{ "uniprot_canonical_ac": "P11511-1", "uniprot_ac": "P11511", "uniprot_id": "CP19A_HUMAN", "mass": { "chemical_mass": 57883.0, "monoisotopic_mass": 57883.0 }, "refseq": { "ac": "NP_000094", "name": "aromatase", "summary": "This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and catalyzes the last steps of estrogen biosynthesis. Mutations in this gene can result in either increased or decreased aromatase activity; the associated phenotypes suggest that estrogen functions both as a sex steroid hormone and in growth or differentiation. Alternative promoter use and alternative splicing results in multiple transcript variants that have different tissue specificities. [provided by RefSeq, Dec 2016].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000094" }, "gene_names": [ { "name": "CYP19A1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P11511", "id": "P11511" }, { "name": "ARO1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P11511", "id": "P11511" }, { "name": "ARO; ARO1; CPV1; CYAR; CYP19; CYPXIX; P-450AROM", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000094", "id": "NP_000094" }, { "name": "CYAR", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P11511", "id": "P11511" }, { "name": "CYP19A1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000094", "id": "NP_000094" }, { "name": "CYP19", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P11511", "id": "P11511" } ], "protein_names": [ { "name": "Aromatase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P11511" }, { "name": "1.14.14.14", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P11511" }, { "name": "CYPXIX", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P11511" }, { "name": "Cytochrome P-450AROM", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P11511" }, { "name": "Cytochrome P450 19A1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P11511" }, { "name": "Estrogen synthase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P11511" }, { "name": "aromatase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000094", "id": "NP_000094" }, { "name": "microsomal monooxygenase; flavoprotein-linked monooxygenase; estrogen synthetase; cytochrome P450, family 19, subfamily A, polypeptide 1; cytochrome P450, subfamily XIX (aromatization of androgens); cytochrome P450 19A1; estrogen synthase; cytochrome P-450AROM", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000094", "id": "NP_000094" } ], "function": [ { "annotation": "A cytochrome P450 monooxygenase that catalyzes the conversion of C19 androgens, androst-4-ene-3,17-dione (androstenedione) and testosterone to the C18 estrogens, estrone and estradiol, respectively (PubMed:27702664, PubMed:2848247). Catalyzes three successive oxidations of C19 androgens: two conventional oxidations at C19 yielding 19-hydroxy and 19-oxo/19-aldehyde derivatives, followed by a third oxidative aromatization step that involves C1-beta hydrogen abstraction combined with cleavage of the C10-C19 bond to yield a phenolic A ring and formic acid (PubMed:20385561). Alternatively, the third oxidative reaction yields a 19-norsteroid and formic acid. Converts dihydrotestosterone to delta1,10-dehydro 19-nordihydrotestosterone and may play a role in homeostasis of this potent androgen (PubMed:22773874). Also displays 2-hydroxylase activity toward estrone (PubMed:22773874). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase) (PubMed:20385561, PubMed:22773874).", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511#function" }, { "database": "PubMed", "id": "2848247", "url": "https://glygen.org/publication/PubMed/2848247" }, { "database": "PubMed", "id": "27702664", "url": "https://glygen.org/publication/PubMed/27702664" }, { "database": "PubMed", "id": "22773874", "url": "https://glygen.org/publication/PubMed/22773874" }, { "database": "PubMed", "id": "20385561", "url": "https://glygen.org/publication/PubMed/20385561" } ] }, { "annotation": "CYP19A1 mediates severe SARS-CoV-2 disease outcome in males.", "evidence": [ { "database": "RefSeq", "id": "NP_000094", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000094" }, { "database": "PubMed", "id": "37572667", "url": "https://glygen.org/publication/PubMed/37572667" } ] }, { "annotation": "CYP19A1 promotes gastric cancer as part of a lipid metabolism-related gene signature related to the response of immunotherapy and prognosis. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000094", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000094" }, { "database": "PubMed", "id": "37784135", "url": "https://glygen.org/publication/PubMed/37784135" } ] }, { "annotation": "Intratumoral cortisol associated with aromatase in the endometrial cancer microenvironment.", "evidence": [ { "database": "RefSeq", "id": "NP_000094", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000094" }, { "database": "PubMed", "id": "37820440", "url": "https://glygen.org/publication/PubMed/37820440" } ] }, { "annotation": "SNP of Aromatase Predict Long-term Survival and Aromatase Inhibitor Toxicity in Patients with Early Breast Cancer: A Biomarker Analysis of the GIM4 and GIM5 Trials.", "evidence": [ { "database": "RefSeq", "id": "NP_000094", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000094" }, { "database": "PubMed", "id": "37888299", "url": "https://glygen.org/publication/PubMed/37888299" } ] }, { "annotation": "This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and catalyzes the last steps of estrogen biosynthesis. Mutations in this gene can result in either increased or decreased aromatase activity; the associated phenotypes suggest that estrogen functions both as a sex steroid hormone and in growth or differentiation. Alternative promoter use and alternative splicing results in multiple transcript variants that have different tissue specificities. [provided by RefSeq, Dec 2016].", "evidence": [ { "database": "RefSeq", "id": "NP_000094", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000094" } ] } ], "disease": [ { "disease_id": "DOID:0090122", "recommended_name": { "id": "DOID:0090122", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0090122", "name": "aromatase excess syndrome", "description": "A reproductive system disease characterized by increased extraglandular aromatization of steroids resulting in heterosexual precocity in males and isosexual precocity in females, and has_material_basis_in autosomal dominant inheritance of fusion of the aromatase gene (CYP19A1) with various partners, brought about by translocations and resulting in gain of function of the CYP19A1 gene." }, "synonyms": [ { "id": "DOID:0090122", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0090122", "name": "AEXS", "description": "" }, { "id": "DOID:0090122", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0090122", "name": "familial hyperestrogenism", "description": "" }, { "id": "DOID:0090122", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0090122", "name": "hereditary prepubertal gynecomastia", "description": "" }, { "id": "DOID:0090122", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0090122", "name": "increased aromatase activity", "description": "" }, { "id": "MONDO:0007690", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007690", "name": "aromatase excess syndrome", "description": "Aromatase excess syndrome is a rare, genetic endocrine disease characterized by increased levels of estrogen due to elevated extraglandular aromatase activity. Males present with heterosexual precocious puberty which manifests with pre- or peripubertal onset of gynecomastia, premature growth spurt, accelerated bone maturation resulting in decreased adult stature, and may present mild hypogonadotropic hypogonadism. Female patients may have isosexual precocious puberty or not have any manifestations at all." }, { "id": "MONDO:0007690", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007690", "name": "AEXS", "description": "" }, { "id": "MONDO:0007690", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007690", "name": "aromatase excess syndrome", "description": "" }, { "id": "MONDO:0007690", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007690", "name": "familial hyperestrogenism", "description": "" }, { "id": "MONDO:0007690", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007690", "name": "gynecomastia, familial, due to increased aromatase activity", "description": "" }, { "id": "MONDO:0007690", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007690", "name": "gynecomastia, hereditary", "description": "" }, { "id": "MONDO:0007690", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007690", "name": "hereditary prepubertal gynecomastia", "description": "" }, { "id": "MONDO:0007690", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007690", "name": "increased aromatase activity", "description": "" }, { "id": "MONDO:0007690", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007690", "name": "aromatase activity, increased", "description": "" }, { "id": "MIM:139300", "resource": "MIM", "url": "https://www.omim.org/entry/139300", "name": "Aromatase excess syndrome", "description": "Aromatase excess syndrome" } ], "evidence": [ { "id": "139300", "database": "MIM", "url": "https://www.omim.org/entry/139300" } ] }, { "disease_id": "MONDO:0013301", "recommended_name": { "id": "MONDO:0013301", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013301", "name": "aromatase deficiency", "description": "Aromatase deficiency disrupts the synthesis of estradiol, resulting in hirsutism of mothers during gestation of an affected child; pseudohermaphroditism and virilization in women; and tall stature, osteoporosis and obesity in men." }, "synonyms": [ { "id": "MONDO:0013301", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013301", "name": "aromatase deficiency", "description": "" }, { "id": "MONDO:0013301", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013301", "name": "congenital estrogen deficiency", "description": "" }, { "id": "MONDO:0013301", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013301", "name": "congenital oestrogen deficiency", "description": "" }, { "id": "MONDO:0013301", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013301", "name": "pseudohermaphroditism, female, due to placental aromatase deficiency", "description": "" }, { "id": "MIM:613546", "resource": "MIM", "url": "https://www.omim.org/entry/613546", "name": "Aromatase deficiency", "description": "Aromatase deficiency" } ], "evidence": [ { "id": "613546", "database": "MIM", "url": "https://www.omim.org/entry/613546" } ] } ], "snv": [ { "evidence": [ { "id": "P11511", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P11511" } ], "glycoeffect": [], "start_pos": 483, "end_pos": 483, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "E", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "15", "chr_pos": "51210873", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "E483", "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] }, { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] }, { "disease_id": "DOID:4362", "recommended_name": { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical cancer", "description": "A female reproductive organ cancer that is located_in the cervix." }, "synonyms": [ { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical neoplasm", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix uteri cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "neoplasm of uterine cervix", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "tumor of the Cervix Uteri", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer", "description": "A primary or metastatic malignant neoplasm involving the cervix." }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cancer of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer, somatic", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix uteri cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervix cancer", "description": "" }, { "id": "MIM:603956", "resource": "MIM", "url": "https://www.omim.org/entry/603956", "name": "Cervical cancer", "description": "Cervical cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "55.63", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000137869", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137869" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "41.27", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000137869", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137869" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "48.25", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000137869", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137869" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "60.61", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000137869", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137869" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "56.47", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000137869", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137869" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "56.87", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000137869", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137869" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000137869", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137869" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "57.61", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000137869", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137869" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "70.74", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000137869", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137869" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000137869", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137869" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "32.11", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000137869", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137869" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "54.24", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000137869", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137869" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "56.41", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000137869", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137869" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P11511", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11511" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P11511", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11511" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P11511", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11511" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P11511", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11511" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P11511", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11511" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P11511", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11511" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P11511", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11511" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P11511", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11511" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P11511", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11511" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P11511", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11511" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P11511", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11511" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P11511", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11511" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "common_name": "Human" } ], "gene": [ { "name": "CYP19A1", "url": "https://www.uniprot.org/uniprot/P11511", "locus": { "chromosome": "15", "start_pos": 51208057, "end_pos": 51338601, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000137869", "url": "https://www.ensembl.org/id/ENSG00000137869" } ] } } ], "crossref": [ { "id": "ENSG00000137869", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137869", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P11511", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P11511", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "1.14.14.14", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.14.14.14&UniProtAcc=P11511", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd20616", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20616", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL1978", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1978", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "CYP19A1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CYP19A1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "1588", "url": "https://www.ncbi.nlm.nih.gov/gene/1588", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "2594", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=2594", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P11511", "url": "https://www.ebi.ac.uk/intact/interactors/id:P11511*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001128", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001128", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002401", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002401", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017972", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017972", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036396", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036396", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:1588", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1588", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "107910", "url": "http://www.omim.org/entry/107910", "database": "MIM", "categories": [ "Other" ] }, { "id": "139300", "url": "http://www.omim.org/entry/139300", "database": "MIM", "categories": [ "Other" ] }, { "id": "613546", "url": "http://www.omim.org/entry/613546", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P11511", "url": "https://www.nextprot.org/entry/NX_P11511", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "PGLQCIG", "url": "https://omabrowser.org/oma/group/PGLQCIG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5385594at2759", "url": "http://www.orthodb.org/?query=5385594at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24291", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24291", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24291:SF43", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24291:SF43", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3EQM", "url": "https://www.rcsb.org/structure/3EQM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3S79", "url": "https://www.rcsb.org/structure/3S79", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3S7S", "url": "https://www.rcsb.org/structure/3S7S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4GL5", "url": "https://www.rcsb.org/structure/4GL5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4GL7", "url": "https://www.rcsb.org/structure/4GL7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4KQ8", "url": "https://www.rcsb.org/structure/4KQ8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5JKV", "url": "https://www.rcsb.org/structure/5JKV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5JKW", "url": "https://www.rcsb.org/structure/5JKW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5JL6", "url": "https://www.rcsb.org/structure/5JL6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5JL7", "url": "https://www.rcsb.org/structure/5JL7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5JL9", "url": "https://www.rcsb.org/structure/5JL9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00067", "url": "http://pfam.xfam.org/family/PF00067", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P11511", "url": "https://pharos.nih.gov/targets/P11511", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P11511", "url": "http://purl.obolibrary.org/obo/PR_P11511", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-193144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193144", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5579030", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5579030", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000094", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000094", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "38191", "url": "https://www.rhea-db.org/rhea/38191", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "38195", "url": "https://www.rhea-db.org/rhea/38195", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "38199", "url": "https://www.rhea-db.org/rhea/38199", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "38203", "url": "https://www.rhea-db.org/rhea/38203", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "38207", "url": "https://www.rhea-db.org/rhea/38207", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "47208", "url": "https://www.rhea-db.org/rhea/47208", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "53200", "url": "https://www.rhea-db.org/rhea/53200", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "53204", "url": "https://www.rhea-db.org/rhea/53204", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "53276", "url": "https://www.rhea-db.org/rhea/53276", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "E7EPL6", "url": "https://www.uniprot.org/uniprot/E7EPL6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EPL6-1", "url": "https://www.uniprot.org/uniprot/E7EPL6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EQ08", "url": "https://www.uniprot.org/uniprot/E7EQ08", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EQ08-1", "url": "https://www.uniprot.org/uniprot/E7EQ08-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PGZ6", "url": "https://www.uniprot.org/uniprot/E9PGZ6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PGZ6-1", "url": "https://www.uniprot.org/uniprot/E9PGZ6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YK57", "url": "https://www.uniprot.org/uniprot/H0YK57", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YK57-1", "url": "https://www.uniprot.org/uniprot/H0YK57-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YKN1", "url": "https://www.uniprot.org/uniprot/H0YKN1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YKN1-1", "url": "https://www.uniprot.org/uniprot/H0YKN1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YLP1", "url": "https://www.uniprot.org/uniprot/H0YLP1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YLP1-1", "url": "https://www.uniprot.org/uniprot/H0YLP1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YLS2", "url": "https://www.uniprot.org/uniprot/H0YLS2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YLS2-1", "url": "https://www.uniprot.org/uniprot/H0YLS2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YNJ7", "url": "https://www.uniprot.org/uniprot/H0YNJ7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YNJ7-1", "url": "https://www.uniprot.org/uniprot/H0YNJ7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P11511-1", "url": "https://www.uniprot.org/uniprot/P11511-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P11511-2", "url": "https://www.uniprot.org/uniprot/P11511-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWLYKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFATELILAEKRGDLTRENVNQCILEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQKLKVMENFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAKNVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLHPDETKNMLEMIFTPRNSDRCLEH", "length": 503, "header": "sp|P11511-1|CP19A_HUMAN Isoform 1 of Aromatase OS=Homo sapiens OX=9606 GN=CYP19A1 PE=1 SV=3 CANONICAL=P11511-1" }, "isoforms": [ { "isoform_ac": "E7EPL6-1", "url": "", "sequence": { "sequence": "MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWLYK", "length": 242, "header": "tr|E7EPL6-1|E7EPL6_HUMAN Computationally mapped isoform of Cytochrome P450 family 19 subfamily A member 1 OS=Homo sapiens OX=9606 GN=CYP19A1 PE=1 SV=2 CANONICAL=P11511-1" }, "locus": { "chromosome": "15", "start_pos": 51242912, "end_pos": 51218558, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000453807.6", "url": "https://www.ensembl.org/id/ENST00000453807.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000391139.2", "url": "https://www.ensembl.org/id/ENSP00000391139.2" } ] } }, { "isoform_ac": "E7EQ08-1", "url": "", "sequence": { "sequence": "MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWLYKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFATELILAEKRGDLTRENVNQCILEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQK", "length": 352, "header": "tr|E7EQ08-1|E7EQ08_HUMAN Computationally mapped isoform of Aromatase OS=Homo sapiens OX=9606 GN=CYP19A1 PE=1 SV=2 CANONICAL=P11511-1" }, "locus": { "chromosome": "15", "start_pos": 51242912, "end_pos": 51212527, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000557934.5", "url": "https://www.ensembl.org/id/ENST00000557934.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000454004.1", "url": "https://www.ensembl.org/id/ENSP00000454004.1" } ] } }, { "isoform_ac": "E9PGZ6-1", "url": "", "sequence": { "sequence": "MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAE", "length": 166, "header": "tr|E9PGZ6-1|E9PGZ6_HUMAN Computationally mapped isoform of Cytochrome P450 family 19 subfamily A member 1 OS=Homo sapiens OX=9606 GN=CYP19A1 PE=1 SV=2 CANONICAL=P11511-1" }, "locus": { "chromosome": "15", "start_pos": 51242912, "end_pos": 51222479, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000405011.6", "url": "https://www.ensembl.org/id/ENST00000405011.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000384389.2", "url": "https://www.ensembl.org/id/ENSP00000384389.2" } ] } }, { "isoform_ac": "H0YK57-1", "url": "", "sequence": { "sequence": "XDLTRENVNQCILEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQKLKVMENFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAKNVRALP", "length": 138, "header": "tr|H0YK57-1|H0YK57_HUMAN Computationally mapped isoform of Aromatase OS=Homo sapiens OX=9606 GN=CYP19A1 PE=1 SV=1 CANONICAL=P11511-1" }, "locus": { "chromosome": "15", "start_pos": 51215224, "end_pos": 51212303, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000559653.1", "url": "https://www.ensembl.org/id/ENST00000559653.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000452667.1", "url": "https://www.ensembl.org/id/ENSP00000452667.1" } ] } }, { "isoform_ac": "H0YKN1-1", "url": "", "sequence": { "sequence": "MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHL", "length": 172, "header": "tr|H0YKN1-1|H0YKN1_HUMAN Computationally mapped isoform of Cytochrome P450 family 19 subfamily A member 1 OS=Homo sapiens OX=9606 GN=CYP19A1 PE=1 SV=1 CANONICAL=P11511-1" }, "locus": { "chromosome": "15", "start_pos": 51242912, "end_pos": 51222461, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000559980.5", "url": "https://www.ensembl.org/id/ENST00000559980.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000452872.1", "url": "https://www.ensembl.org/id/ENSP00000452872.1" } ] } }, { "isoform_ac": "H0YLP1-1", "url": "", "sequence": { "sequence": "MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWLYKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFATELI", "length": 283, "header": "tr|H0YLP1-1|H0YLP1_HUMAN Computationally mapped isoform of Cytochrome P450 family 19 subfamily A member 1 OS=Homo sapiens OX=9606 GN=CYP19A1 PE=1 SV=1 CANONICAL=P11511-1" }, "locus": { "chromosome": "15", "start_pos": 51242912, "end_pos": 51215712, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000558328.5", "url": "https://www.ensembl.org/id/ENST00000558328.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000453280.1", "url": "https://www.ensembl.org/id/ENSP00000453280.1" } ] } }, { "isoform_ac": "H0YLS2-1", "url": "", "sequence": { "sequence": "MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVC", "length": 164, "header": "tr|H0YLS2-1|H0YLS2_HUMAN Computationally mapped isoform of Cytochrome P450 family 19 subfamily A member 1 OS=Homo sapiens OX=9606 GN=CYP19A1 PE=1 SV=8 CANONICAL=P11511-1" }, "locus": { "chromosome": "15", "start_pos": 51242912, "end_pos": 51222485, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000559646.1", "url": "https://www.ensembl.org/id/ENST00000559646.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000453318.1", "url": "https://www.ensembl.org/id/ENSP00000453318.1" } ] } }, { "isoform_ac": "H0YNJ7-1", "url": "", "sequence": { "sequence": "MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRPFFMKESAIVVKIQGYFDAWQALLIKPDIFFKISWLYKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFATELILAEKRGDLTRENVNQCILEM", "length": 244, "header": "tr|H0YNJ7-1|H0YNJ7_HUMAN Computationally mapped isoform of Cytochrome P450 family 19 subfamily A member 1 OS=Homo sapiens OX=9606 GN=CYP19A1 PE=1 SV=1 CANONICAL=P11511-1" }, "locus": { "chromosome": "15", "start_pos": 51242912, "end_pos": 51215182, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000561075.5", "url": "https://www.ensembl.org/id/ENST00000561075.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000454039.1", "url": "https://www.ensembl.org/id/ENSP00000454039.1" } ] } }, { "isoform_ac": "P11511-1", "url": "", "sequence": { "sequence": "MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWLYKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFATELILAEKRGDLTRENVNQCILEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQKLKVMENFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAKNVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLHPDETKNMLEMIFTPRNSDRCLEH", "length": 503, "header": "sp|P11511-1|CP19A_HUMAN Isoform 1 of Aromatase OS=Homo sapiens OX=9606 GN=CYP19A1 PE=1 SV=3 CANONICAL=P11511-1" }, "locus": { "chromosome": "15", "start_pos": 51242912, "end_pos": 51210811, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000559878.5", "url": "https://www.ensembl.org/id/ENST00000559878.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000453149.1", "url": "https://www.ensembl.org/id/ENSP00000453149.1" } ] } }, { "isoform_ac": "P11511-2", "url": "", "sequence": { "sequence": "MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLDTSNTLFLRIPLDGTEIFTLTS", "length": 218, "header": "sp|P11511-2|CP19A_HUMAN Isoform 2 of Aromatase OS=Homo sapiens OX=9606 GN=CYP19A1 PE=1 SV=3 CANONICAL=P11511-1" }, "locus": { "chromosome": "15", "start_pos": 51242912, "end_pos": 51222323, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000405913.7", "url": "https://www.ensembl.org/id/ENST00000405913.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000383930.3", "url": "https://www.ensembl.org/id/ENSP00000383930.3" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 118, "end_pos": 118, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11511", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11511" }, { "database": "PubMed", "id": "18822378", "url": "https://glygen.org/publication/PubMed/18822378" } ], "site_lbl": "Ser118" }, { "start_pos": 162, "end_pos": 162, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11511", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11511" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "phospho.ELM", "id": "P11511", "url": "http://phospho.elm.eu.org/byAccession/P11511.html" } ], "site_lbl": "Thr162" }, { "start_pos": 220, "end_pos": 220, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11511", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11511" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ], "site_lbl": "Tyr220" }, { "start_pos": 361, "end_pos": 361, "kinase_uniprot_canonical_ac": "P12931-1", "kinase_gene_name": "SRC", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11511", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11511" }, { "database": "PubMed", "id": "19556341", "url": "https://glygen.org/publication/PubMed/19556341" } ], "site_lbl": "Tyr361" }, { "start_pos": 392, "end_pos": 392, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11511", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11511" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Thr392" } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Structure and functions of human oxysterol 7alpha-hydroxylase cDNAs and gene CYP7B1.", "journal": "Journal of lipid research", "date": "1999", "authors": "Wu Z, Martin KO, Javitt NB, Chiang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "10588945", "url": "https://glygen.org/publication/PubMed/10588945" } ] }, { "title": "Breast cancer risk associated with polymorphism in CYP19 in Japanese women.", "journal": "International journal of cancer", "date": "2000", "authors": "Miyoshi Y, Iwao K, Ikeda N, Egawa C, Noguchi S", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "reference": [ { "type": "PubMed", "id": "10956405", "url": "https://glygen.org/publication/PubMed/10956405" } ] }, { "title": "Role of human cytochrome P450 1A1, 1A2, 1B1, and 3A4 in the 2-, 4-, and 16alpha-hydroxylation of 17beta-estradiol.", "journal": "Metabolism: clinical and experimental", "date": "2001", "authors": "Badawi AF, Cavalieri EL, Rogan EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "11555828", "url": "https://glygen.org/publication/PubMed/11555828" } ] }, { "title": "Approval summary: letrozole in the treatment of postmenopausal women with advanced breast cancer.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2002", "authors": "Cohen MH, Johnson JR, Li N, Chen G, Pazdur R", "evidence": [ { "database": "Reactome", "id": "R-HSA-193144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193144" } ], "reference": [ { "type": "PubMed", "id": "11895893", "url": "https://glygen.org/publication/PubMed/11895893" } ] }, { "title": "Aromatase and breast cancer: W39R, an inactive protein.", "journal": "European journal of endocrinology", "date": "2002", "authors": "Nativelle-Serpentini C, Lambard S, Seralini GE, Sourdaine P", "evidence": [ { "database": "Entrez", "id": "1588", "url": "https://www.ncbi.nlm.nih.gov/gene/1588" } ], "reference": [ { "type": "PubMed", "id": "11916629", "url": "https://glygen.org/publication/PubMed/11916629" } ] }, { "title": "An overview of the pharmacology and pharmacokinetics of the newer generation aromatase inhibitors anastrozole, letrozole, and exemestane.", "journal": "Cancer", "date": "2002", "authors": "Buzdar AU, Robertson JF, Eiermann W, Nabholtz JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-193144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193144" } ], "reference": [ { "type": "PubMed", "id": "12404296", "url": "https://glygen.org/publication/PubMed/12404296" } ] }, { "title": "17 beta-hydroxysteroid dehydrogenase type XI localizes to human steroidogenic cells.", "journal": "Endocrinology", "date": "2003", "authors": "Chai Z, Brereton P, Suzuki T, Sasano H, Obeyesekere V, Escher G, Saffery R, Fuller P, Enriquez C, Krozowski Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-193144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193144" } ], "reference": [ { "type": "PubMed", "id": "12697717", "url": "https://glygen.org/publication/PubMed/12697717" } ] }, { "title": "Biochemical and molecular genetic analyses on placental aromatase (P-450AROM) deficiency.", "journal": "J. Biol. Chem.", "date": "1992", "authors": "Harada N, Ogawa H, Shozu M, Yamada K, Suhara K, Nishida E, Takagi Y", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "reference": [ { "type": "PubMed", "id": "1371509", "url": "https://glygen.org/publication/PubMed/1371509" } ] }, { "title": "Dysmetabolic syndrome in a man with a novel mutation of the aromatase gene: effects of testosterone, alendronate, and estradiol treatment.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2004", "authors": "Maffei L, Murata Y, Rochira V, Tubert G, Aranda C, Vazquez M, Clyne CD, Davis S, Simpson ER, Carani C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5579030", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5579030" } ], "reference": [ { "type": "PubMed", "id": "14715828", "url": "https://glygen.org/publication/PubMed/14715828" } ] }, { "title": "Bietti crystalline corneoretinal dystrophy is caused by mutations in the novel gene CYP4V2.", "journal": "American journal of human genetics", "date": "2004", "authors": "Li A, Jiao X, Munier FL, Schorderet DF, Yao W, Iwata F, Hayakawa M, Kanai A, Shy Chen M, Alan Lewis R, Heckenlively J, Weleber RG, Traboulsi EI, Zhang Q, Xiao X, Kaiser-Kupfer M, Sergeev YV, Hejtmancik JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "15042513", "url": "https://glygen.org/publication/PubMed/15042513" } ] }, { "title": "HPMA copolymer-aminoglutethimide conjugates inhibit aromatase in MCF-7 cell lines.", "journal": "Journal of drug targeting", "date": "2005", "authors": "Greco F, Vicent MJ, Penning NA, Nicholson RI, Duncan R", "evidence": [ { "database": "Reactome", "id": "R-HSA-193144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193144" } ], "reference": [ { "type": "PubMed", "id": "16332571", "url": "https://glygen.org/publication/PubMed/16332571" } ] }, { "title": "[Effect of R264C polymorphism in CYP19A1 gene on BRCA1/2-negative hereditary breast cancer from Shanghai population of China].", "journal": "Zhonghua yi xue yi chuan xue za zhi = Zhonghua yixue yichuanxue zazhi = Chinese journal of medical genetics", "date": "2006", "authors": "Song CG, Hu Z, Yuan WT, Di GH, Shen ZZ, Huang W, Shao ZM", "evidence": [ { "database": "Entrez", "id": "1588", "url": "https://www.ncbi.nlm.nih.gov/gene/1588" } ], "reference": [ { "type": "PubMed", "id": "16604491", "url": "https://glygen.org/publication/PubMed/16604491" } ] }, { "title": "A probability-based approach for high-throughput protein phosphorylation analysis and site localization.", "journal": "Nature biotechnology", "date": "2006", "authors": "Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "P11511-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11511-1" } ], "reference": [ { "type": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" } ] }, { "title": "Structural and biochemical characterization of human orphan DHRS10 reveals a novel cytosolic enzyme with steroid dehydrogenase activity.", "journal": "The Biochemical journal", "date": "2007", "authors": "Lukacik P, Keller B, Bunkoczi G, Kavanagh KL, Lee WH, Adamski J, Oppermann U", "evidence": [ { "database": "Reactome", "id": "R-HSA-193144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193144" } ], "reference": [ { "type": "PubMed", "id": "17067289", "url": "https://glygen.org/publication/PubMed/17067289" } ] }, { "title": "Characterization of human sterol 27-hydroxylase. A mitochondrial cytochrome P-450 that catalyzes multiple oxidation reaction in bile acid biosynthesis.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Cali JJ, Russell DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "1708392", "url": "https://glygen.org/publication/PubMed/1708392" } ] }, { "title": "Role of steroid 11 beta-hydroxylase and steroid 18-hydroxylase in the biosynthesis of glucocorticoids and mineralocorticoids in humans.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Kawamoto T, Mitsuuchi Y, Toda K, Yokoyama Y, Miyahara K, Miura S, Ohnishi T, Ichikawa Y, Nakao K, Imura H, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "1741400", "url": "https://glygen.org/publication/PubMed/1741400" } ] }, { "title": "Fadrozole hydrochloride: a potent, selective, nonsteroidal inhibitor of aromatase for the treatment of estrogen-dependent disease.", "journal": "Journal of medicinal chemistry", "date": "1991", "authors": "Browne LJ, Gude C, Rodriguez H, Steele RE, Bhatnager A", "evidence": [ { "database": "Reactome", "id": "R-HSA-193144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193144" } ], "reference": [ { "type": "PubMed", "id": "1825337", "url": "https://glygen.org/publication/PubMed/1825337" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "P11511-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11511-1" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "Aromatase is phosphorylated in situ at serine-118.", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "2008", "authors": "Miller TW, Shin I, Kagawa N, Evans DB, Waterman MR, Arteaga CL", "evidence": [ { "database": "iPTMnet", "id": "P11511", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11511" } ], "reference": [ { "type": "PubMed", "id": "18822378", "url": "https://glygen.org/publication/PubMed/18822378" } ] }, { "title": "DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome.", "journal": "Nature", "date": "2008", "authors": "Ley TJ, Mardis ER, Ding L, Fulton B, McLellan MD, Chen K, Dooling D, Dunford-Shore BH, McGrath S, Hickenbotham M, Cook L, Abbott R, Larson DE, Koboldt DC, Pohl C, Smith S, Hawkins A, Abbott S, Locke D, Hillier LW, Miner T, Fulton L, Magrini V, Wylie T, Glasscock J, Conyers J, Sander N, Shi X, Osborne JR, Minx P, Gordon D, Chinwalla A, Zhao Y, Ries RE, Payton JE, Westervelt P, Tomasson MH, Watson M, Baty J, Ivanovich J, Heath S, Shannon WD, Nagarajan R, Walter MJ, Link DC, Graubert TA, DiPersio JF, Wilson RK", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "reference": [ { "type": "PubMed", "id": "18987736", "url": "https://glygen.org/publication/PubMed/18987736" } ] }, { "title": "Integrated view on 17beta-hydroxysteroid dehydrogenases.", "journal": "Molecular and cellular endocrinology", "date": "2009", "authors": "Moeller G, Adamski J", "evidence": [ { "database": "Reactome", "id": "R-HSA-193144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193144" } ], "reference": [ { "type": "PubMed", "id": "19027824", "url": "https://glygen.org/publication/PubMed/19027824" } ] }, { "title": "Structural basis for androgen specificity and oestrogen synthesis in human aromatase.", "journal": "Nature", "date": "2009", "authors": "Ghosh D, Griswold J, Erman M, Pangborn W", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "reference": [ { "type": "PubMed", "id": "19129847", "url": "https://glygen.org/publication/PubMed/19129847" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "P11511-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11511-1" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "CYP17 (T34C), CYP19 (Trp39Arg), and FGFR2 (C906T) polymorphisms and the risk of breast cancer in south Indian women.", "journal": "Asian Pacific journal of cancer prevention : APJCP", "date": "2009", "authors": "Samson M, Rama R, Swaminathan R, Sridevi V, Nancy KN, Rajkumar T", "evidence": [ { "database": "Entrez", "id": "1588", "url": "https://www.ncbi.nlm.nih.gov/gene/1588" } ], "reference": [ { "type": "PubMed", "id": "19469636", "url": "https://glygen.org/publication/PubMed/19469636" } ] }, { "title": "Rapid estradiol/ERalpha signaling enhances aromatase enzymatic activity in breast cancer cells.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2009", "authors": "Catalano S, Barone I, Giordano C, Rizza P, Qi H, Gu G, Malivindi R, Bonofiglio D, Ando S", "evidence": [ { "database": "iPTMnet", "id": "P11511", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11511" } ], "reference": [ { "type": "PubMed", "id": "19556341", "url": "https://glygen.org/publication/PubMed/19556341" } ] }, { "title": "Expression and characterization of CYP4V2 as a fatty acid omega-hydroxylase.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2009", "authors": "Nakano M, Kelly EJ, Rettie AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "19661213", "url": "https://glygen.org/publication/PubMed/19661213" } ] }, { "title": "Association between CYP19 polymorphisms and breast cancer risk: results from 10,592 cases and 11,720 controls.", "journal": "Breast cancer research and treatment", "date": "2010", "authors": "Ma X, Qi X, Chen C, Lin H, Xiong H, Li Y, Jiang J", "evidence": [ { "database": "Entrez", "id": "1588", "url": "https://www.ncbi.nlm.nih.gov/gene/1588" } ], "reference": [ { "type": "PubMed", "id": "20052540", "url": "https://glygen.org/publication/PubMed/20052540" } ] }, { "title": "CYP17 (T-34C) and CYP19 (Trp39Arg) polymorphisms and their cooperative effects on breast cancer susceptibility.", "journal": "In vivo (Athens, Greece)", "date": "2010", "authors": "Tuzuner BM, Ozturk T, Kisakesen HI, Ilvan S, Zerrin C, Ozturk O, Isbir T", "evidence": [ { "database": "Entrez", "id": "1588", "url": "https://www.ncbi.nlm.nih.gov/gene/1588" } ], "reference": [ { "type": "PubMed", "id": "20133979", "url": "https://glygen.org/publication/PubMed/20133979" } ] }, { "title": "Structural basis of human CYP51 inhibition by antifungal azoles.", "journal": "Journal of molecular biology", "date": "2010", "authors": "Strushkevich N, Usanov SA, Park HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "20149798", "url": "https://glygen.org/publication/PubMed/20149798" } ] }, { "title": "Kinetic analysis of the three-step steroid aromatase reaction of human cytochrome P450 19A1.", "journal": "The Journal of biological chemistry", "date": "2010-06-04", "authors": "Sohl Christal D, Guengerich F Peter", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "reference": [ { "type": "PubMed", "id": "20385561", "url": "https://glygen.org/publication/PubMed/20385561" } ] }, { "title": "Tissue-specific expression of human P-450AROM. The promoter responsible for expression in adipose tissue is different from that utilized in placenta.", "journal": "J. Biol. Chem.", "date": "1991", "authors": "Mahendroo M S, Means G D, Mendelson C R, Simpson E R", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "reference": [ { "type": "PubMed", "id": "2040633", "url": "https://glygen.org/publication/PubMed/2040633" } ] }, { "title": "Highly selective inhibition of estrogen biosynthesis by CGS 20267, a new non-steroidal aromatase inhibitor.", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "1990", "authors": "Bhatnagar AS, Hausler A, Schieweck K, Lang M, Bowman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-193144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193144" } ], "reference": [ { "type": "PubMed", "id": "2149502", "url": "https://glygen.org/publication/PubMed/2149502" } ] }, { "title": "Structural basis for pregnenolone biosynthesis by the mitochondrial monooxygenase system.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Strushkevich N, MacKenzie F, Cherkesova T, Grabovec I, Usanov S, Park HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "21636783", "url": "https://glygen.org/publication/PubMed/21636783" } ] }, { "title": "Structural and functional characterization of human aromatase P-450 gene.", "journal": "European journal of biochemistry", "date": "1990", "authors": "Toda K, Terashima M, Kawamoto T, Sumimoto H, Yokoyama Y, Kuribayashi I, Mitsuuchi Y, Maeda T, Yamamoto Y, Sagara Y, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-193144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193144" } ], "reference": [ { "type": "PubMed", "id": "2171939", "url": "https://glygen.org/publication/PubMed/2171939" } ] }, { "title": "Cloning and expression of a cDNA for human cytochrome P-450aldo as related to primary aldosteronism.", "journal": "Biochemical and biophysical research communications", "date": "1990", "authors": "Kawainoto T, Mitsuuchi Y, Ohnishi T, Ichikawa Y, Yokoyama Y, Sumimoto H, Toda K, Miyahara K, Kuribayashi I, Nakao K, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "2256920", "url": "https://glygen.org/publication/PubMed/2256920" } ] }, { "title": "CYP4V2 in Bietti's crystalline dystrophy: ocular localization, metabolism of omega-3-polyunsaturated fatty acids, and functional deficit of the p.H331P variant.", "journal": "Molecular pharmacology", "date": "2012", "authors": "Nakano M, Kelly EJ, Wiek C, Hanenberg H, Rettie AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "22772592", "url": "https://glygen.org/publication/PubMed/22772592" } ] }, { "title": "Oxidation of dihydrotestosterone by human cytochromes P450 19A1 and 3A4.", "journal": "The Journal of biological chemistry", "date": "2012-08-24", "authors": "Cheng Qian, Sohl Christal D, Yoshimoto Francis K, Guengerich F Peter", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "reference": [ { "type": "PubMed", "id": "22773874", "url": "https://glygen.org/publication/PubMed/22773874" } ] }, { "title": "17beta-Hydroxysteroid dehydrogenase type 14 is a predictive marker for tamoxifen response in oestrogen receptor positive breast cancer.", "journal": "PloS one", "date": "2012", "authors": "Sivik T, Gunnarsson C, Fornander T, Nordenskjold B, Skoog L, Stal O, Jansson A", "evidence": [ { "database": "Reactome", "id": "R-HSA-193144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193144" } ], "reference": [ { "type": "PubMed", "id": "22792371", "url": "https://glygen.org/publication/PubMed/22792371" } ] }, { "title": "Characterization of a novel CYP19A1 (aromatase) R192H mutation causing virilization of a 46,XX newborn, undervirilization of the 46,XY brother, but no virilization of the mother during pregnancies.", "journal": "Molecular and cellular endocrinology", "date": "2014", "authors": "Bouchoucha N, Samara-Boustani D, Pandey AV, Bony-Trifunovic H, Hofer G, Aigrain Y, Polak M, Fluck CE", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "reference": [ { "type": "PubMed", "id": "24705274", "url": "https://glygen.org/publication/PubMed/24705274" } ] }, { "title": "Alternative usage of different poly(A) addition signals for two major species of mRNA encoding human aromatase P-450.", "journal": "FEBS Lett.", "date": "1989", "authors": "Toda K, Terashima M, Mitsuuchi Y, Yamasaki Y, Yokoyama Y, Nojima S, Ushiro H, Maeda T, Yamamoto Y, Sagara Y", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "reference": [ { "type": "PubMed", "id": "2541021", "url": "https://glygen.org/publication/PubMed/2541021" } ] }, { "title": "Aldo-keto Reductase 1B15 (AKR1B15): a mitochondrial human aldo-keto reductase with activity toward steroids and 3-keto-acyl-CoA conjugates.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Weber S, Salabei JK, Moller G, Kremmer E, Bhatnagar A, Adamski J, Barski OA", "evidence": [ { "database": "Reactome", "id": "R-HSA-193144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193144" } ], "reference": [ { "type": "PubMed", "id": "25577493", "url": "https://glygen.org/publication/PubMed/25577493" } ] }, { "title": "Characterization of two genes encoding human steroid 11 beta-hydroxylase (P-450(11) beta).", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Mornet E, Dupont J, Vitek A, White PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "2592361", "url": "https://glygen.org/publication/PubMed/2592361" } ] }, { "title": "17beta-Hydroxysteroid Dehydrogenase Type 2 Inhibition: Discovery of Selective and Metabolically Stable Compounds Inhibiting Both the Human Enzyme and Its Murine Ortholog.", "journal": "PloS one", "date": "2015", "authors": "Gargano EM, Allegretta G, Perspicace E, Carotti A, Van Koppen C, Frotscher M, Marchais-Oberwinkler S, Hartmann RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-193144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193144" } ], "reference": [ { "type": "PubMed", "id": "26230928", "url": "https://glygen.org/publication/PubMed/26230928" } ] }, { "title": "Expression of human placental aromatase in Saccharomyces cerevisiae.", "journal": "Mol. Endocrinol.", "date": "1989", "authors": "Pompon D, Liu R Y, Besman M J, Wang P L, Shively J E, Chen S", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "reference": [ { "type": "PubMed", "id": "2691883", "url": "https://glygen.org/publication/PubMed/2691883" } ] }, { "title": "A dominant variant in DMXL2 is linked to nonsyndromic hearing loss.", "journal": "Genetics in medicine : official journal of the American College of Medical Genetics", "date": "2017", "authors": "Chen DY, Liu XF, Lin XJ, Zhang D, Chai YC, Yu DH, Sun CL, Wang XL, Zhu WD, Chen Y, Sun LH, Wang XW, Shi FX, Huang ZW, Yang T, Wu H", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "reference": [ { "type": "PubMed", "id": "27657680", "url": "https://glygen.org/publication/PubMed/27657680" } ] }, { "title": "Impact of R264C and R264H polymorphisms in human aromatase function.", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "2017", "authors": "Baravalle R, Di Nardo G, Bandino A, Barone I, Catalano S, Ando S, Gilardi G", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "reference": [ { "type": "PubMed", "id": "27702664", "url": "https://glygen.org/publication/PubMed/27702664" } ] }, { "title": "Structural analysis of the gene encoding human aromatase cytochrome P-450, the enzyme responsible for estrogen biosynthesis.", "journal": "J. Biol. Chem.", "date": "1989", "authors": "Means G D, Mahendroo M S, Corbin C J, Mathis J M, Powell F E, Mendelson C R, Simpson E R", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "reference": [ { "type": "PubMed", "id": "2808431", "url": "https://glygen.org/publication/PubMed/2808431" } ] }, { "title": "Isolation of a full-length cDNA insert encoding human aromatase system cytochrome P-450 and its expression in nonsteroidogenic cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1988", "authors": "Corbin CJ, Graham-Lorence S, McPhaul M, Mason JI, Mendelson CR, Simpson ER", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "reference": [ { "type": "PubMed", "id": "2848247", "url": "https://glygen.org/publication/PubMed/2848247" } ] }, { "title": "Cloning of a complete cDNA encoding human aromatase: immunochemical identification and sequence analysis.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1988", "authors": "Harada N", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "reference": [ { "type": "PubMed", "id": "2973313", "url": "https://glygen.org/publication/PubMed/2973313" } ] }, { "title": "Isolation and characterization of a complementary DNA specific for human aromatase-system cytochrome P-450 mRNA.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1986", "authors": "Evans C T, Ledesma D B, Schulz T Z, Simpson E R, Mendelson C R", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "reference": [ { "type": "PubMed", "id": "3018730", "url": "https://glygen.org/publication/PubMed/3018730" } ] }, { "title": "Human cholesterol side-chain cleavage enzyme, P450scc: cDNA cloning, assignment of the gene to chromosome 15, and expression in the placenta.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986", "authors": "Chung BC, Matteson KJ, Voutilainen R, Mohandas TK, Miller WL", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "3024157", "url": "https://glygen.org/publication/PubMed/3024157" } ] }, { "title": "Molecular characterization of the HLA-linked steroid 21-hydroxylase B gene from an individual with congenital adrenal hyperplasia.", "journal": "The EMBO journal", "date": "1987", "authors": "Rodrigues NR, Dunham I, Yu CY, Carroll MC, Porter RR, Campbell RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "3038528", "url": "https://glygen.org/publication/PubMed/3038528" } ] }, { "title": "Human aromatase: cDNA cloning, Southern blot analysis, and assignment of the gene to chromosome 15.", "journal": "DNA", "date": "1988", "authors": "Chen S A, Besman M J, Sparkes R S, Zollman S, Klisak I, Mohandas T, Hall P F, Shively J E", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "reference": [ { "type": "PubMed", "id": "3390233", "url": "https://glygen.org/publication/PubMed/3390233" } ] }, { "title": "Structure of human steroid 21-hydroxylase genes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986", "authors": "White PC, New MI, Dupont B", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "3487786", "url": "https://glygen.org/publication/PubMed/3487786" } ] }, { "title": "Sequencing of cDNA inserts encoding aromatase cytochrome P-450 (P-450AROM).", "journal": "Molecular and cellular endocrinology", "date": "1987", "authors": "Simpson ER, Evans CT, Corbin CJ, Powell FE, Ledesma DB, Mendelson CR", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "reference": [ { "type": "PubMed", "id": "3653507", "url": "https://glygen.org/publication/PubMed/3653507" } ] }, { "title": "CYP19A1 mediates severe SARS-CoV-2 disease outcome in males.", "journal": "Cell reports. Medicine", "date": "2023-09-19", "authors": "Stanelle-Bertram Stephanie, Beck Sebastian, Mounogou Nancy Kouassi, Schaumburg Berfin, Stoll Fabian, Al Jawazneh Amirah, Schmal Zo\u00e9, Bai Tian, Zickler Martin, Beythien Georg, Becker Kathrin, de la Roi Madeleine, Heinrich Fabian, Schulz Claudia, Sauter Martina, Krasemann Susanne, Lange Philine, Heinemann Axel, van Riel Debby, Leijten Lonneke, Bauer Lisa, van den Bosch Thierry P P, Lopuha\u00e4 Boaz, Busche Tobias, Wibberg Daniel, Schaudien Dirk, Goldmann Torsten, L\u00fcttjohann Anna, Ruschinski Jenny, Jania Hanna, M\u00fcller Zacharias, Pinho Dos Reis Vinicius, Krupp-Buzimkic Vanessa, Wolff Martin, Fallerini Chiara, Baldassarri Margherita, Furini Simone, Norwood Katrina, K\u00e4ufer Christopher, Sch\u00fctzenmeister Nina, von K\u00f6ckritz-Blickwede Maren, Schroeder Maria, Jarczak Dominik, Nierhaus Axel, Welte Tobias, Kluge Stefan, McHardy Alice C, Sommer Frank, Kalinowski J\u00f6rn, Krauss-Etschmann Susanne, Richter Franziska, von der Th\u00fcsen Jan, Baumg\u00e4rtner Wolfgang, Klingel Karin, Ondruschka Benjamin, , Renieri Alessandra, Gabriel G\u00fclsah", "evidence": [ { "database": "RefSeq", "id": "NP_000094", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000094" } ], "reference": [ { "type": "PubMed", "id": "37572667", "url": "https://glygen.org/publication/PubMed/37572667" } ] }, { "title": "CYP19A1 promotes gastric cancer as part of a lipid metabolism-related gene signature related to the response of immunotherapy and prognosis.", "journal": "BMC medical genomics", "date": "2023-10-02", "authors": "Zhou Xinyi, Meng Fanyu, Xiao Linmei, Shen Hua", "evidence": [ { "database": "RefSeq", "id": "NP_000094", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000094" } ], "reference": [ { "type": "PubMed", "id": "37784135", "url": "https://glygen.org/publication/PubMed/37784135" } ] }, { "title": "Intratumoral cortisol associated with aromatase in the endometrial cancer microenvironment.", "journal": "Pathology, research and practice", "date": "2023-11", "authors": "Miki Yasuhiro, Iwabuchi Erina, Takagi Kiyoshi, Yamazaki Yuto, Shibuya Yusuke, Tokunaga Hideki, Shimada Muneaki, Suzuki Takashi, Ito Kiyoshi", "evidence": [ { "database": "RefSeq", "id": "NP_000094", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000094" } ], "reference": [ { "type": "PubMed", "id": "37820440", "url": "https://glygen.org/publication/PubMed/37820440" } ] }, { "title": "SNP of Aromatase Predict Long-term Survival and Aromatase Inhibitor Toxicity in Patients with Early Breast Cancer: A Biomarker Analysis of the GIM4 and GIM5 Trials.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2023-12-15", "authors": "Conte Benedetta, Boni Luca, Bisagni Giancarlo, Durando Antonio, Sanna Giovanni, Gori Stefania, Garrone Ornella, Tamberi Stefano, De Placido Sabino, Schettini Francesco, Pazzola Antonio, Ponzone Riccardo, Montemurro Filippo, Lunardi Gianluigi, Notaro Rosario, De Angioletti Maria, Turletti Anna, Mansutti Mauro, Puglisi Fabio, Frassoldati Antonio, Porpiglia Mauro, Fabi Alessandra, Generali Daniele, Scognamiglio Giovanni, Rossi Maura, Bras\u00f3-Maristany Fara, Prat Aleix, Cardinali Barbara, Piccioli Patrizia, Serra Martina, Lastraioli Sonia, Bighin Claudia, Poggio Francesca, Lambertini Matteo, Del Mastro Lucia", "evidence": [ { "database": "RefSeq", "id": "NP_000094", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000094" } ], "reference": [ { "type": "PubMed", "id": "37888299", "url": "https://glygen.org/publication/PubMed/37888299" } ] }, { "title": "Amino terminal sequence analysis of human placenta aromatase.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1986", "authors": "Chen S, Shively J E, Nakajin S, Shinoda M, Hall P F", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "reference": [ { "type": "PubMed", "id": "3964273", "url": "https://glygen.org/publication/PubMed/3964273" } ] }, { "title": "Inactivation of aromatase in vitro by 4-hydroxy-4-androstene-3,17-dione and 4-acetoxy-4-androstene-3,17-dione and sustained effects in vivo.", "journal": "Steroids", "date": "1981", "authors": "Brodie AM, Garrett WM, Hendrickson JR, Tsai-Morris CH, Marcotte PA, Robinson CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-193144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193144" } ], "reference": [ { "type": "PubMed", "id": "7336466", "url": "https://glygen.org/publication/PubMed/7336466" } ] }, { "title": "Tissue-specific and hormonally controlled alternative promoters regulate aromatase cytochrome P450 gene expression in human adipose tissue.", "journal": "J. Biol. Chem.", "date": "1993", "authors": "Mahendroo M S, Mendelson C R, Simpson E R", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "reference": [ { "type": "PubMed", "id": "7690033", "url": "https://glygen.org/publication/PubMed/7690033" } ] }, { "title": "Aromatase cytochrome P450, the enzyme responsible for estrogen biosynthesis.", "journal": "Endocrine reviews", "date": "1994", "authors": "Simpson ER, Mahendroo MS, Means GD, Kilgore MW, Hinshelwood MM, Graham-Lorence S, Amarneh B, Ito Y, Fisher CR, Michael MD, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-193144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193144" } ], "reference": [ { "type": "PubMed", "id": "8076586", "url": "https://glygen.org/publication/PubMed/8076586" } ] }, { "title": "Expression cloning and characterization of human 17 beta-hydroxysteroid dehydrogenase type 2, a microsomal enzyme possessing 20 alpha-hydroxysteroid dehydrogenase activity.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Wu L, Einstein M, Geissler WM, Chan HK, Elliston KO, Andersson S", "evidence": [ { "database": "Reactome", "id": "R-HSA-193144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193144" } ], "reference": [ { "type": "PubMed", "id": "8099587", "url": "https://glygen.org/publication/PubMed/8099587" } ] }, { "title": "Novel exon 1 of the aromatase gene specific for aromatase transcripts in human brain.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1994", "authors": "Honda S, Harada N, Takagi Y", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "reference": [ { "type": "PubMed", "id": "8117272", "url": "https://glygen.org/publication/PubMed/8117272" } ] }, { "title": "Molecular basis of aromatase deficiency in an adult female with sexual infantilism and polycystic ovaries.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Ito Y, Fisher CR, Conte FA, Grumbach MM, Simpson ER", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" }, { "database": "Reactome", "id": "R-HSA-5579030", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5579030" } ], "reference": [ { "type": "PubMed", "id": "8265607", "url": "https://glygen.org/publication/PubMed/8265607" } ] }, { "title": "Aromatase deficiency in male and female siblings caused by a novel mutation and the physiological role of estrogens.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1995", "authors": "Morishima A, Grumbach MM, Simpson ER, Fisher C, Qin K", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" }, { "database": "Reactome", "id": "R-HSA-5579030", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5579030" } ], "reference": [ { "type": "PubMed", "id": "8530621", "url": "https://glygen.org/publication/PubMed/8530621" } ] }, { "title": "The ubiquitously expressed human CYP51 encodes lanosterol 14 alpha-demethylase, a cytochrome P450 whose expression is regulated by oxysterols.", "journal": "Archives of biochemistry and biophysics", "date": "1996", "authors": "Stromstedt M, Rozman D, Waterman MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "8619637", "url": "https://glygen.org/publication/PubMed/8619637" } ] }, { "title": "Effect of testosterone and estradiol in a man with aromatase deficiency.", "journal": "The New England journal of medicine", "date": "1997", "authors": "Carani C, Qin K, Simoni M, Faustini-Fustini M, Serpente S, Boyd J, Korach KS, Simpson ER", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" }, { "database": "Reactome", "id": "R-HSA-5579030", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5579030" } ], "reference": [ { "type": "PubMed", "id": "9211678", "url": "https://glygen.org/publication/PubMed/9211678" } ] }, { "title": "Arginine-cysteine polymorphism at codon 264 of the human CYP19 gene does not affect aromatase activity.", "journal": "Pharmacogenetics", "date": "1997", "authors": "Watanabe J, Harada N, Suemasu K, Higashi Y, Gotoh O, Kawajiri K", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "reference": [ { "type": "PubMed", "id": "9352581", "url": "https://glygen.org/publication/PubMed/9352581" } ] }, { "title": "A critical review of the origin and control of adrenal androgens.", "journal": "Bailliere's clinical obstetrics and gynaecology", "date": "1997", "authors": "McKenna TJ, Fearon U, Clarke D, Cunningham SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "9536209", "url": "https://glygen.org/publication/PubMed/9536209" } ] }, { "title": "Expression of catalytically active human cytochrome p450scc in Escherichia coli and mutagenesis of isoleucine-462.", "journal": "Archives of biochemistry and biophysics", "date": "1998", "authors": "Woods ST, Sadleir J, Downs T, Triantopoulos T, Headlam MJ, Tuckey RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "9578606", "url": "https://glygen.org/publication/PubMed/9578606" } ] }, { "title": "17Beta-hydroxysteroid dehydrogenases in human bone cells.", "journal": "Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research", "date": "1998", "authors": "Dong Y, Qiu QQ, Debear J, Lathrop WF, Bertolini DR, Tamburini PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-193144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193144" } ], "reference": [ { "type": "PubMed", "id": "9783542", "url": "https://glygen.org/publication/PubMed/9783542" } ] } ], "pathway": [ { "id": "hsa:1588", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1588", "resource": "KEGG Pathway" }, { "id": "R-HSA-193144", "name": "Estrogen biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193144", "resource": "Reactome", "description": "Estrogen biosynthesis" }, { "id": "R-HSA-211976", "name": "Endogenous sterols", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976", "resource": "Reactome", "description": "Endogenous sterols" }, { "id": "R-HSA-5579030", "name": "Defective CYP19A1 causes AEXS", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5579030", "resource": "Reactome", "description": "Defective CYP19A1 causes AEXS" } ], "orthologs": [ { "uniprot_canonical_ac": "P22443-1", "protein_name": "Aromatase", "gene_name": "Cyp19a1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MFLEMLNPMHYNVTIMVPETVPVSAMPLLLIMGLLLLIRNCESSSSIPGPGYCLGIGPLISHGRFLWMGIGSACNYYNKMYGEFMRVWISGEETLIISKSSSMVHVMKHSNYISRFGSKRGLQCIGMHENGIIFNNNPSLWRTVRPFFMKALTGPGLIRMVEVCVESIKQHLDRLGDVTDNSGYVDVVTLMRHIMLDTSNTLFLGIPLDESSIVKKIQGYFNAWQALLIKPNIFFKISWLYRKYERSVKDLKDEIEILVEKKRQKVSSAEKLEDCMDFATDLIFAERRGDLTKENVNQCILEMLIAAPDTMSVTLYVMLLLIAEYPEVETAILKEIHTVVGDRDIRIGDVQNLKVVENFINESLRYQPVVDLVMRRALEDDVIDGYPVKKGTNIILNIGRMHRLEYFPKPNEFTLENFEKNVPYRYFQPFGFGPRSCAGKYIAMVMMKVVLVTLLKRFHVKTLQKRCIENMPKNNDLSLHLDEDSPIVEIIFRHIFNTPFLQCLYISL", "length": 508 }, "evidence": [ { "id": "45916791", "url": "http://www.informatics.jax.org/homology/45916791", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P28649-1", "protein_name": "Aromatase", "gene_name": "Cyp19a1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MFLEMLNPMQYNVTIMVPETVTVSAMPLLLIMGLLLLIWNCESSSSIPGPGYCLGIGPLISHGRFLWMGIGSACNYYNKMYGEFMRVWISGEETLIISKSSSMFHVMKHSHYISRFGSKRGLQCIGMHENGIIFNNNPSLWRTIRPFFMKALTGPGLVRMVEVCVESIKQHLDRLGEVTDTSGYVDVLTLMRHIMLDTSNMLFLGIPLDESAIVKKIQGYFNAWQALLIKPNIFFKISWLYRKYERSVKDLKDEIAVLVEKKRHKVSTAEKLEDCMDFATDLIFAERRGDLTKENVNQCILEMLIAAPDTMSVTLYFMLLLVAEYPEVEAAILKEIHTVVGDRDIKIEDIQNLKVVENFINESMRYQPVVDLVMRRALEDDVIDGYPVKKGTNIILNIGRMHRLEYFPKPNEFTLENFEKNVPYRYFQPFGFGPRGCAGKYIAMVMMKVVLVTLLRRFQVKTLQKRCIENIPKKNDLSLHPNEDRHLVEIIFSPRNSDKYLQQ", "length": 503 }, "evidence": [ { "id": "45916791", "url": "http://www.informatics.jax.org/homology/45916791", "database": "MGI" }, { "id": "P11511", "url": "https://omabrowser.org/oma/group/P11511/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 15, "go_terms": [ { "name": "negative regulation of chronic inflammatory response", "id": "GO:0002677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002677", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" }, { "name": "androgen catabolic process", "id": "GO:0006710", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006710", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" }, { "name": "positive regulation of estradiol secretion", "id": "GO:2000866", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000866", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" }, { "name": "female genitalia development", "id": "GO:0030540", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030540", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" }, { "name": "syncytium formation", "id": "GO:0006949", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006949", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" }, { "name": "response to estradiol", "id": "GO:0032355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032355", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" }, { "name": "sterol metabolic process", "id": "GO:0016125", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016125", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" }, { "name": "steroid biosynthetic process", "id": "GO:0006694", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006694", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" }, { "name": "estrogen biosynthetic process", "id": "GO:0006703", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006703", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" }, { "name": "female gonad development", "id": "GO:0008585", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008585", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" }, { "name": "prostate gland growth", "id": "GO:0060736", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060736", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" }, { "name": "testosterone biosynthetic process", "id": "GO:0061370", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061370", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" }, { "name": "mammary gland development", "id": "GO:0030879", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030879", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" }, { "name": "uterus development", "id": "GO:0060065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060065", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" }, { "name": "negative regulation of macrophage chemotaxis", "id": "GO:0010760", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010760", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 9, "go_terms": [ { "name": "aromatase activity", "id": "GO:0070330", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070330", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" }, { "name": "iron ion binding", "id": "GO:0005506", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005506", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" }, { "name": "electron transfer activity", "id": "GO:0009055", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009055", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" }, { "name": "heme binding", "id": "GO:0020037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0020037", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" }, { "name": "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen", "id": "GO:0016712", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016712", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" }, { "name": "steroid hydroxylase activity", "id": "GO:0008395", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008395", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" }, { "name": "oxygen binding", "id": "GO:0019825", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019825", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" }, { "name": "monooxygenase activity", "id": "GO:0004497", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004497", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" }, { "name": "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen", "id": "GO:0016705", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016705", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 12, "end_pos": 14, "annotation": "n_glycosylation_sequon" }, { "start_pos": 180, "end_pos": 182, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated in vitro by PKA and PKG/PRKG1. These phosphorylations inhibit the catalytic activity as measured by estrone synthesis from androstenedione (36% decrease for PKA and 30% for PKG/PRKG1).", "evidence": [ { "database": "UniProtKB", "id": "P11511", "url": "https://www.uniprot.org/uniprot/P11511" }, { "database": "PubMed", "id": "27702664", "url": "https://glygen.org/publication/PubMed/27702664" } ] } ], "interactions": [], "reactions": [ { "id": "38191", "name": "", "equation": "3 O2 + 3 reduced [NADPH--hemoprotein reductase] + testosterone = 17beta-estradiol + formate + 4 H(+) + 4 H2O + 3 oxidized [NADPH--hemoprotein reductase]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P22443-1", "P11511-1", "P28649-1" ], "evidence": [ { "id": "38191", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/38191" } ] }, { "id": "38195", "name": "", "equation": "androst-4-ene-3,17-dione + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = estrone + formate + 4 H(+) + 4 H2O + 3 oxidized [NADPH--hemoprotein reductase]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P22443-1", "P11511-1", "P28649-1" ], "evidence": [ { "id": "38195", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/38195" } ] }, { "id": "38199", "name": "", "equation": "androst-4-ene-3,17-dione + O2 + reduced [NADPH--hemoprotein reductase] = 19-hydroxyandrost-4-ene-3,17-dione + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P11511-1", "P28649-1" ], "evidence": [ { "id": "38199", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/38199" } ] }, { "id": "38203", "name": "", "equation": "19-hydroxyandrost-4-ene-3,17-dione + O2 + reduced [NADPH--hemoprotein reductase] = 19-oxo-androst-4-ene-3,17-dione + H(+) + 2 H2O + oxidized [NADPH--hemoprotein reductase]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P11511-1", "P28649-1" ], "evidence": [ { "id": "38203", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/38203" } ] }, { "id": "38207", "name": "", "equation": "19-oxo-androst-4-ene-3,17-dione + O2 + reduced [NADPH--hemoprotein reductase] = estrone + formate + 2 H(+) + H2O + oxidized [NADPH--hemoprotein reductase]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P11511-1", "P28649-1" ], "evidence": [ { "id": "38207", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/38207" } ] }, { "id": "47208", "name": "", "equation": "estrone + O2 + reduced [NADPH--hemoprotein reductase] = 2-hydroxyestrone + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P00185-1", "P04799-1", "Q64678-1", "P08684-1", "P04798-1", "P05177-1", "Q16678-1", "P11511-1", "P20813-1", "P24462-1", "P11712-1", "P20815-1", "P28649-1", "P00186-1", "P00184-1", "Q64429-1" ], "evidence": [ { "id": "47208", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/47208" } ] }, { "id": "53200", "name": "", "equation": "17beta-hydroxy-5alpha-androstan-3-one + O2 + reduced [NADPH--hemoprotein reductase] = 17beta,19-dihydroxy-3-oxo-5alpha-androstanone + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P08684-1", "P11511-1", "P28649-1" ], "evidence": [ { "id": "53200", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/53200" } ] }, { "id": "53204", "name": "", "equation": "17beta,19-dihydroxy-3-oxo-5alpha-androstanone + O2 + reduced [NADPH--hemoprotein reductase] = 17beta-hydroxy-3,19-dioxo-5alpha-androstanone + H(+) + 2 H2O + oxidized [NADPH--hemoprotein reductase]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P11511-1", "P28649-1" ], "evidence": [ { "id": "53204", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/53204" } ] }, { "id": "53276", "name": "", "equation": "17beta-hydroxy-3,19-dioxo-5alpha-androstanone + O2 + reduced [NADPH--hemoprotein reductase] = 17beta-hydroxy-3-oxo-19-nor-5alpha-androst-1-ene + formate + 2 H(+) + H2O + oxidized [NADPH--hemoprotein reductase]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P11511-1", "P28649-1" ], "evidence": [ { "id": "53276", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/53276" } ] }, { "id": "R-HSA-193060", "name": "CYP19A1 hydroxylates ANDST to E1", "equation": "", "summary": "The conversion of androstenedione (ANDST) to estrone (E1) is catalysed by aromatase (CYP19A1) associated with the endoplasmic reticulum membrane (Toda et al. 1990, Simpson et al. 1994).", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-193079" ], "output_participant_list": [], "enzyme_list": [ "P11511-1" ], "evidence": [ { "id": "R-HSA-193060", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193060" } ] }, { "id": "R-HSA-193143", "name": "CYP19A1 hydroxylates TEST to EST17b", "equation": "", "summary": "The conversion of testosterone to estradiol is catalyzed by aromatase (CYP19A1) associated with the endoplasmic reticulum membrane.", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P11511-1" ], "evidence": [ { "id": "R-HSA-193143", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193143" } ] }, { "id": "R-HSA-5601849", "name": "Defective CYP19A1 does not convert ANDST to E1", "equation": "", "summary": "Aromatase (CYP19A1) catalyses the conversion of androstenedione (ANDST) to estrone (E1). Defects in CYP19A1 can cause aromatase excess syndrome (AEXS; MIM:139300) and aromatase deficiency (AROD; MIM:613546). Affected individuals cannot synthesise endogenous estrogens. In females the lack of estrogen leads to pseudohermaphroditism and progressive virilization at puberty, whereas in males pubertal development is normal. Mutations causing AEXS include C437Y, R375C, R365Q and E210K (Ito et al. 1993, Morishima et al. 1995, Carani et al. 1997, Maffei et al. 2004).", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P11511-1" ], "evidence": [ { "id": "R-HSA-5601849", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5601849" } ] }, { "id": "R-HSA-9707353", "name": "CYP19A1 binds Aromatase inhibitors", "equation": "", "summary": "CYP19A1 (aromatase) is the enzyme that catalyses a key aromatization step in the synthesis of estrogens from androgens. Aromatase inhibitors work by inhibiting the action of the enzyme aromatase (Brodie et al. 1981). Many breast cancers are hormone receptor-positive, meaning their growth is stimulated and/or maintained by the presence of hormones such as estrogen or progesterone. In postmenopausal women, estrogen is primarily derived from the aromatization of adrenally-produced androgens into estrogens by CYP19A1. Aromatase inhibitors are a class of drugs used in the treatment of breast cancer in postmenopausal women by competitively inhibiting CYP19A1. As breast tissue is stimulated by estrogens, decreasing their production is a way of suppressing growth of hormone receptor-positive breast tumours (Chumsri et al. 2011). Aromatase inhibitors can be first-generation (e.g. aminoglutethimide) (Greco et al. 2005), second-generation (e.g. fadrozole) (Browne et al. 1991), and third-generation (e.g. anastrozole, letrozole, and exemestane) (Bhatnagar et al. 1990, Cohen et al. 2002, Buzdar et al. 2002) agents. They can also be divided into type I and type II inhibitors. Type I inhibitors have a steroidal structure similar to androgens and inactivate CYP19A1 irreversibly by blocking the substrate-binding site, and are therefore known as aromatase inactivators. Type II inhibitors are nonsteroidal and their action is reversible.", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P11511-1" ], "evidence": [ { "id": "R-HSA-9707353", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707353" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-193079", "participant_name": "ANDST [cytosol]", "crossref": [ { "id": "C00280", "database": "COMPOUND", "url": "" }, { "id": "16422", "database": "ChEBI", "url": "" }, { "id": "HMDB0000053", "database": "HMDB Metabolite", "url": "" }, { "id": "000004428526", "database": "ZINC", "url": "" }, { "id": "2860", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00280", "database": "COMPOUND", "url": "" }, { "id": "16422", "database": "ChEBI", "url": "" }, { "id": "HMDB0000053", "database": "HMDB Metabolite", "url": "" }, { "id": "000004428526", "database": "ZINC", "url": "" }, { "id": "2860", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "16422", "database": "ChEBI", "url": "" }, { "id": "000004428526", "database": "ZINC", "url": "" }, { "id": "2860", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0000053", "database": "HMDB Metabolite", "url": "" }, { "id": "C00280", "database": "COMPOUND", "url": "" }, { "id": "C00280", "database": "COMPOUND", "url": "" }, { "id": "16422", "database": "ChEBI", "url": "" }, { "id": "HMDB0000053", "database": "HMDB Metabolite", "url": "" }, { "id": "000004428526", "database": "ZINC", "url": "" }, { "id": "2860", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C00280", "database": "COMPOUND", "url": "" }, { "id": "HMDB0000053", "database": "HMDB Metabolite", "url": "" }, { "id": "2860", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000004428526", "database": "ZINC", "url": "" }, { "id": "16422", "database": "ChEBI", "url": "" }, { "id": "C00280", "database": "COMPOUND", "url": "" }, { "id": "16422", "database": "ChEBI", "url": "" }, { "id": "HMDB0000053", "database": "HMDB Metabolite", "url": "" }, { "id": "000004428526", "database": "ZINC", "url": "" }, { "id": "2860", "database": "Guide to Pharmacology - Ligands", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "P00184", "gene_name": "Cyp1a1", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P00184", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00184" } ] }, { "ec_number": "4.2.1.152", "activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.", "evidence": [ { "id": "P00184", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00184" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P00184", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00184" } ] } ] }, { "uniprot_ac": "P00185", "gene_name": "Cyp1a1", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P00185", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00185" } ] }, { "ec_number": "4.2.1.152", "activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.", "evidence": [ { "id": "P00185", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00185" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P00185", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00185" } ] } ] }, { "uniprot_ac": "P00186", "gene_name": "Cyp1a2", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P00186", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00186" } ] }, { "ec_number": "4.2.1.152", "activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.", "evidence": [ { "id": "P00186", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00186" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P00186", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00186" } ] } ] }, { "uniprot_ac": "P04798", "gene_name": "CYP1A1", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P04798", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04798" } ] }, { "ec_number": "4.2.1.152", "activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.", "evidence": [ { "id": "P04798", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04798" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P04798", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04798" } ] } ] }, { "uniprot_ac": "P04799", "gene_name": "Cyp1a2", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P04799", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04799" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P04799", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04799" } ] }, { "ec_number": "4.2.1.152", "activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.", "evidence": [ { "id": "P04799", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04799" } ] } ] }, { "uniprot_ac": "P05177", "gene_name": "CYP1A2", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P05177", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05177" } ] }, { "ec_number": "4.2.1.152", "activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.", "evidence": [ { "id": "P05177", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05177" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P05177", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05177" } ] } ] }, { "uniprot_ac": "P08684", "gene_name": "CYP3A4", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P08684", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08684" } ] }, { "ec_number": "1.14.14.55", "activity": "O2 + quinine + reduced [NADPH--hemoprotein reductase] = 3-hydroxyquinine + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P08684", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08684" } ] }, { "ec_number": "1.14.14.56", "activity": "1,8-cineole + O2 + reduced [NADPH--hemoprotein reductase] = 2-exo-hydroxy-1,8-cineole + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P08684", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08684" } ] }, { "ec_number": "1.14.14.73", "activity": "albendazole + O2 + reduced [NADPH--hemoprotein reductase] = albendazole S-oxide + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P08684", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08684" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P08684", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08684" } ] }, { "ec_number": "1.14.14.-", "activity": "", "evidence": [ { "id": "P08684", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08684" } ] } ] }, { "uniprot_ac": "P11511", "gene_name": "CYP19A1", "activity": [ { "ec_number": "1.14.14.14", "activity": "androst-4-ene-3,17-dione + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = estrone + formate + 4 H(+) + 4 H2O + 3 oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P11511", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11511" } ] }, { "ec_number": "1.14.14.14", "activity": "", "evidence": [ { "id": "P11511", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11511" } ] } ] }, { "uniprot_ac": "P11712", "gene_name": "CYP2C9", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P11712", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11712" } ] }, { "ec_number": "1.14.14.51", "activity": "(4S)-limonene + O2 + reduced [NADPH--hemoprotein reductase] = (1S,5R)-carveol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P11712", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11712" } ] }, { "ec_number": "1.14.14.52", "activity": "(4S)-limonene + O2 + reduced [NADPH--hemoprotein reductase] = (4S)-perillyl alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P11712", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11712" } ] }, { "ec_number": "1.14.14.53", "activity": "(4R)-limonene + O2 + reduced [NADPH--hemoprotein reductase] = (1R,5S)-carveol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P11712", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11712" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P11712", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11712" } ] } ] }, { "uniprot_ac": "P20813", "gene_name": "CYP2B6", "activity": [ { "ec_number": "1.14.13.-", "activity": "", "evidence": [ { "id": "P20813", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20813" } ] } ] }, { "uniprot_ac": "P20815", "gene_name": "CYP3A5", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P20815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20815" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P20815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20815" } ] } ] }, { "uniprot_ac": "P22443", "gene_name": "Cyp19a1", "activity": [ { "ec_number": "1.14.14.14", "activity": "androst-4-ene-3,17-dione + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = estrone + formate + 4 H(+) + 4 H2O + 3 oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P22443", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22443" } ] }, { "ec_number": "1.14.14.14", "activity": "", "evidence": [ { "id": "P22443", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22443" } ] } ] }, { "uniprot_ac": "P24462", "gene_name": "CYP3A7", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P24462", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24462" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P24462", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24462" } ] } ] }, { "uniprot_ac": "P28649", "gene_name": "Cyp19a1", "activity": [ { "ec_number": "1.14.14.14", "activity": "androst-4-ene-3,17-dione + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = estrone + formate + 4 H(+) + 4 H2O + 3 oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P28649", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28649" } ] }, { "ec_number": "1.14.14.14", "activity": "", "evidence": [ { "id": "P28649", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28649" } ] } ] }, { "uniprot_ac": "Q16678", "gene_name": "CYP1B1", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q16678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16678" } ] }, { "ec_number": "4.2.1.152", "activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.", "evidence": [ { "id": "Q16678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16678" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q16678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16678" } ] } ] }, { "uniprot_ac": "Q64429", "gene_name": "Cyp1b1", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q64429", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64429" } ] }, { "ec_number": "4.2.1.152", "activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.", "evidence": [ { "id": "Q64429", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64429" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q64429", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64429" } ] } ] }, { "uniprot_ac": "Q64678", "gene_name": "Cyp1b1", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q64678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64678" } ] }, { "ec_number": "4.2.1.152", "activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.", "evidence": [ { "id": "Q64678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64678" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q64678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64678" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [ 483 ], "glycation_sites": [], "phosphorylation_sites": [ 118, 162, 220, 361, 392 ], "sequon_annotation_sites": [ { "start_pos": 12, "end_pos": 14 }, { "start_pos": 180, "end_pos": 182 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 73 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }