "title": "SMG6 promotes endonucleolytic cleavage of nonsense mRNA in human cells.", "journal": "Nature structural & molecular biology", "date": "2009", "authors": "Eberle AB, Lykke-Andersen S, Muhlemann O, Jensen TH", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "19060897", "url": "https://glygen.org/publication/PubMed/19060897" } ] }, { "title": "Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex.", "journal": "Molecular cell", "date": "2009", "authors": "Cho H, Kim KM, Kim YK", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "19150429", "url": "https://glygen.org/publication/PubMed/19150429" } ] }, { "title": "The many pathways of RNA degradation.", "journal": "Cell", "date": "2009", "authors": "Houseley J, Tollervey D", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "19239894", "url": "https://glygen.org/publication/PubMed/19239894" } ] }, { "title": "Execution of nonsense-mediated mRNA decay: what defines a substrate?", "journal": "Current opinion in cell biology", "date": "2009", "authors": "Rebbapragada I, Lykke-Andersen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "19359157", "url": "https://glygen.org/publication/PubMed/19359157" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "P11940-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11940-1" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "SMG-8 and SMG-9, two novel subunits of the SMG-1 complex, regulate remodeling of the mRNA surveillance complex during nonsense-mediated mRNA decay.", "journal": "Genes & development", "date": "2009", "authors": "Yamashita A, Izumi N, Kashima I, Ohnishi T, Saari B, Katsuhata Y, Muramatsu R, Morita T, Iwamatsu A, Hachiya T, Kurata R, Hirano H, Anderson P, Ohno S", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "19417104", "url": "https://glygen.org/publication/PubMed/19417104" } ] }, { "title": "The hierarchy of exon-junction complex assembly by the spliceosome explains key features of mammalian nonsense-mediated mRNA decay.", "journal": "PLoS biology", "date": "2009", "authors": "Gehring NH, Lamprinaki S, Hentze MW, Kulozik AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "19478851", "url": "https://glygen.org/publication/PubMed/19478851" } ] }, { "title": "A UPF3-mediated regulatory switch that maintains RNA surveillance.", "journal": "Nature structural & molecular biology", "date": "2009", "authors": "Chan WK, Bhalla AD, Le Hir H, Nguyen LS, Huang L, Gecz J, Wilkinson MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "19503078", "url": "https://glygen.org/publication/PubMed/19503078" } ] }, { "title": "Unusual bipartite mode of interaction between the nonsense-mediated decay factors, UPF1 and UPF2.", "journal": "The EMBO journal", "date": "2009", "authors": "Clerici M, Mourao A, Gutsche I, Gehring NH, Hentze MW, Kulozik A, Kadlec J, Sattler M, Cusack S", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "19556969", "url": "https://glygen.org/publication/PubMed/19556969" } ] }, { "title": "Human Ccr4-Not complexes contain variable deadenylase subunits.", "journal": "The Biochemical journal", "date": "2009", "authors": "Lau NC, Kolkman A, van Schaik FM, Mulder KW, Pijnappel WW, Heck AJ, Timmers HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "19558367", "url": "https://glygen.org/publication/PubMed/19558367" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "Deubiquitinating enzyme USP33/VDU1 is required for Slit signaling in inhibiting breast cancer cell migration.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Yuasa-Kawada J, Kinoshita-Kawada M, Rao Y, Wu JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9010553", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9010553" } ], "reference": [ { "type": "PubMed", "id": "19706539", "url": "https://glygen.org/publication/PubMed/19706539" } ] }, { "title": "Nonsense-mediated mRNA decay in human cells: mechanistic insights, functions beyond quality control and the double-life of NMD factors.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2010", "authors": "Nicholson P, Yepiskoposyan H, Metze S, Zamudio Orozco R, Kleinschmidt N, Muhlemann O", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "19859661", "url": "https://glygen.org/publication/PubMed/19859661" } ] }, { "title": "Gene expression networks: competing mRNA decay pathways in mammalian cells.", "journal": "Biochemical Society transactions", "date": "2009", "authors": "Maquat LE, Gong C", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "19909264", "url": "https://glygen.org/publication/PubMed/19909264" } ] }, { "title": "How and where are nonsense mRNAs degraded in mammalian cells?", "journal": "RNA biology", "date": "2010", "authors": "Muhlemann O, Lykke-Andersen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "20023408", "url": "https://glygen.org/publication/PubMed/20023408" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" }, { "database": "iPTMnet", "id": "P11940-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11940-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Molecular determinants of PAM2 recognition by the MLLE domain of poly(A)-binding protein.", "journal": "J. Mol. Biol.", "date": "2010", "authors": "Kozlov Guennadi, M\u00e9nade Marie, Rosenauer Angelika, Nguyen Long, Gehring Kalle", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "20096703", "url": "https://glygen.org/publication/PubMed/20096703" } ] }, { "title": "Poly(A)-binding protein (PABP): a common viral target.", "journal": "Biochem. J.", "date": "2010", "authors": "Smith Richard W P, Gray Nicola K", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "20102337", "url": "https://glygen.org/publication/PubMed/20102337" } ] }, { "title": "Human cytomegalovirus UL69 protein facilitates translation by associating with the mRNA cap-binding complex and excluding 4EBP1.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2010", "authors": "Aoyagi Mariko, Gaspar Miguel, Shenk Thomas E", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "20133758", "url": "https://glygen.org/publication/PubMed/20133758" } ] }, { "title": "Glycopeptide-specific monoclonal antibodies suggest new roles for O-GlcNAc.", "journal": "Nature chemical biology", "date": "2010", "authors": "Teo CF, Ingale S, Wolfert MA, Elsayed GA, Not LG, Chatham JC, Wells L, Boons GJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11940", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11940" } ], "reference": [ { "type": "PubMed", "id": "20305658", "url": "https://glygen.org/publication/PubMed/20305658" } ] }, { "title": "The RNA binding protein Larp1 regulates cell division, apoptosis and cell migration.", "journal": "Nucleic Acids Res.", "date": "2010", "authors": "Burrows C, Abd Latip N, Lam SJ, Carpenter L, Sawicka K, Tzolovsky G, Gabra H, Bushell M, Glover DM, Willis AE, Blagden SP", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "20430826", "url": "https://glygen.org/publication/PubMed/20430826" } ] }, { "title": "Insights into the recruitment of the NMD machinery from the crystal structure of a core EJC-UPF3b complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Buchwald G, Ebert J, Basquin C, Sauliere J, Jayachandran U, Bono F, Le Hir H, Conti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "20479275", "url": "https://glygen.org/publication/PubMed/20479275" } ] }, { "title": "A stimulatory role for the La-related protein 4B in translation.", "journal": "RNA (New York, N.Y.)", "date": "2010", "authors": "Schaffler K, Schulz K, Hirmer A, Wiesner J, Grimm M, Sickmann A, Fischer U", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "20573744", "url": "https://glygen.org/publication/PubMed/20573744" } ] }, { "title": "UPF1 association with the cap-binding protein, CBP80, promotes nonsense-mediated mRNA decay at two distinct steps.", "journal": "Molecular cell", "date": "2010", "authors": "Hwang J, Sato H, Tang Y, Matsuda D, Maquat LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "20691628", "url": "https://glygen.org/publication/PubMed/20691628" } ] }, { "title": "Characterization of SMG-9, an essential component of the nonsense-mediated mRNA decay SMG1C complex.", "journal": "Nucleic acids research", "date": "2011", "authors": "Fernandez IS, Yamashita A, Arias-Palomo E, Bamba Y, Bartolome RA, Canales MA, Teixido J, Ohno S, Llorca O", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "20817927", "url": "https://glygen.org/publication/PubMed/20817927" } ] }, { "title": "SMG6 interacts with the exon junction complex via two conserved EJC-binding motifs (EBMs) required for nonsense-mediated mRNA decay.", "journal": "Genes & development", "date": "2010", "authors": "Kashima I, Jonas S, Jayachandran U, Buchwald G, Conti E, Lupas AN, Izaurralde E", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "20930030", "url": "https://glygen.org/publication/PubMed/20930030" } ] }, { "title": "Upf1 senses 3'UTR length to potentiate mRNA decay.", "journal": "Cell", "date": "2010", "authors": "Hogg JR, Goff SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-975956", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975956" } ], "reference": [ { "type": "PubMed", "id": "21029861", "url": "https://glygen.org/publication/PubMed/21029861" } ] }, { "title": "La-related protein 4 binds poly(A), interacts with the poly(A)-binding protein MLLE domain via a variant PAM2w motif, and can promote mRNA stability.", "journal": "Mol. Cell. Biol.", "date": "2011", "authors": "Yang R, Gaidamakov SA, Xie J, Lee J, Martino L, Kozlov G, Crawford AK, Russo AN, Conte MR, Gehring K, Maraia RJ", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "21098120", "url": "https://glygen.org/publication/PubMed/21098120" } ] }, { "title": "Upf1 ATPase-dependent mRNP disassembly is required for completion of nonsense- mediated mRNA decay.", "journal": "Cell", "date": "2010", "authors": "Franks TM, Singh G, Lykke-Andersen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "21145460", "url": "https://glygen.org/publication/PubMed/21145460" } ] }, { "title": "Molecular mechanisms for the RNA-dependent ATPase activity of Upf1 and its regulation by Upf2.", "journal": "Molecular cell", "date": "2011", "authors": "Chakrabarti S, Jayachandran U, Bonneau F, Fiorini F, Basquin C, Domcke S, Le Hir H, Conti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "21419344", "url": "https://glygen.org/publication/PubMed/21419344" } ] }, { "title": "Human senataxin resolves RNA/DNA hybrids formed at transcriptional pause sites to promote Xrn2-dependent termination.", "journal": "Mol. Cell", "date": "2011", "authors": "Skourti-Stathaki Konstantina, Proudfoot Nicholas J, Gromak Natalia", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "21700224", "url": "https://glygen.org/publication/PubMed/21700224" } ] }, { "title": "Combining high-energy C-trap dissociation and electron transfer dissociation for protein O-GlcNAc modification site assignment.", "journal": "Journal of proteome research", "date": "2011", "authors": "Zhao P, Viner R, Teo CF, Boons GJ, Horn D, Wells L", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11940", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11940" } ], "reference": [ { "type": "PubMed", "id": "21740066", "url": "https://glygen.org/publication/PubMed/21740066" } ] }, { "title": "Critical roles of RNA helicase DDX3 and its interactions with eIF4E/PABP1 in stress granule assembly and stress response.", "journal": "Biochem. J.", "date": "2012", "authors": "Shih JW, Wang WT, Tsai TY, Kuo CY, Li HK, Wu Lee YH", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "21883093", "url": "https://glygen.org/publication/PubMed/21883093" } ] }, { "title": "GlcNAcylation of histone H2B facilitates its monoubiquitination.", "journal": "Nature", "date": "2011", "authors": "Fujiki R, Hashiba W, Sekine H, Yokoyama A, Chikanishi T, Ito S, Imai Y, Kim J, He HH, Igarashi K, Kanno J, Ohtake F, Kitagawa H, Roeder RG, Brown M, Kato S", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11940", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11940" } ], "reference": [ { "type": "PubMed", "id": "22121020", "url": "https://glygen.org/publication/PubMed/22121020" } ] }, { "title": "DEAD-box protein DDX3 associates with eIF4F to promote translation of selected mRNAs.", "journal": "EMBO J.", "date": "2012", "authors": "Soto-Rifo R, Rubilar PS, Limousin T, de Breyne S, Decimo D, Ohlmann T", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "22872150", "url": "https://glygen.org/publication/PubMed/22872150" } ] }, { "title": "Structural basis of the PNRC2-mediated link between mrna surveillance and decapping.", "journal": "Structure (London, England : 1993)", "date": "2012", "authors": "Lai T, Cho H, Liu Z, Bowler MW, Piao S, Parker R, Kim YK, Song H", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "23085078", "url": "https://glygen.org/publication/PubMed/23085078" } ] }, { "title": "The mammalian TRIM-NHL protein TRIM71/LIN-41 is a repressor of mRNA function.", "journal": "Nucleic Acids Res.", "date": "2013", "authors": "Loedige I, Gaidatzis D, Sack R, Meister G, Filipowicz W", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "23125361", "url": "https://glygen.org/publication/PubMed/23125361" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" }, { "database": "iPTMnet", "id": "P11940", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11940" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Dystroglycan organizes axon guidance cue localization and axonal pathfinding.", "journal": "Neuron", "date": "2012", "authors": "Wright KM, Lyon KA, Leung H, Leahy DJ, Ma L, Ginty DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9010553", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9010553" } ], "reference": [ { "type": "PubMed", "id": "23217742", "url": "https://glygen.org/publication/PubMed/23217742" } ] }, { "title": "SMG5-PNRC2 is functionally dominant compared with SMG5-SMG7 in mammalian nonsense-mediated mRNA decay.", "journal": "Nucleic acids research", "date": "2013", "authors": "Cho H, Han S, Choe J, Park SG, Choi SS, Kim YK", "evidence": [ { "database": "Reactome", "id": "R-HSA-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957" } ], "reference": [ { "type": "PubMed", "id": "23234702", "url": "https://glygen.org/publication/PubMed/23234702" } ] }, { "title": "Both G3BP1 and G3BP2 contribute to stress granule formation.", "journal": "Genes Cells", "date": "2013", "authors": "Matsuki H, Takahashi M, Higuchi M, Makokha GN, Oie M, Fujii M", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "23279204", "url": "https://glygen.org/publication/PubMed/23279204" } ] }, { "title": "Regulation of axon guidance by compartmentalized nonsense-mediated mRNA decay.", "journal": "Cell", "date": "2013", "authors": "Colak D, Ji SJ, Porse BT, Jaffrey SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9010553", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9010553" } ], "reference": [ { "type": "PubMed", "id": "23746841", "url": "https://glygen.org/publication/PubMed/23746841" } ] }, { "title": "Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Guo A, Gu H, Zhou J, Mulhern D, Wang Y, Lee KA, Yang V, Aguiar M, Kornhauser J, Jia X, Ren J, Beausoleil SA, Silva JC, Vemulapalli V, Bedford MT, Comb MJ", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "24129315", "url": "https://glygen.org/publication/PubMed/24129315" } ] }, { "title": "Proteomic analysis of cap-dependent translation identifies LARP1 as a key regulator of 5'TOP mRNA translation.", "journal": "Genes Dev.", "date": "2014", "authors": "Tcherkezian Joseph, Cargnello Marie, Romeo Yves, Huttlin Edward L, Lavoie Genevieve, Gygi Steven P, Roux Philippe P", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "24532714", "url": "https://glygen.org/publication/PubMed/24532714" } ] }, { "title": "The RNA helicase DHX34 activates NMD by promoting a transition from the surveillance to the decay-inducing complex.", "journal": "Cell Rep.", "date": "2014", "authors": "Hug N, Caceres JF", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "25220460", "url": "https://glygen.org/publication/PubMed/25220460" } ] }, { "title": "USP33 mediates Slit-Robo signaling in inhibiting colorectal cancer cell migration.", "journal": "International journal of cancer", "date": "2015", "authors": "Huang Z, Wen P, Kong R, Cheng H, Zhang B, Quan C, Bian Z, Chen M, Zhang Z, Chen X, Du X, Liu J, Zhu L, Fushimi K, Hua D, Wu JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9010553", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9010553" } ], "reference": [ { "type": "PubMed", "id": "25242263", "url": "https://glygen.org/publication/PubMed/25242263" } ] }, { "title": "Uridylation by TUT4 and TUT7 marks mRNA for degradation.", "journal": "Cell", "date": "2014", "authors": "Lim J, Ha M, Chang H, Kwon SC, Simanshu DK, Patel DJ, Kim VN", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" }, { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "25480299", "url": "https://glygen.org/publication/PubMed/25480299" } ] }, { "title": "La-related protein 1 (LARP1) represses terminal oligopyrimidine (TOP) mRNA translation downstream of mTOR complex 1 (mTORC1).", "journal": "J. Biol. Chem.", "date": "2015", "authors": "Fonseca BD, Zakaria C, Jia JJ, Graber TE, Svitkin Y, Tahmasebi S, Healy D, Hoang HD, Jensen JM, Diao IT, Lussier A, Dajadian C, Padmanabhan N, Wang W, Matta-Camacho E, Hearnden J, Smith EM, Tsukumo Y, Yanagiya A, Morita M, Petroulakis E, Gonzalez JL, Hernandez G, Alain T, Damgaard CK", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "25940091", "url": "https://glygen.org/publication/PubMed/25940091" } ] }, { "title": "Characterization of RyDEN (C19orf66) as an Interferon-Stimulated Cellular Inhibitor against Dengue Virus Replication.", "journal": "PLoS pathogens", "date": "2016", "authors": "Suzuki Y, Chin WX, Han Q, Ichiyama K, Lee CH, Eyo ZW, Ebina H, Takahashi H, Takahashi C, Tan BH, Hishiki T, Ohba K, Matsuyama T, Koyanagi Y, Tan YJ, Sawasaki T, Chu JJ, Vasudevan SG, Sano K, Yamamoto N", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "26735137", "url": "https://glygen.org/publication/PubMed/26735137" } ] }, { "title": "Regulation of Human Endonuclease V Activity and Relocalization to Cytoplasmic Stress Granules.", "journal": "J. Biol. Chem.", "date": "2016", "authors": "Nawaz MS, Vik ES, Berges N, Fladeby C, Bjoras M, Dalhus B, Alseth I", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "27573237", "url": "https://glygen.org/publication/PubMed/27573237" } ] }, { "title": "Identification of a nuclear exosome decay pathway for processed transcripts.", "journal": "Mol. Cell", "date": "2016", "authors": "Meola N, Domanski M, Karadoulama E, Chen Y, Gentil C, Pultz D, Vitting-Seerup K, Lykke-Andersen S, Andersen JS, Sandelin A, Jensen TH", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "27871484", "url": "https://glygen.org/publication/PubMed/27871484" } ] }, { "title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.", "journal": "Analytical chemistry", "date": "2017", "authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11940", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11940" } ], "reference": [ { "type": "PubMed", "id": "28510447", "url": "https://glygen.org/publication/PubMed/28510447" } ] }, { "title": "Antagonistic actions of two human Pan3 isoforms on global mRNA turnover.", "journal": "RNA", "date": "2017", "authors": "Chen CA, Zhang Y, Xiang Y, Han L, Chang JT, Shyu AB", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "28559491", "url": "https://glygen.org/publication/PubMed/28559491" } ] }, { "title": "Quantitative proteomics identifies altered O-GlcNAcylation of structural, synaptic and memory-associated proteins in Alzheimer's disease.", "journal": "The Journal of pathology", "date": "2017", "authors": "Wang S, Yang F, Petyuk VA, Shukla AK, Monroe ME, Gritsenko MA, Rodland KD, Smith RD, Qian WJ, Gong CX, Liu T", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11940", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11940" } ], "reference": [ { "type": "PubMed", "id": "28657654", "url": "https://glygen.org/publication/PubMed/28657654" } ] }, { "title": "The helicase, DDX3X, interacts with poly(A)-binding protein 1 (PABP1) and caprin-1 at the leading edge of migrating fibroblasts and is required for efficient cell spreading.", "journal": "Biochem. J.", "date": "2017", "authors": "Copsey AC, Cooper S, Parker R, Lineham E, Lapworth C, Jallad D, Sweet S, Morley SJ", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "28733330", "url": "https://glygen.org/publication/PubMed/28733330" } ] }, { "title": "Human mRNA polyadenylate binding protein: evolutionary conservation of a nucleic acid binding motif.", "journal": "Nucleic Acids Res.", "date": "1987", "authors": "Grange T, de Sa C M, Oddos J, Pictet R", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "2885805", "url": "https://glygen.org/publication/PubMed/2885805" } ] }, { "title": "The non-canonical poly(A) polymerase FAM46C acts as an onco-suppressor in multiple myeloma.", "journal": "Nat. Commun.", "date": "2017", "authors": "Mroczek S, Chlebowska J, Kulinski TM, Gewartowska O, Gruchota J, Cysewski D, Liudkovska V, Borsuk E, Nowis D, Dziembowski A", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "28931820", "url": "https://glygen.org/publication/PubMed/28931820" } ] }, { "title": "Recognition of RNA N6-methyladenosine by IGF2BP proteins enhances mRNA stability and translation.", "journal": "Nat. Cell Biol.", "date": "2018", "authors": "Huang H, Weng H, Sun W, Qin X, Shi H, Wu H, Zhao BS, Mesquita A, Liu C, Yuan CL, Hu YC, Huttelmaier S, Skibbe JR, Su R, Deng X, Dong L, Sun M, Li C, Nachtergaele S, Wang Y, Hu C, Ferchen K, Greis KD, Jiang X, Wei M, Qu L, Guan JL, He C, Yang J, Chen J", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "29476152", "url": "https://glygen.org/publication/PubMed/29476152" } ] }, { "title": "O-GlcNAc-induced nuclear translocation of hnRNP-K is associated with progression and metastasis of cholangiocarcinoma.", "journal": "Molecular oncology", "date": "2019", "authors": "Phoomak C, Park D, Silsirivanit A, Sawanyawisuth K, Vaeteewoottacharn K, Detarya M, Wongkham C, Lebrilla CB, Wongkham S", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11940", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11940" } ], "reference": [ { "type": "PubMed", "id": "30444036", "url": "https://glygen.org/publication/PubMed/30444036" } ] }, { "title": "An Isotope-Coded Photocleavable Probe for Quantitative Profiling of Protein O-GlcNAcylation.", "journal": "ACS chemical biology", "date": "2019", "authors": "Li J, Li Z, Duan X, Qin K, Dang L, Sun S, Cai L, Hsieh-Wilson LC, Wu L, Yi W", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11940", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11940" }, { "database": "O-GlcNAc Atlas", "id": "P11940", "url": "https://oglcnac.org/atlas/detail/P11940" } ], "reference": [ { "type": "PubMed", "id": "30620550", "url": "https://glygen.org/publication/PubMed/30620550" } ] }, { "title": "The Interactome analysis of the Respiratory Syncytial Virus protein M2-1 suggests a new role in viral mRNA metabolism post-transcription.", "journal": "Sci. Rep.", "date": "2019", "authors": "Bouillier Camille, Cosentino Gina, L\u00e9ger Thibaut, Rincheval Vincent, Richard Charles-Adrien, Desquesnes Aurore, Sitterlin Delphine, Blouquit-Laye Sabine, El\u00e9ou\u00ebt Jean-Francois, Gault Elyanne, Rameix-Welti Marie-Anne", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "31649314", "url": "https://glygen.org/publication/PubMed/31649314" } ] }, { "title": "Engineering a Proximity-Directed O-GlcNAc Transferase for Selective Protein O-GlcNAcylation in Cells.", "journal": "ACS chemical biology", "date": "2020", "authors": "Ramirez DH, Aonbangkhen C, Wu HY, Naftaly JA, Tang S, O'Meara TR, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11940", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11940" } ], "reference": [ { "type": "PubMed", "id": "32119511", "url": "https://glygen.org/publication/PubMed/32119511" } ] }, { "title": "An oncopeptide regulates m(6)A recognition by the m(6)A reader IGF2BP1 and tumorigenesis.", "journal": "Nature communications", "date": "2020", "authors": "Zhu S, Wang JZ, Chen, He YT, Meng N, Chen M, Lu RX, Chen XH, Zhang XL, Yan GR", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "32245947", "url": "https://glygen.org/publication/PubMed/32245947" } ] }, { "title": "Homozygous Mutations in BTG4 Cause Zygotic Cleavage Failure and Female Infertility.", "journal": "American journal of human genetics", "date": "2020", "authors": "Zheng W, Zhou Z, Sha Q, Niu X, Sun X, Shi J, Zhao L, Zhang S, Dai J, Cai S, Meng F, Hu L, Gong F, Li X, Fu J, Shi R, Lu G, Chen B, Fan H, Wang L, Lin G, Sang Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-9820841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9820841" } ], "reference": [ { "type": "PubMed", "id": "32502391", "url": "https://glygen.org/publication/PubMed/32502391" } ] }, { "title": "Tandem Bioorthogonal Labeling Uncovers Endogenous Cotranslationally O-GlcNAc Modified Nascent Proteins.", "journal": "Journal of the American Chemical Society", "date": "2020", "authors": "Zhu Y, Willems LI, Salas D, Cecioni S, Wu WB, Foster LJ, Vocadlo DJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11940", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11940" } ], "reference": [ { "type": "PubMed", "id": "32870666", "url": "https://glygen.org/publication/PubMed/32870666" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11940", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11940" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "A new tandem enrichment strategy for the simultaneous profiling of O-GlcNAcylation and phosphorylation in RNA-binding proteome.", "journal": "The Analyst", "date": "2021", "authors": "Fan Z, Li J, Liu T, Zhang Z, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11940", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11940" }, { "database": "O-GlcNAc Atlas", "id": "P11940", "url": "https://oglcnac.org/atlas/detail/P11940" } ], "reference": [ { "type": "PubMed", "id": "33465208", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "title": "The SARS-unique domain (SUD) of SARS-CoV and SARS-CoV-2 interacts with human Paip1 to enhance viral RNA translation.", "journal": "EMBO J.", "date": "2021", "authors": "Lei J, Ma-Lauer Y, Han Y, Thoms M, Buschauer R, Jores J, Thiel V, Beckmann R, Deng W, Leonhardt H, Hilgenfeld R, von Brunn A", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "33876849", "url": "https://glygen.org/publication/PubMed/33876849" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11940", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11940" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "A novel homozygous missense variant in BTG4 causes zygotic cleavage failure and female infertility.", "journal": "Journal of assisted reproduction and genetics", "date": "2021", "authors": "Liu R, Zhou Y, Li Q, Chen B, Zhou Z, Wang L, Wang L, Sang Q, Jin L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9820841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9820841" } ], "reference": [ { "type": "PubMed", "id": "34647228", "url": "https://glygen.org/publication/PubMed/34647228" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11940", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11940" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "O-GlcNAcylation promotes fatty acid synthase activity under nutritional stress as a pro-survival mechanism in cancer cells.", "journal": "Proteomics", "date": "2022", "authors": "Wong YK, Wang J, Lim TK, Lin Q, Yap CT, Shen HM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11940", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11940" } ], "reference": [ { "type": "PubMed", "id": "35083852", "url": "https://glygen.org/publication/PubMed/35083852" } ] }, { "title": "Spatiotemporal Activation of Protein O-GlcNAcylation in Living Cells.", "journal": "Journal of the American Chemical Society", "date": "2022", "authors": "He J, Fan Z, Tian Y, Yang W, Zhou Y, Zhu Q, Zhang W, Qin W, Yi W", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11940", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11940" } ], "reference": [ { "type": "PubMed", "id": "35138101", "url": "https://glygen.org/publication/PubMed/35138101" } ] }, { "title": "An Optimized Isotopic Photocleavable Tagging Strategy for Site-Specific and Quantitative Profiling of Protein O-GlcNAcylation in Colorectal Cancer Metastasis.", "journal": "ACS chemical biology", "date": "2022", "authors": "Liu J, Hao Y, Wang C, Jin Y, Yang Y, Gu J, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11940", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11940" } ], "reference": [ { "type": "PubMed", "id": "35254053", "url": "https://glygen.org/publication/PubMed/35254053" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11940", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11940" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "A complex with poly(A)-binding protein and EWS facilitates the transcriptional function of oncogenic ETS transcription factors in prostate cells.", "journal": "The Journal of biological chemistry", "date": "2023-12", "authors": "Greulich Benjamin M, Rajendran Saranya, Downing Nicholas F, Nicholas Taylor R, Hollenhorst Peter C", "evidence": [ { "database": "RefSeq", "id": "NP_002559", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_002559" } ], "reference": [ { "type": "PubMed", "id": "37956771", "url": "https://glygen.org/publication/PubMed/37956771" } ] }, { "title": "Initiation of mammalian protein synthesis. II. The assembly of the initiation complex with purified initiation factors.", "journal": "Journal of molecular biology", "date": "1977", "authors": "Trachsel H, Erni B, Schreier MH, Staehelin T", "evidence": [ { "database": "Reactome", "id": "R-HSA-72649", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72649" } ], "reference": [ { "type": "PubMed", "id": "592399", "url": "https://glygen.org/publication/PubMed/592399" } ] }, { "title": "The mechanism of action of protein synthesis initiation factors from rabbit reticulocytes.", "journal": "The Journal of biological chemistry", "date": "1978", "authors": "Benne R, Hershey JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-72649", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72649" } ], "reference": [ { "type": "PubMed", "id": "641056", "url": "https://glygen.org/publication/PubMed/641056" } ] }, { "title": "New initiation factor activity required for globin mRNA translation.", "journal": "The Journal of biological chemistry", "date": "1983", "authors": "Grifo JA, Tahara SM, Morgan MA, Shatkin AJ, Merrick WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-72649", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72649" } ], "reference": [ { "type": "PubMed", "id": "6853548", "url": "https://glygen.org/publication/PubMed/6853548" } ] }, { "title": "The mRNA poly(A)-binding protein: localization, abundance, and RNA-binding specificity.", "journal": "Exp. Cell Res.", "date": "1994", "authors": "G\u00f6rlach M, Burd C G, Dreyfuss G", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "7908267", "url": "https://glygen.org/publication/PubMed/7908267" } ] }, { "title": "Poly(A) tail shortening by a mammalian poly(A)-specific 3'-exoribonuclease.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Korner CG, Wahle E", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "9099687", "url": "https://glygen.org/publication/PubMed/9099687" } ] }, { "title": "Interaction of polyadenylate-binding protein with the eIF4G homologue PAIP enhances translation.", "journal": "Nature", "date": "1998", "authors": "Craig AW, Haghighat A, Yu AT, Sonenberg N", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "9548260", "url": "https://glygen.org/publication/PubMed/9548260" } ] }, { "title": "The human poly(A)-binding protein 1 shuttles between the nucleus and the cytoplasm.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Afonina E, Stauber R, Pavlakis GN", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "reference": [ { "type": "PubMed", "id": "9582337", "url": "https://glygen.org/publication/PubMed/9582337" } ] }, { "title": "Eukaryotic ribosomes require initiation factors 1 and 1A to locate initiation codons.", "journal": "Nature", "date": "1998", "authors": "Pestova TV, Borukhov SI, Hellen CU", "evidence": [ { "database": "Reactome", "id": "R-HSA-72649", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72649" } ], "reference": [ { "type": "PubMed", "id": "9732867", "url": "https://glygen.org/publication/PubMed/9732867" } ] }, { "title": "A newly identified N-terminal amino acid sequence of human eIF4G binds poly(A)-binding protein and functions in poly(A)-dependent translation.", "journal": "The EMBO journal", "date": "1998", "authors": "Imataka H, Gradi A, Sonenberg N", "evidence": [ { "database": "Reactome", "id": "R-HSA-72649", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72649" } ], "reference": [ { "type": "PubMed", "id": "9857202", "url": "https://glygen.org/publication/PubMed/9857202" } ] } ], "pathway": [ { "id": "hsa:26986", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:26986", "resource": "KEGG Pathway" }, { "id": "R-HSA-156827", "name": "L13a-mediated translational silencing of Ceruloplasmin expression", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156827", "resource": "Reactome", "description": "L13a-mediated translational silencing of Ceruloplasmin expression" }, { "id": "R-HSA-429947", "name": "Deadenylation of mRNA", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947", "resource": "Reactome", "description": "Deadenylation of mRNA" }, { "id": "R-HSA-450408", "name": "AUF1 (hnRNP D0) binds and destabilizes mRNA", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450408", "resource": "Reactome", "description": "AUF1 (hnRNP D0) binds and destabilizes mRNA" }, { "id": "R-HSA-72649", "name": "Translation initiation complex formation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72649", "resource": "Reactome", "description": "Translation initiation complex formation" }, { "id": "R-HSA-9010553", "name": "Regulation of expression of SLITs and ROBOs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9010553", "resource": "Reactome", "description": "Regulation of expression of SLITs and ROBOs" }, { "id": "R-HSA-975956", "name": "Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975956", "resource": "Reactome", "description": "Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)" }, { "id": "R-HSA-975957", "name": "Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975957", "resource": "Reactome", "description": "Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)" }, { "id": "R-HSA-9820841", "name": "M-decay: degradation of maternal mRNAs by maternally stored factors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9820841", "resource": "Reactome", "description": "M-decay: degradation of maternal mRNAs by maternally stored factors" }, { "id": "R-HSA-9820865", "name": "Z-decay: degradation of maternal mRNAs by zygotically expressed factors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9820865", "resource": "Reactome", "description": "Z-decay: degradation of maternal mRNAs by zygotically expressed factors" } ], "orthologs": [ { "uniprot_canonical_ac": "P29341-1", "protein_name": "Polyadenylate-binding protein 1", "gene_name": "Pabpc1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKELFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV", "length": 636 }, "evidence": [ { "id": "45918975", "url": "http://www.informatics.jax.org/homology/45918975", "database": "MGI" }, { "id": "P11940", "url": "https://omabrowser.org/oma/group/P11940/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9EPH8-1", "protein_name": "Polyadenylate-binding protein 1", "gene_name": "Pabpc1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKELFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAATAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV", "length": 636 }, "evidence": [ { "id": "45918975", "url": "http://www.informatics.jax.org/homology/45918975", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9H361-1", "protein_name": "Polyadenylate-binding protein 3", "gene_name": "PABPC3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MNPSTPSYPTASLYVGDLHPDVTEAMLYEKFSPAGPILSIRICRDLITSGSSNYAYVNFQHTKDAEHALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFVKNLDKSINNKALYDTVSAFGNILSCNVVCDENGSKGYGFVHFETHEAAERAIKKMNGMLLNGRKVFVGQFKSRKEREAELGARAKEFPNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRTFEQMKQDRITRYQVVNLYVKNLDDGIDDERLRKAFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAYLTNEYMQRMASVRAVPNQRAPPSGYFMTAVPQTQNHAAYYPPSQIARLRPSPRWTAQGARPHPFQNKPSAIRPGAPRVPFSTMRPASSQVPRVMSTQRVANTSTQTVGPRPAAAAAAAATPAVRTVPRYKYAAGVRNPQQHRNAQPQVTMQQLAVHVQGQETLTASRLASAPPQKQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLYMLESPESLRSKVDEAVAVLQAHQAKEATQKAVNSATGVPTV", "length": 631 }, "evidence": [ { "id": "45918975", "url": "http://www.informatics.jax.org/homology/45918975", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "mRNA binding", "id": "GO:0003729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003729", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "translation activator activity", "id": "GO:0008494", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008494", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "mRNA 3'-UTR binding", "id": "GO:0003730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003730", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "poly(A) binding", "id": "GO:0008143", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008143", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "poly(U) RNA binding", "id": "GO:0008266", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008266", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 13, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "focal adhesion", "id": "GO:0005925", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005925", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "lamellipodium", "id": "GO:0030027", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030027", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "cell leading edge", "id": "GO:0031252", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031252", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "cytoplasmic ribonucleoprotein granule", "id": "GO:0036464", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036464", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "catalytic step 2 spliceosome", "id": "GO:0071013", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071013", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "cytoplasmic stress granule", "id": "GO:0010494", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010494", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "ribonucleoprotein complex", "id": "GO:1990904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990904", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "mCRD-mediated mRNA stability complex", "id": "GO:0106002", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0106002", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 12, "go_terms": [ { "name": "CRD-mediated mRNA stabilization", "id": "GO:0070934", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070934", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "positive regulation of cytoplasmic translation", "id": "GO:2000767", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000767", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "mRNA polyadenylation", "id": "GO:0006378", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006378", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "mRNA stabilization", "id": "GO:0048255", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048255", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "nuclear-transcribed mRNA catabolic process, nonsense-mediated decay", "id": "GO:0000184", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000184", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "regulatory ncRNA-mediated gene silencing", "id": "GO:0031047", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031047", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "positive regulation of nuclear-transcribed mRNA poly(A) tail shortening", "id": "GO:0060213", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060213", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay", "id": "GO:1900153", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900153", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "mRNA splicing, via spliceosome", "id": "GO:0000398", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000398", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "positive regulation of viral genome replication", "id": "GO:0045070", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045070", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "negative regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay", "id": "GO:2000623", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000623", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" }, { "name": "negative regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay", "id": "GO:1900152", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900152", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 135, "end_pos": 137, "annotation": "n_glycosylation_sequon" }, { "start_pos": 484, "end_pos": 486, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Methylated by CARM1. Arg-493 is dimethylated, probably to asymmetric dimethylarginine.", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" }, { "database": "PubMed", "id": "11850402", "url": "https://glygen.org/publication/PubMed/11850402" } ] }, { "annotation": "Phosphorylated by MAPKAPK2.", "evidence": [ { "database": "UniProtKB", "id": "P11940", "url": "https://www.uniprot.org/uniprot/P11940" }, { "database": "PubMed", "id": "12565831", "url": "https://glygen.org/publication/PubMed/12565831" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 315, 319, 321, 485, 635 ], "snv_sites": [ 3, 114, 319, 321, 420, 451, 629, 635 ], "glycation_sites": [], "phosphorylation_sites": [ 51, 54, 96, 315, 319, 342, 364, 591, 599 ], "sequon_annotation_sites": [ { "start_pos": 135, "end_pos": 137 }, { "start_pos": 484, "end_pos": 486 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 5 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 5 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 11 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 11 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 166 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }