{ "uniprot_canonical_ac": "P11388-1", "uniprot_ac": "P11388", "uniprot_id": "TOP2A_HUMAN", "mass": { "chemical_mass": 174385.0, "monoisotopic_mass": 174385.0 }, "refseq": { "ac": "NP_001058", "name": "DNA topoisomerase 2-alpha", "summary": "This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional stress that occurs during DNA transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex DNA which allows the strands to pass through one another, thus altering the topology of DNA. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this form, alpha, is localized to chromosome 17 and the beta gene is localized to chromosome 3. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia. [provided by RefSeq, Jul 2010].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001058" }, "gene_names": [ { "name": "TOP2A", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P11388", "id": "P11388" }, { "name": "TOP2; TOP2alpha; TOPIIA; TP2A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001058", "id": "NP_001058" }, { "name": "TOP2A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001058", "id": "NP_001058" }, { "name": "TOP2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P11388", "id": "P11388" } ], "protein_names": [ { "name": "DNA topoisomerase 2-alpha", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P11388" }, { "name": "5.6.2.2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P11388" }, { "name": "DNA gyrase; DNA topoisomerase (ATP-hydrolyzing); DNA topoisomerase II, 170 kD; DNA topoisomerase II, alpha isozyme; topoisomerase (DNA) II alpha 170kDa", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001058", "id": "NP_001058" }, { "name": "DNA topoisomerase 2-alpha", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001058", "id": "NP_001058" }, { "name": "DNA topoisomerase II, alpha isozyme", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P11388" } ], "function": [ { "annotation": "Association of TOP2A and ADH1B with lipid levels and prognosis in patients with lung adenocarcinoma and squamous cell carcinoma.", "evidence": [ { "database": "RefSeq", "id": "NP_001058", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001058" }, { "database": "PubMed", "id": "37985446", "url": "https://glygen.org/publication/PubMed/37985446" } ] }, { "annotation": "ERK2-topoisomerase II regulatory axis is important for gene activation in immediate early genes. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001058", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001058" }, { "database": "PubMed", "id": "38097570", "url": "https://glygen.org/publication/PubMed/38097570" } ] }, { "annotation": "EZH2-H3K27me3-mediated silencing of mir-139-5p inhibits cellular senescence in hepatocellular carcinoma by activating TOP2A. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001058", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001058" }, { "database": "PubMed", "id": "38008711", "url": "https://glygen.org/publication/PubMed/38008711" } ] }, { "annotation": "Key decatenating enzyme that alters DNA topology by binding to two double-stranded DNA molecules, generating a double-stranded break in one of the strands, passing the intact strand through the broken strand, and religating the broken strand (PubMed:17567603, PubMed:18790802, PubMed:22013166, PubMed:22323612). May play a role in regulating the period length of BMAL1 transcriptional oscillation (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388#function" }, { "database": "UniProtKB", "id": "Q01320", "url": "https://www.uniprot.org/uniprot/Q01320#function" }, { "database": "PubMed", "id": "18790802", "url": "https://glygen.org/publication/PubMed/18790802" }, { "database": "PubMed", "id": "22323612", "url": "https://glygen.org/publication/PubMed/22323612" }, { "database": "PubMed", "id": "22013166", "url": "https://glygen.org/publication/PubMed/22013166" }, { "database": "PubMed", "id": "17567603", "url": "https://glygen.org/publication/PubMed/17567603" } ] }, { "annotation": "Role of TOP2A and CDC6 in liver cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_001058", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001058" }, { "database": "PubMed", "id": "37861550", "url": "https://glygen.org/publication/PubMed/37861550" } ] }, { "annotation": "This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional stress that occurs during DNA transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex DNA which allows the strands to pass through one another, thus altering the topology of DNA. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this form, alpha, is localized to chromosome 17 and the beta gene is localized to chromosome 3. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia. [provided by RefSeq, Jul 2010].", "evidence": [ { "database": "RefSeq", "id": "NP_001058", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001058" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs1170823026", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1170823026" }, { "id": "rs1170823026", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1170823026#frequency_tab" }, { "id": "rs1170823026", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1170823026" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1423, "end_pos": 1423, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SQS->NQS); o-glyco-site-loss (S->N).", "chr_id": "17", "chr_pos": "40390164", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1423", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs756125132", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756125132" }, { "id": "rs756125132", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756125132" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1000, "end_pos": 1000, "sequence_org": "M", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSM->NST).", "chr_id": "17", "chr_pos": "40400210", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "M1000", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1374612424", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1374612424" }, { "id": "rs1374612424", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1374612424" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1052, "end_pos": 1052, "sequence_org": "A", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NQA->NQS).", "chr_id": "17", "chr_pos": "40399914", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A1052", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs749413974", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749413974" }, { "id": "rs749413974", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749413974" }, { "id": "rs749413974", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749413974" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1243, "end_pos": 1243, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NEN->NES).", "chr_id": "17", "chr_pos": "40395532", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N1243", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs765583738", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765583738" }, { "id": "rs765583738", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765583738" }, { "id": "rs765583738", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765583738" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1352, "end_pos": 1352, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DAS->NAS).", "chr_id": "17", "chr_pos": "40392252", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D1352", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs750593637", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750593637" }, { "id": "rs750593637", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750593637" }, { "id": "rs750593637", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs750593637#frequency_tab" }, { "id": "rs750593637", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750593637" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1374, "end_pos": 1374, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "17", "chr_pos": "40392079", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1374", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P11388", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P11388" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1385, "end_pos": 1385, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "K", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (KGS->NGS).", "chr_id": "17", "chr_pos": "40391618", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "K1385", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1043064286", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1043064286" }, { "id": "rs1043064286", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1043064286#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1426, "end_pos": 1426, "sequence_org": "S", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->A).", "chr_id": "17", "chr_pos": "40390156", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1426", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1598606373", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1598606373" }, { "id": "rs1598606373", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1598606373" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1427, "end_pos": 1427, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).", "chr_id": "17", "chr_pos": "40390153", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1427", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs771346220", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771346220" }, { "id": "rs771346220", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771346220" }, { "id": "rs771346220", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771346220" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1428, "end_pos": 1428, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "17", "chr_pos": "40390149", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1428", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs934528221", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs934528221" }, { "id": "rs934528221", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs934528221" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1471, "end_pos": 1471, "sequence_org": "S", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->A).", "chr_id": "17", "chr_pos": "40390021", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1471", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1804539", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1804539" }, { "id": "rs1804539", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1804539" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1471, "end_pos": 1471, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "17", "chr_pos": "40390020", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1471", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P11388", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P11388" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1483, "end_pos": 1483, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "L", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "17", "chr_pos": "40389984", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S1483", "disease": [ { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs534100273", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs534100273" }, { "id": "rs534100273", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs534100273" }, { "id": "rs534100273", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs534100273" }, { "id": "rs534100273", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs534100273" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1487, "end_pos": 1487, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->R).", "chr_id": "17", "chr_pos": "40389972", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T1487", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs760133627", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760133627" }, { "id": "rs760133627", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760133627" }, { "id": "rs760133627", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs760133627#frequency_tab" }, { "id": "rs760133627", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760133627" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1488, "end_pos": 1488, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "17", "chr_pos": "40389970", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1488", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1567790430", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1567790430" }, { "id": "rs1567790430", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1567790430" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 260, "end_pos": 260, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NGN->NGS).", "chr_id": "17", "chr_pos": "40412769", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N260", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P11388", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P11388" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 371, "end_pos": 371, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "P", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NPT->NST).", "chr_id": "17", "chr_pos": "40411201", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "P371", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs748048325", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748048325" }, { "id": "rs748048325", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs748048325" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 387, "end_pos": 387, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "17", "chr_pos": "40411153", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S387", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1183293679", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1183293679" }, { "id": "rs1183293679", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1183293679" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 545, "end_pos": 545, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DGS->NGS).", "chr_id": "17", "chr_pos": "40406936", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D545", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1413326763", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1413326763" }, { "id": "rs1413326763", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1413326763" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 600, "end_pos": 600, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SST->NST).", "chr_id": "17", "chr_pos": "40406628", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S600", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1598615717", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1598615717" }, { "id": "rs1598615717", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1598615717" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 641, "end_pos": 641, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "17", "chr_pos": "40406416", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S641", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs11656816", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs11656816" }, { "id": "rs11656816", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs11656816" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 654, "end_pos": 654, "sequence_org": "S", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->I).", "chr_id": "17", "chr_pos": "40404876", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S654", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P11388", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P11388" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 689, "end_pos": 689, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (TTT->NTT).", "chr_id": "17", "chr_pos": "40404472", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T689", "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1329483854", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1329483854" }, { "id": "rs1329483854", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1329483854#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 692, "end_pos": 692, "sequence_org": "Y", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (YLT->NLT).", "chr_id": "17", "chr_pos": "40404464", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "Y692", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs763661948", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763661948" }, { "id": "rs763661948", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763661948" }, { "id": "rs763661948", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763661948" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 739, "end_pos": 739, "sequence_org": "K", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDK->NDT).", "chr_id": "17", "chr_pos": "40404219", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K739", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs756580989", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756580989" }, { "id": "rs756580989", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756580989" }, { "id": "rs756580989", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs756580989#frequency_tab" }, { "id": "rs756580989", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs756580989" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 835, "end_pos": 835, "sequence_org": "R", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NQR->NQS).", "chr_id": "17", "chr_pos": "40401011", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "R835", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1018933690", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1018933690" }, { "id": "rs1018933690", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1018933690#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 93, "end_pos": 93, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NAA->NAT).", "chr_id": "17", "chr_pos": "40416060", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A93", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 1469, "end_pos": 1469, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes binding to the antibody MPM2.", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "10942766", "url": "https://glygen.org/publication/PubMed/10942766" } ] }, { "start_pos": 342, "end_pos": 344, "sequence_org": "KKK", "sequence_mut": "AAA", "comment": "Reduced enzyme activity; abolishes stimulation of ATPase activity upon DNA binding.", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "23022727", "url": "https://glygen.org/publication/PubMed/23022727" } ] }, { "start_pos": 342, "end_pos": 344, "sequence_org": "KKK", "sequence_mut": "EEE", "comment": "Strongly reduced enzyme activity; abolishes stimulation of ATPase activity upon DNA binding.", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "23022727", "url": "https://glygen.org/publication/PubMed/23022727" } ] }, { "start_pos": 461, "end_pos": 461, "sequence_org": "E", "sequence_mut": "A", "comment": "Impairs bending of target DNA. Strongly reduced DNA cleavage.", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "19697956", "url": "https://glygen.org/publication/PubMed/19697956" }, { "database": "PubMed", "id": "22323612", "url": "https://glygen.org/publication/PubMed/22323612" } ] }, { "start_pos": 461, "end_pos": 461, "sequence_org": "E", "sequence_mut": "C", "comment": "Impairs bending of target DNA. Strongly reduced DNA cleavage.", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "19697956", "url": "https://glygen.org/publication/PubMed/19697956" }, { "database": "PubMed", "id": "22323612", "url": "https://glygen.org/publication/PubMed/22323612" } ] }, { "start_pos": 541, "end_pos": 541, "sequence_org": "D", "sequence_mut": "A", "comment": "Impairs bending of target DNA. Strongly reduced DNA cleavage.", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "19697956", "url": "https://glygen.org/publication/PubMed/19697956" }, { "database": "PubMed", "id": "22323612", "url": "https://glygen.org/publication/PubMed/22323612" } ] }, { "start_pos": 541, "end_pos": 541, "sequence_org": "D", "sequence_mut": "C", "comment": "Impairs bending of target DNA. Strongly reduced DNA cleavage.", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "19697956", "url": "https://glygen.org/publication/PubMed/19697956" }, { "database": "PubMed", "id": "22323612", "url": "https://glygen.org/publication/PubMed/22323612" } ] }, { "start_pos": 543, "end_pos": 543, "sequence_org": "D", "sequence_mut": "A", "comment": "Impairs bending of target DNA. Strongly reduced DNA cleavage.", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "19697956", "url": "https://glygen.org/publication/PubMed/19697956" }, { "database": "PubMed", "id": "22323612", "url": "https://glygen.org/publication/PubMed/22323612" } ] }, { "start_pos": 543, "end_pos": 543, "sequence_org": "D", "sequence_mut": "C", "comment": "Impairs bending of target DNA. Strongly reduced DNA cleavage.", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "19697956", "url": "https://glygen.org/publication/PubMed/19697956" }, { "database": "PubMed", "id": "22323612", "url": "https://glygen.org/publication/PubMed/22323612" } ] }, { "start_pos": 545, "end_pos": 545, "sequence_org": "D", "sequence_mut": "A", "comment": "Strongly reduced DNA cleavage.", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "19697956", "url": "https://glygen.org/publication/PubMed/19697956" } ] }, { "start_pos": 545, "end_pos": 545, "sequence_org": "D", "sequence_mut": "C", "comment": "Strongly reduced DNA cleavage.", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "19697956", "url": "https://glygen.org/publication/PubMed/19697956" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "58.97", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131747", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131747" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "88.31", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000131747", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131747" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "68.74", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131747", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131747" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000131747", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131747" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "61.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131747", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131747" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "89.78", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000131747", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131747" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "71.29", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131747", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131747" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "54.39", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000131747", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131747" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "58.86", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131747", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131747" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000131747", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131747" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "59.47", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131747", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131747" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "61.82", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131747", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131747" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "67.26", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131747", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131747" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P11388", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11388" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P11388", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11388" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P11388", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11388" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P11388", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11388" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P11388", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11388" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P11388", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11388" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P11388", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11388" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P11388", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11388" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P11388", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11388" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P11388", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11388" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P11388", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11388" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P11388", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11388" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "common_name": "Human" } ], "gene": [ { "name": "TOP2A", "url": "https://www.uniprot.org/uniprot/P11388", "locus": { "chromosome": "17", "start_pos": 40388525, "end_pos": 40417896, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000131747", "url": "https://www.ensembl.org/id/ENSG00000131747" } ] } } ], "crossref": [ { "id": "ENSG00000131747", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131747", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P11388", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P11388", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "5.6.2.2", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=5.6.2.2&UniProtAcc=P11388", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "5.99.1.3", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=5.99.1.3&UniProtAcc=P11388", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd00187", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00187", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd03365", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03365", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd03481", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03481", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd16930", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16930", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL1806", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1806", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "TOP2A", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=TOP2A", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "7153", "url": "https://www.ncbi.nlm.nih.gov/gene/7153", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "11989", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=11989", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P11388", "url": "https://www.ebi.ac.uk/intact/interactors/id:P11388*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001154", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001154", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001241", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001241", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002205", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002205", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003594", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003594", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006171", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006171", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012542", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012542", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013506", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013506", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013757", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013757", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013758", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013758", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013759", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013759", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013760", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013760", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014721", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014721", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018522", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018522", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020568", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020568", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR031660", "url": "https://www.ebi.ac.uk/interpro/entry/IPR031660", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034157", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034157", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036890", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036890", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:7153", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7153", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "126430", "url": "http://www.omim.org/entry/126430", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P11388", "url": "https://www.nextprot.org/entry/NX_P11388", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P11388", "url": "https://oglcnac.org/atlas/detail/P11388", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P11388", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11388", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "NESMDYN", "url": "https://omabrowser.org/oma/group/NESMDYN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1944951at2759", "url": "http://www.orthodb.org/?query=1944951at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10169", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10169", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10169:SF61", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10169:SF61", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1ZXM", "url": "https://www.rcsb.org/structure/1ZXM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1ZXN", "url": "https://www.rcsb.org/structure/1ZXN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4FM9", "url": "https://www.rcsb.org/structure/4FM9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4R1F", "url": "https://www.rcsb.org/structure/4R1F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5GWK", "url": "https://www.rcsb.org/structure/5GWK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5NNE", "url": "https://www.rcsb.org/structure/5NNE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ZY5", "url": "https://www.rcsb.org/structure/6ZY5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ZY6", "url": "https://www.rcsb.org/structure/6ZY6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ZY7", "url": "https://www.rcsb.org/structure/6ZY7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ZY8", "url": "https://www.rcsb.org/structure/6ZY8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00204", "url": "http://pfam.xfam.org/family/PF00204", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00521", "url": "http://pfam.xfam.org/family/PF00521", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01751", "url": "http://pfam.xfam.org/family/PF01751", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02518", "url": "http://pfam.xfam.org/family/PF02518", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF08070", "url": "http://pfam.xfam.org/family/PF08070", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF16898", "url": "http://pfam.xfam.org/family/PF16898", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P11388", "url": "https://pharos.nih.gov/targets/P11388", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P11388", "url": "http://purl.obolibrary.org/obo/PR_P11388", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1362277", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362277", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001058", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001058", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "J3KTB7", "url": "https://www.uniprot.org/uniprot/J3KTB7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3KTB7-1", "url": "https://www.uniprot.org/uniprot/J3KTB7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QR57", "url": "https://www.uniprot.org/uniprot/J3QR57", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QR57-1", "url": "https://www.uniprot.org/uniprot/J3QR57-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P11388-1", "url": "https://www.uniprot.org/uniprot/P11388-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P11388-2", "url": "https://www.uniprot.org/uniprot/P11388-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P11388-3", "url": "https://www.uniprot.org/uniprot/P11388-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P11388-4", "url": "https://www.uniprot.org/uniprot/P11388-4", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEVSPLQPVNENMQVNKIKKNEDAKKRLSVERIYQKKTQLEHILLRPDTYIGSVELVTQQMWVYDEDVGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWNNGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETASREYKKMFKQTWMDNMGRAGEMELKPFNGEDYTCITFQPDLSKFKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKLDETGNSLKVIHEQVNHRWEVCLTMSEKGFQQISFVNSIATSKGGRHVDYVADQIVTKLVDVVKKKNKGGVAVKAHQVKNHMWIFVNALIENPTFDSQTKENMTLQPKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQVQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEMAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQIDDRKEWLTNFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSSLARLLFPPKDDHTLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDVREIVNNIRRLMDGEEPLPMLPSYKNFKGTIEELAPNQYVISGEVAILNSTTIEISELPVRTWTQTYKEQVLEPMLNGTEKTPPLITDYREYHTDTTVKFVVKMTEEKLAEAERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILRDFFELRLKYYGLRKEWLLGMLGAESAKLNNQARFILEKIDGKIIIENKPKKELIKVLIQRGYDSDPVKAWKEAQQKVPDEEENEESDNEKETEKSDSVTDSGPTFNYLLDMPLWYLTKEKKDELCRLRNEKEQELDTLKRKSPSDLWKEDLATFIEELEAVEAKEKQDEQVGLPGKGGKAKGKKTQMAEVLPSPRGQRVIPRITIEMKAEAEKKNKKKIKNENTEGSPQEDGVELEGLKQRLEKKQKREPGTKTKKQTTLAFKPIKKGKKRNPWSDSESDRSSDESNFDVPPRETEPRRAATKTKFTMDLDSDEDFSDFDEKTDDEDFVPSDASPPKTKTSPKLSNKELKPQKSVVSDLEADDVKGSVPLSSSPPATHFPDETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF", "length": 1531, "header": "sp|P11388-1|TOP2A_HUMAN Isoform 1 of DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3 CANONICAL=P11388-1" }, "isoforms": [ { "isoform_ac": "J3KTB7-1", "url": "", "sequence": { "sequence": "MQVNKIKKNEDAKKRLSVERIYQKKTQLEHILLRPDTYIGSVELVTQQMWVYDEDVGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWNNGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVT", "length": 147, "header": "tr|J3KTB7-1|J3KTB7_HUMAN Computationally mapped isoform of DNA topoisomerase II alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=1 CANONICAL=P11388-1" }, "locus": { "chromosome": "17", "start_pos": 40416880, "end_pos": 40413481, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000581055.1", "url": "https://www.ensembl.org/id/ENST00000581055.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000462908.1", "url": "https://www.ensembl.org/id/ENSP00000462908.1" } ] } }, { "isoform_ac": "J3QR57-1", "url": "", "sequence": { "sequence": "AVAPRAKSVRAKKPIKYLEESDEDDLF", "length": 27, "header": "tr|J3QR57-1|TOP2A_HUMAN Computationally mapped isoform of DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=1 CANONICAL=P11388-1" }, "locus": { "chromosome": "17", "start_pos": 40389602, "end_pos": 40389522, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000577541.1", "url": "https://www.ensembl.org/id/ENST00000577541.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000464055.1", "url": "https://www.ensembl.org/id/ENSP00000464055.1" } ] } }, { "isoform_ac": "P11388-1", "url": "", "sequence": { "sequence": "MEVSPLQPVNENMQVNKIKKNEDAKKRLSVERIYQKKTQLEHILLRPDTYIGSVELVTQQMWVYDEDVGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWNNGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETASREYKKMFKQTWMDNMGRAGEMELKPFNGEDYTCITFQPDLSKFKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKLDETGNSLKVIHEQVNHRWEVCLTMSEKGFQQISFVNSIATSKGGRHVDYVADQIVTKLVDVVKKKNKGGVAVKAHQVKNHMWIFVNALIENPTFDSQTKENMTLQPKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQVQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEMAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQIDDRKEWLTNFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSSLARLLFPPKDDHTLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDVREIVNNIRRLMDGEEPLPMLPSYKNFKGTIEELAPNQYVISGEVAILNSTTIEISELPVRTWTQTYKEQVLEPMLNGTEKTPPLITDYREYHTDTTVKFVVKMTEEKLAEAERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILRDFFELRLKYYGLRKEWLLGMLGAESAKLNNQARFILEKIDGKIIIENKPKKELIKVLIQRGYDSDPVKAWKEAQQKVPDEEENEESDNEKETEKSDSVTDSGPTFNYLLDMPLWYLTKEKKDELCRLRNEKEQELDTLKRKSPSDLWKEDLATFIEELEAVEAKEKQDEQVGLPGKGGKAKGKKTQMAEVLPSPRGQRVIPRITIEMKAEAEKKNKKKIKNENTEGSPQEDGVELEGLKQRLEKKQKREPGTKTKKQTTLAFKPIKKGKKRNPWSDSESDRSSDESNFDVPPRETEPRRAATKTKFTMDLDSDEDFSDFDEKTDDEDFVPSDASPPKTKTSPKLSNKELKPQKSVVSDLEADDVKGSVPLSSSPPATHFPDETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF", "length": 1531, "header": "sp|P11388-1|TOP2A_HUMAN Isoform 1 of DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3 CANONICAL=P11388-1" }, "locus": { "chromosome": "17", "start_pos": 40417791, "end_pos": 40389522, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000423485.6", "url": "https://www.ensembl.org/id/ENST00000423485.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000411532.1", "url": "https://www.ensembl.org/id/ENSP00000411532.1" } ] } }, { "isoform_ac": "P11388-2", "url": "", "sequence": { "sequence": "MEVSPLQPVNENMQVNKIKKNEDAKKRLSVERIYQKKTQLEHILLRPDTYIGSVELVTQQMWVYDEDVGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWNNGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETASREYKKMFKQTWMDNMGRAGEMELKPFNGEDYTCITFQPDLSKFKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKLDETGNSLKVIHEQVNHRWEVCLTMSEKGFQQISFVNSIATSKGGRHVDYVADQIVTKLVDVVKKKNKGGVAVKAHQVKNHMWIFVNALIENPTFDSQTKENMTLQPKSFGSTCQLSEKFIKAHLYSRFLIDPFFPNMIPNMIFSFSKAAIGCGIVESILNWVKFKAQVQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEMAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQIDDRKEWLTNFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSSLARLLFPPKDDHTLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDVREIVNNIRRLMDGEEPLPMLPSYKNFKGTIEELAPNQYVISGEVAILNSTTIEISELPVRTWTQTYKEQVLEPMLNGTEKTPPLITDYREYHTDTTVKFVVKMTEEKLAEAERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILRDFFELRLKYYGLRKEWLLGMLGAESAKLNNQARFILEKIDGKIIIENKPKKELIKVLIQRGYDSDPVKAWKEAQQKVPDEEENEESDNEKETEKSDSVTDSGPTFNYLLDMPLWYLTKEKKDELCRLRNEKEQELDTLKRKSPSDLWKEDLATFIEELEAVEAKEKQDEQVGLPGKGGKAKGKKTQMAEVLPSPRGQRVIPRITIEMKAEAEKKNKKKIKNENTEGSPQEDGVELEGLKQRLEKKQKREPGTKTKKQTTLAFKPIKKGKKRNPWSDSESDRSSDESNFDVPPRETEPRRAATKTKFTMDLDSDEDFSDFDEKTDDEDFVPSDASPPKTKTSPKLSNKELKPQKSVVSDLEADDVKGSVPLSSSPPATHFPDETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF", "length": 1557, "header": "sp|P11388-2|TOP2A_HUMAN Isoform 2 of DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3 CANONICAL=P11388-1" }, "locus": {} }, { "isoform_ac": "P11388-3", "url": "", "sequence": { "sequence": "MEVSPLQPVNENMQVNKIKKNEDAKKRLSVERIYQKKTQLEHILLRPDTYIGSVELVTQQMWVYDEDVGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWNNGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETASREYKKMFKQTWMDNMGRAGEMELKPFNGEDYTCITFQPDLSKFKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKLDETGNSLKVIHEQVNHRWEVCLTMSEKGFQQISFVNSIATSKSSKYWSSRKSKQHILLNFFVLFKFINDAFFGICPFKGGRHVDYVADQIVTKLVDVVKKKNKGGVAVKAHQVKNHMWIFVNALIENPTFDSQTKENMTLQPKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQVQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEMAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQIDDRKEWLTNFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSSLARLLFPPKDDHTLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDVREIVNNIRRLMDGEEPLPMLPSYKNFKGTIEELAPNQYVISGEVAILNSTTIEISELPVRTWTQTYKEQVLEPMLNGTEKTPPLITDYREYHTDTTVKFVVKMTEEKLAEAERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILRDFFELRLKYYGLRKEWLLGMLGAESAKLNNQARFILEKIDGKIIIENKPKKELIKVLIQRGYDSDPVKAWKEAQQKVPDEEENEESDNEKETEKSDSVTDSGPTFNYLLDMPLWYLTKEKKDELCRLRNEKEQELDTLKRKSPSDLWKEDLATFIEELEAVEAKEKQDEQVGLPGKGGKAKGKKTQMAEVLPSPRGQRVIPRITIEMKAEAEKKNKKKIKNENTEGSPQEDGVELEGLKQRLEKKQKREPGTKTKKQTTLAFKPIKKGKKRNPWSDSESDRSSDESNFDVPPRETEPRRAATKTKFTMDLDSDEDFSDFDEKTDDEDFVPSDASPPKTKTSPKLSNKELKPQKSVVSDLEADDVKGSVPLSSSPPATHFPDETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF", "length": 1567, "header": "sp|P11388-3|TOP2A_HUMAN Isoform 3 of DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3 CANONICAL=P11388-1" }, "locus": {} }, { "isoform_ac": "P11388-4", "url": "", "sequence": { "sequence": "MEVSPLQPVNENMQVNKIKKNEDAKKRLSVERIYQKKTQLEHILLRPDTYIGSVELVTQQMWVYDEDVGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWNNGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETASREYKKMFKQTWMDNMGRAGEMELKPFNGEDYTCITFQPDLSKFKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKLDETGNSLKVIHEQVNHRWEVCLTMSEKGFQQISFVNSIATSKGGRHVDYVADQIVTKLVDVVKKKNKGGVAVKAHQRELCNGAILAHCNLRLMGSSDSPASASRVAGIAGGCHHTQLIFVFLVETGFHHVGQAGLERLTSGDPPASASQSSGITDVKVKNHMWIFVNALIENPTFDSQTKENMTLQPKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQVQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEMAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQIDDRKEWLTNFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSSLARLLFPPKDDHTLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDVREIVNNIRRLMDGEEPLPMLPSYKNFKGTIEELAPNQYVISGEVAILNSTTIEISELPVRTWTQTYKEQVLEPMLNGTEKTPPLITDYREYHTDTTVKFVVKMTEEKLAEAERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILRDFFELRLKYYGLRKEWLLGMLGAESAKLNNQARFILEKIDGKIIIENKPKKELIKVLIQRGYDSDPVKAWKEAQQKVPDEEENEESDNEKETEKSDSVTDSGPTFNYLLDMPLWYLTKEKKDELCRLRNEKEQELDTLKRKSPSDLWKEDLATFIEELEAVEAKEKQDEQVGLPGKGGKAKGKKTQMAEVLPSPRGQRVIPRITIEMKAEAEKKNKKKIKNENTEGSPQEDGVELEGLKQRLEKKQKREPGTKTKKQTTLAFKPIKKGKKRNPWSDSESDRSSDESNFDVPPRETEPRRAATKTKFTMDLDSDEDFSDFDEKTDDEDFVPSDASPPKTKTSPKLSNKELKPQKSVVSDLEADDVKGSVPLSSSPPATHFPDETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF", "length": 1612, "header": "sp|P11388-4|TOP2A_HUMAN Isoform 4 of DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3 CANONICAL=P11388-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1374, "start_aa": "Ser", "end_pos": 1374, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1374", "evidence": [ { "id": "P11388", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11388" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "P11388", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11388" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1423, "start_aa": "Ser", "end_pos": 1423, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1423", "evidence": [ { "id": "P11388", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11388" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "P11388", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11388" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1425, "start_aa": "Ser", "end_pos": 1425, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1425", "evidence": [ { "id": "P11388", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11388" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1426, "start_aa": "Ser", "end_pos": 1426, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1426", "evidence": [ { "id": "P11388", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11388" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1427, "start_aa": "Thr", "end_pos": 1427, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1427", "evidence": [ { "id": "P11388", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11388" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1428, "start_aa": "Ser", "end_pos": 1428, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1428", "evidence": [ { "id": "P11388", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11388" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1469, "start_aa": "Ser", "end_pos": 1469, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1469", "evidence": [ { "id": "P11388", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11388" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1470, "start_aa": "Thr", "end_pos": 1470, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1470", "evidence": [ { "id": "P11388", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11388" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1471, "start_aa": "Ser", "end_pos": 1471, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1471", "evidence": [ { "id": "P11388", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11388" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "P11388", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11388" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1487, "start_aa": "Thr", "end_pos": 1487, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1487", "evidence": [ { "id": "P11388", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11388" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1488, "start_aa": "Ser", "end_pos": 1488, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1488", "evidence": [ { "id": "P11388", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11388" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "P11388", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11388" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 387, "start_aa": "Ser", "end_pos": 387, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser387", "evidence": [ { "id": "P11388", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11388" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 390, "start_aa": "Ser", "end_pos": 390, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser390", "evidence": [ { "id": "P11388", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11388" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 395, "start_aa": "Ser", "end_pos": 395, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser395", "evidence": [ { "id": "P11388", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11388" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "P11388", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11388" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 641, "start_aa": "Ser", "end_pos": 641, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser641", "evidence": [ { "id": "P11388", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11388" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 654, "start_aa": "Ser", "end_pos": 654, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser654", "evidence": [ { "id": "P11388", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11388" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "32522876", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32522876" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "P11388", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11388" } ] } ], "phosphorylation": [ { "start_pos": 1106, "end_pos": 1106, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CK1", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "12569090", "url": "https://glygen.org/publication/PubMed/12569090" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "35873470", "url": "" }, { "database": "PubMed", "id": "19043076", "url": "https://glygen.org/publication/PubMed/19043076" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ], "site_lbl": "Ser1106" }, { "start_pos": 1115, "end_pos": 1115, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser1115" }, { "start_pos": 1117, "end_pos": 1117, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Ser1117" }, { "start_pos": 1162, "end_pos": 1162, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Ser1162" }, { "start_pos": 1164, "end_pos": 1164, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Ser1164" }, { "start_pos": 1205, "end_pos": 1205, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" } ], "site_lbl": "Thr1205" }, { "start_pos": 1213, "end_pos": 1213, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "12569090", "url": "https://glygen.org/publication/PubMed/12569090" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" }, { "database": "PubMed", "id": "20068230", "url": "https://glygen.org/publication/PubMed/20068230" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "7635160", "url": "https://glygen.org/publication/PubMed/7635160" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Ser1213" }, { "start_pos": 1213, "end_pos": 1213, "kinase_uniprot_canonical_ac": "P27361-1", "kinase_gene_name": "MAPK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "7635160", "url": "https://glygen.org/publication/PubMed/7635160" } ], "site_lbl": "Ser1213" }, { "start_pos": 1213, "end_pos": 1213, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "7635160", "url": "https://glygen.org/publication/PubMed/7635160" } ], "site_lbl": "Ser1213" }, { "start_pos": 1213, "end_pos": 1213, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "12569090", "url": "https://glygen.org/publication/PubMed/12569090" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" }, { "database": "PubMed", "id": "20068230", "url": "https://glygen.org/publication/PubMed/20068230" }, { "database": "PubMed", "id": "7635160", "url": "https://glygen.org/publication/PubMed/7635160" }, { "database": "PubMed", "id": "17466629", "url": "https://glygen.org/publication/PubMed/17466629" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" }, { "database": "PubMed", "id": "27407105", "url": "https://glygen.org/publication/PubMed/27407105" }, { "database": "PubMed", "id": "30871006", "url": "https://glygen.org/publication/PubMed/30871006" } ], "site_lbl": "Ser1213" }, { "start_pos": 1244, "end_pos": 1244, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Thr1244" }, { "start_pos": 1247, "end_pos": 1247, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "12569090", "url": "https://glygen.org/publication/PubMed/12569090" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "7635160", "url": "https://glygen.org/publication/PubMed/7635160" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Ser1247" }, { "start_pos": 1247, "end_pos": 1247, "kinase_uniprot_canonical_ac": "P27361-1", "kinase_gene_name": "MAPK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "7635160", "url": "https://glygen.org/publication/PubMed/7635160" } ], "site_lbl": "Ser1247" }, { "start_pos": 1247, "end_pos": 1247, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "7635160", "url": "https://glygen.org/publication/PubMed/7635160" } ], "site_lbl": "Ser1247" }, { "start_pos": 1247, "end_pos": 1247, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "12569090", "url": "https://glygen.org/publication/PubMed/12569090" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" }, { "database": "PubMed", "id": "7635160", "url": "https://glygen.org/publication/PubMed/7635160" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" }, { "database": "PubMed", "id": "30871006", "url": "https://glygen.org/publication/PubMed/30871006" } ], "site_lbl": "Ser1247" }, { "start_pos": 1295, "end_pos": 1295, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Ser1295" }, { "start_pos": 1297, "end_pos": 1297, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Ser1297" }, { "start_pos": 1299, "end_pos": 1299, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Ser1299" }, { "start_pos": 1302, "end_pos": 1302, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ], "site_lbl": "Ser1302" }, { "start_pos": 1303, "end_pos": 1303, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ], "site_lbl": "Ser1303" }, { "start_pos": 1306, "end_pos": 1306, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Ser1306" }, { "start_pos": 1327, "end_pos": 1327, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Thr1327" }, { "start_pos": 1332, "end_pos": 1332, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Ser1332" }, { "start_pos": 1337, "end_pos": 1337, "kinase_uniprot_canonical_ac": "P53350-1", "kinase_gene_name": "PLK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "18171681", "url": "https://glygen.org/publication/PubMed/18171681" } ], "site_lbl": "Ser1337" }, { "start_pos": 1337, "end_pos": 1337, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Ser1337" }, { "start_pos": 1343, "end_pos": 1343, "kinase_uniprot_canonical_ac": "P68400-1", "kinase_gene_name": "CSNK2A1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "11940573", "url": "https://glygen.org/publication/PubMed/11940573" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "8939955", "url": "https://glygen.org/publication/PubMed/8939955" }, { "database": "PubMed", "id": "9804834", "url": "https://glygen.org/publication/PubMed/9804834" } ], "site_lbl": "Thr1343" }, { "start_pos": 1343, "end_pos": 1343, "kinase_uniprot_canonical_ac": "Q9H4B4-1", "kinase_gene_name": "PLK3", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "18062778", "url": "https://glygen.org/publication/PubMed/18062778" } ], "site_lbl": "Thr1343" }, { "start_pos": 1343, "end_pos": 1343, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PLK3", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "9804834", "url": "https://glygen.org/publication/PubMed/9804834" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "7499337", "url": "https://glygen.org/publication/PubMed/7499337" }, { "database": "PubMed", "id": "18062778", "url": "https://glygen.org/publication/PubMed/18062778" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ], "site_lbl": "Thr1343" }, { "start_pos": 1351, "end_pos": 1351, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Ser1351" }, { "start_pos": 1354, "end_pos": 1354, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "12569090", "url": "https://glygen.org/publication/PubMed/12569090" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "7635160", "url": "https://glygen.org/publication/PubMed/7635160" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Ser1354" }, { "start_pos": 1354, "end_pos": 1354, "kinase_uniprot_canonical_ac": "P27361-1", "kinase_gene_name": "MAPK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "7635160", "url": "https://glygen.org/publication/PubMed/7635160" } ], "site_lbl": "Ser1354" }, { "start_pos": 1354, "end_pos": 1354, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "7635160", "url": "https://glygen.org/publication/PubMed/7635160" } ], "site_lbl": "Ser1354" }, { "start_pos": 1354, "end_pos": 1354, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "12569090", "url": "https://glygen.org/publication/PubMed/12569090" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "7635160", "url": "https://glygen.org/publication/PubMed/7635160" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Ser1354" }, { "start_pos": 1358, "end_pos": 1358, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Thr1358" }, { "start_pos": 1360, "end_pos": 1360, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr1360" }, { "start_pos": 1361, "end_pos": 1361, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "12569090", "url": "https://glygen.org/publication/PubMed/12569090" }, { "database": "PubMed", "id": "7635160", "url": "https://glygen.org/publication/PubMed/7635160" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Ser1361" }, { "start_pos": 1361, "end_pos": 1361, "kinase_uniprot_canonical_ac": "P27361-1", "kinase_gene_name": "MAPK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "7635160", "url": "https://glygen.org/publication/PubMed/7635160" } ], "site_lbl": "Ser1361" }, { "start_pos": 1361, "end_pos": 1361, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "7635160", "url": "https://glygen.org/publication/PubMed/7635160" } ], "site_lbl": "Ser1361" }, { "start_pos": 1365, "end_pos": 1365, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser1365" }, { "start_pos": 1374, "end_pos": 1374, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Ser1374" }, { "start_pos": 1377, "end_pos": 1377, "kinase_uniprot_canonical_ac": "P68400-1", "kinase_gene_name": "CSNK2A1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "7961967", "url": "https://glygen.org/publication/PubMed/7961967" } ], "site_lbl": "Ser1377" }, { "start_pos": 1377, "end_pos": 1377, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" }, { "database": "PubMed", "id": "7961967", "url": "https://glygen.org/publication/PubMed/7961967" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" }, { "database": "PubMed", "id": "9761967", "url": "https://glygen.org/publication/PubMed/9761967" } ], "site_lbl": "Ser1377" }, { "start_pos": 1387, "end_pos": 1387, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Ser1387" }, { "start_pos": 1391, "end_pos": 1391, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Ser1391" }, { "start_pos": 1392, "end_pos": 1392, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Ser1392" }, { "start_pos": 1393, "end_pos": 1393, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "12569090", "url": "https://glygen.org/publication/PubMed/12569090" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "7635160", "url": "https://glygen.org/publication/PubMed/7635160" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Ser1393" }, { "start_pos": 1393, "end_pos": 1393, "kinase_uniprot_canonical_ac": "P27361-1", "kinase_gene_name": "MAPK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "7635160", "url": "https://glygen.org/publication/PubMed/7635160" } ], "site_lbl": "Ser1393" }, { "start_pos": 1393, "end_pos": 1393, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "7635160", "url": "https://glygen.org/publication/PubMed/7635160" } ], "site_lbl": "Ser1393" }, { "start_pos": 1393, "end_pos": 1393, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ], "site_lbl": "Ser1393" }, { "start_pos": 1397, "end_pos": 1397, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Thr1397" }, { "start_pos": 1403, "end_pos": 1403, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Thr1403" }, { "start_pos": 1449, "end_pos": 1449, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Ser1449" }, { "start_pos": 1452, "end_pos": 1452, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Ser1452" }, { "start_pos": 1469, "end_pos": 1469, "kinase_uniprot_canonical_ac": "P68400-1", "kinase_gene_name": "CSNK2A1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "10942766", "url": "https://glygen.org/publication/PubMed/10942766" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser1469" }, { "start_pos": 1469, "end_pos": 1469, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CK2", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "10942766", "url": "https://glygen.org/publication/PubMed/10942766" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ], "site_lbl": "Ser1469" }, { "start_pos": 1470, "end_pos": 1470, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Thr1470" }, { "start_pos": 1471, "end_pos": 1471, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Ser1471" }, { "start_pos": 1474, "end_pos": 1474, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Ser1474" }, { "start_pos": 1476, "end_pos": 1476, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ], "site_lbl": "Ser1476" }, { "start_pos": 1491, "end_pos": 1491, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Ser1491" }, { "start_pos": 1495, "end_pos": 1495, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Ser1495" }, { "start_pos": 1504, "end_pos": 1504, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Ser1504" }, { "start_pos": 1521, "end_pos": 1521, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Tyr1521" }, { "start_pos": 1525, "end_pos": 1525, "kinase_uniprot_canonical_ac": "P53350-1", "kinase_gene_name": "PLK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "18171681", "url": "https://glygen.org/publication/PubMed/18171681" }, { "database": "PubMed", "id": "19098900", "url": "https://glygen.org/publication/PubMed/19098900" } ], "site_lbl": "Ser1525" }, { "start_pos": 1525, "end_pos": 1525, "kinase_uniprot_canonical_ac": "P53778-1", "kinase_gene_name": "MAPK12", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "21878638", "url": "https://glygen.org/publication/PubMed/21878638" } ], "site_lbl": "Ser1525" }, { "start_pos": 1525, "end_pos": 1525, "kinase_uniprot_canonical_ac": "P68400-1", "kinase_gene_name": "CSNK2A1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "7961967", "url": "https://glygen.org/publication/PubMed/7961967" }, { "database": "PubMed", "id": "19098900", "url": "https://glygen.org/publication/PubMed/19098900" } ], "site_lbl": "Ser1525" }, { "start_pos": 1525, "end_pos": 1525, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "7961967", "url": "https://glygen.org/publication/PubMed/7961967" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" }, { "database": "PubMed", "id": "9761967", "url": "https://glygen.org/publication/PubMed/9761967" }, { "database": "PubMed", "id": "27407105", "url": "https://glygen.org/publication/PubMed/27407105" } ], "site_lbl": "Ser1525" }, { "start_pos": 230, "end_pos": 230, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser230" }, { "start_pos": 282, "end_pos": 282, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ], "site_lbl": "Thr282" }, { "start_pos": 285, "end_pos": 285, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser285" }, { "start_pos": 29, "end_pos": 29, "kinase_uniprot_canonical_ac": "P05129-1", "kinase_gene_name": "PRKCG", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "12569090", "url": "https://glygen.org/publication/PubMed/12569090" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "7499337", "url": "https://glygen.org/publication/PubMed/7499337" } ], "site_lbl": "Ser29" }, { "start_pos": 29, "end_pos": 29, "kinase_uniprot_canonical_ac": "P05771-1", "kinase_gene_name": "PRKCB", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "12569090", "url": "https://glygen.org/publication/PubMed/12569090" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "7499337", "url": "https://glygen.org/publication/PubMed/7499337" } ], "site_lbl": "Ser29" }, { "start_pos": 29, "end_pos": 29, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "12569090", "url": "https://glygen.org/publication/PubMed/12569090" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "7499337", "url": "https://glygen.org/publication/PubMed/7499337" } ], "site_lbl": "Ser29" }, { "start_pos": 29, "end_pos": 29, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "29493099", "url": "" }, { "database": "PubMed", "id": "32387766", "url": "" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "7499337", "url": "https://glygen.org/publication/PubMed/7499337" } ], "site_lbl": "Ser29" }, { "start_pos": 4, "end_pos": 4, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "phospho.ELM", "id": "P11388", "url": "http://phospho.elm.eu.org/byAccession/P11388.html" } ], "site_lbl": "Ser4" }, { "start_pos": 707, "end_pos": 707, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser707" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Molecular cloning and characterization of the human topoisomerase IIalpha and IIbeta genes: evidence for isoform evolution through gene duplication.", "journal": "Biochim. Biophys. Acta", "date": "1999", "authors": "Sng J H, Heaton V J, Bell M, Maini P, Austin C A, Fisher L M", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "10095062", "url": "https://glygen.org/publication/PubMed/10095062" } ] }, { "title": "CDC25A phosphatase is a target of E2F and is required for efficient E2F-induced S phase.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Vigo E, Muller H, Prosperini E, Hateboer G, Cartwright P, Moroni MC, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362277", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362277" } ], "reference": [ { "type": "PubMed", "id": "10454584", "url": "https://glygen.org/publication/PubMed/10454584" } ] }, { "title": "SUMO-1 conjugation to topoisomerase I: A possible repair response to topoisomerase-mediated DNA damage.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Mao Y, Sun M, Desai SD, Liu LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "10759568", "url": "https://glygen.org/publication/PubMed/10759568" } ] }, { "title": "SUMO-1 conjugation to human DNA topoisomerase II isozymes.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Mao Y, Desai SD, Liu LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "10862613", "url": "https://glygen.org/publication/PubMed/10862613" } ] }, { "title": "Mitotic phosphorylation of DNA topoisomerase II alpha by protein kinase CK2 creates the MPM-2 phosphoepitope on Ser-1469.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Escargueil AE, Plisov SY, Filhol O, Cochet C, Larsen AK", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "10942766", "url": "https://glygen.org/publication/PubMed/10942766" } ] }, { "title": "Nucleolar delocalization of human topoisomerase I in response to topotecan correlates with sumoylation of the protein.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Mo YY, Yu Y, Shen Z, Beck WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "11709553", "url": "https://glygen.org/publication/PubMed/11709553" } ] }, { "title": "Interactions between protein kinase CK2 and Pin1. Evidence for phosphorylation-dependent interactions.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Messenger MM, Saulnier RB, Gilchrist AD, Diamond P, Gorbsky GJ, Litchfield DW", "evidence": [ { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "11940573", "url": "https://glygen.org/publication/PubMed/11940573" } ] }, { "title": "E2F mediates cell cycle-dependent transcriptional repression in vivo by recruitment of an HDAC1/mSin3B corepressor complex.", "journal": "Genes & development", "date": "2002", "authors": "Rayman JB, Takahashi Y, Indjeian VB, Dannenberg JH, Catchpole S, Watson RJ, te Riele H, Dynlacht BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362277", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362277" } ], "reference": [ { "type": "PubMed", "id": "11959842", "url": "https://glygen.org/publication/PubMed/11959842" } ] }, { "title": "Sumoylation of topoisomerase I is involved in its partitioning between nucleoli and nucleoplasm and its clearing from nucleoli in response to camptothecin.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Rallabhandi P, Hashimoto K, Mo YY, Beck WT, Moitra PK, D'Arpa P", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "12149243", "url": "https://glygen.org/publication/PubMed/12149243" } ] }, { "title": "Phosphorylation of serine 1106 in the catalytic domain of topoisomerase II alpha regulates enzymatic activity and drug sensitivity.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Chikamori K, Grabowski DR, Kinter M, Willard BB, Yadav S, Aebersold RH, Bukowski RM, Hickson ID, Andersen AH, Ganapathi R, Ganapathi MK", "evidence": [ { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "12569090", "url": "https://glygen.org/publication/PubMed/12569090" } ] }, { "title": "RNA helicase A interacts with dsDNA and topoisomerase IIalpha.", "journal": "Nucleic Acids Res.", "date": "2003", "authors": "Zhou Kai, Choe Kyoo-Tae, Zaidi Zaheer, Wang Qi, Mathews Michael B, Lee Chee-Gun", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "12711669", "url": "https://glygen.org/publication/PubMed/12711669" } ] }, { "title": "An E2F site in the 5'-promoter region contributes to serum-dependent up-regulation of the human proliferating cell nuclear antigen gene.", "journal": "FEBS letters", "date": "2003", "authors": "Li YY, Wang L, Lu CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362277", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362277" } ], "reference": [ { "type": "PubMed", "id": "12782299", "url": "https://glygen.org/publication/PubMed/12782299" } ] }, { "title": "Identification of functional nuclear export sequences in human topoisomerase IIalpha and beta.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2003", "authors": "Mirski Shelagh E L, Bielawski Juliane C, Cole Susan P C", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "12821127", "url": "https://glygen.org/publication/PubMed/12821127" } ] }, { "title": "The SUMO pathway is required for selective degradation of DNA topoisomerase IIbeta induced by a catalytic inhibitor ICRF-193(1).", "journal": "FEBS letters", "date": "2003", "authors": "Isik S, Sano K, Tsutsui K, Seki M, Enomoto T, Saitoh H, Tsutsui K", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "12832072", "url": "https://glygen.org/publication/PubMed/12832072" } ] }, { "title": "Interaction between glucose-regulated destruction domain of DNA topoisomerase IIalpha and MPN domain of Jab1/CSN5.", "journal": "J. Biol. Chem.", "date": "2004", "authors": "Yun Jisoo, Tomida Akihiro, Andoh Toshiwo, Tsuruo Takashi", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "15126503", "url": "https://glygen.org/publication/PubMed/15126503" } ] }, { "title": "Large-scale characterization of HeLa cell nuclear phosphoproteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" } ] }, { "title": "SUMO-modified PCNA recruits Srs2 to prevent recombination during S phase.", "journal": "Nature", "date": "2005", "authors": "Pfander B, Moldovan GL, Sacher M, Hoege C, Jentsch S", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "15931174", "url": "https://glygen.org/publication/PubMed/15931174" } ] }, { "title": "Crosstalk between SUMO and ubiquitin on PCNA is mediated by recruitment of the helicase Srs2p.", "journal": "Molecular cell", "date": "2005", "authors": "Papouli E, Chen S, Davies AA, Huttner D, Krejci L, Sung P, Ulrich HD", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "15989970", "url": "https://glygen.org/publication/PubMed/15989970" } ] }, { "title": "Nucleotide-dependent domain movement in the ATPase domain of a human type IIA DNA topoisomerase.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Wei H, Ruthenburg AJ, Bechis SK, Verdine GL", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "16100112", "url": "https://glygen.org/publication/PubMed/16100112" } ] }, { "title": "Identification of a point mutation in the topoisomerase II gene from a human leukemia cell line containing an amsacrine-resistant form of topoisomerase II.", "journal": "Cancer research", "date": "1991", "authors": "Hinds M, Deisseroth K, Mayes J, Altschuler E, Jansen R, Ledley FD, Zwelling LA", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "1651812", "url": "https://glygen.org/publication/PubMed/1651812" } ] }, { "title": "Expression of a mutant DNA topoisomerase II in CCRF-CEM human leukemic cells selected for resistance to teniposide.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Bugg BY, Danks MK, Beck WT, Suttle DP", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "1652758", "url": "https://glygen.org/publication/PubMed/1652758" } ] }, { "title": "Phosphoproteome analysis of the human mitotic spindle.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Nousiainen M, Sillje HH, Sauer G, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" } ] }, { "title": "A probability-based approach for high-throughput protein phosphorylation analysis and site localization.", "journal": "Nature biotechnology", "date": "2006", "authors": "Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "PIASgamma is required for faithful chromosome segregation in human cells.", "journal": "PloS one", "date": "2006", "authors": "Diaz-Martinez LA, Gimenez-Abian JF, Azuma Y, Guacci V, Gimenez-Martin G, Lanier LM, Clarke DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "17183683", "url": "https://glygen.org/publication/PubMed/17183683" } ] }, { "title": "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Molina H, Horn DM, Tang N, Mathivanan S, Pandey A", "evidence": [ { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" } ] }, { "title": "The prolyl isomerase Pin1 functions in mitotic chromosome condensation.", "journal": "Molecular cell", "date": "2007", "authors": "Xu YX, Manley JL", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" } ], "reference": [ { "type": "PubMed", "id": "17466629", "url": "https://glygen.org/publication/PubMed/17466629" } ] }, { "title": "Evolutionarily conserved multisubunit RBL2/p130 and E2F4 protein complex represses human cell cycle-dependent genes in quiescence.", "journal": "Molecular cell", "date": "2007", "authors": "Litovchick L, Sadasivam S, Florens L, Zhu X, Swanson SK, Velmurugan S, Chen R, Washburn MP, Liu XS, DeCaprio JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362277", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362277" } ], "reference": [ { "type": "PubMed", "id": "17531812", "url": "https://glygen.org/publication/PubMed/17531812" } ] }, { "title": "Nuclear interactions of topoisomerase II alpha and beta with phospholipid scramblase 1.", "journal": "Nucleic acids research", "date": "2007", "authors": "Wyles Jessica P, Wu Zhongqin, Mirski Shelagh E L, Cole Susan P C", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "17567603", "url": "https://glygen.org/publication/PubMed/17567603" } ] }, { "title": "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.", "journal": "Journal of proteome research", "date": "2007", "authors": "Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" } ] }, { "title": "Plk3 phosphorylates topoisomerase IIalpha at Thr(1342), a site that is not recognized by Plk1.", "journal": "The Biochemical journal", "date": "2008", "authors": "Iida M, Matsuda M, Komatani H", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" } ], "reference": [ { "type": "PubMed", "id": "18062778", "url": "https://glygen.org/publication/PubMed/18062778" } ] }, { "title": "Plk1-dependent phosphorylation regulates functions of DNA topoisomerase IIalpha in cell cycle progression.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Li H, Wang Y, Liu X", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" } ], "reference": [ { "type": "PubMed", "id": "18171681", "url": "https://glygen.org/publication/PubMed/18171681" } ] }, { "title": "Hydrophilic interaction chromatography reduces the complexity of the phosphoproteome and improves global phosphopeptide isolation and detection.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008", "authors": "McNulty DE, Annan RS", "evidence": [ { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" } ] }, { "title": "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.", "journal": "Journal of proteome research", "date": "2008", "authors": "Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" } ], "reference": [ { "type": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ] }, { "title": "Conjugation of human topoisomerase 2 alpha with small ubiquitin-like modifiers 2/3 in response to topoisomerase inhibitors: cell cycle stage and chromosome domain specificity.", "journal": "Cancer research", "date": "2008", "authors": "Agostinho M, Santos V, Ferreira F, Costa R, Cardoso J, Pinheiro I, Rino J, Jaffray E, Hay RT, Ferreira J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "18381449", "url": "https://glygen.org/publication/PubMed/18381449" } ] }, { "title": "Resolution of sister centromeres requires RanBP2-mediated SUMOylation of topoisomerase IIalpha.", "journal": "Cell", "date": "2008", "authors": "Dawlaty MM, Malureanu L, Jeganathan KB, Kao E, Sustmann C, Tahk S, Shuai K, Grosschedl R, van Deursen JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "18394993", "url": "https://glygen.org/publication/PubMed/18394993" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Molecular cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "Successive and selective release of phosphorylated peptides captured by hydroxy acid-modified metal oxide chromatography.", "journal": "Journal of proteome research", "date": "2008", "authors": "Kyono Y, Sugiyama N, Imami K, Tomita M, Ishihama Y", "evidence": [ { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" } ] }, { "title": "The SET and transposase domain protein Metnase enhances chromosome decatenation: regulation by automethylation.", "journal": "Nucleic acids research", "date": "2008", "authors": "Williamson EA, Rasila KK, Corwin LK, Wray J, Beck BD, Severns V, Mobarak C, Lee SH, Nickoloff JA, Hromas R", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "18790802", "url": "https://glygen.org/publication/PubMed/18790802" } ] }, { "title": "RanBP2 and SENP3 function in a mitotic SUMO2/3 conjugation-deconjugation cycle on Borealin.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Klein UR, Haindl M, Nigg EA, Muller S", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "18946085", "url": "https://glygen.org/publication/PubMed/18946085" } ] }, { "title": "Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis.", "journal": "Analytical chemistry", "date": "2008", "authors": "Wang B, Malik R, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" } ] }, { "title": "Casein kinase I delta/epsilon phosphorylates topoisomerase IIalpha at serine-1106 and modulates DNA cleavage activity.", "journal": "Nucleic acids research", "date": "2009", "authors": "Grozav AG, Chikamori K, Kozuki T, Grabowski DR, Bukowski RM, Willard B, Kinter M, Andersen AH, Ganapathi R, Ganapathi MK", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" } ], "reference": [ { "type": "PubMed", "id": "19043076", "url": "https://glygen.org/publication/PubMed/19043076" } ] }, { "title": "Topoisomerase IIalpha controls the decatenation checkpoint.", "journal": "Nature cell biology", "date": "2009", "authors": "Luo K, Yuan J, Chen J, Lou Z", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" } ], "reference": [ { "type": "PubMed", "id": "19098900", "url": "https://glygen.org/publication/PubMed/19098900" } ] }, { "title": "Use of divalent metal ions in the DNA cleavage reaction of human type II topoisomerases.", "journal": "Biochemistry", "date": "2009", "authors": "Deweese Joseph E, Burch Amber M, Burgin Alex B, Osheroff Neil", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "19222228", "url": "https://glygen.org/publication/PubMed/19222228" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "Phosphoproteomic analysis of distinct tumor cell lines in response to nocodazole treatment.", "journal": "Proteomics", "date": "2009", "authors": "Nagano K, Shinkawa T, Mutoh H, Kondoh O, Morimoto S, Inomata N, Ashihara M, Ishii N, Aoki Y, Haramura M", "evidence": [ { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" } ] }, { "title": "Proteomics analysis of nucleolar SUMO-1 target proteins upon proteasome inhibition.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Matafora V, D'Amato A, Mori S, Blasi F, Bachi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "19596686", "url": "https://glygen.org/publication/PubMed/19596686" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Phosphoproteomic analysis of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Brill LM, Xiong W, Lee KB, Ficarro SB, Crain A, Xu Y, Terskikh A, Snyder EY, Ding S", "evidence": [ { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" } ] }, { "title": "Phosphorylation dynamics during early differentiation of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Van Hoof D, Munoz J, Braam SR, Pinkse MW, Linding R, Heck AJ, Mummery CL, Krijgsveld J", "evidence": [ { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "Quantitative analysis of the human spindle phosphoproteome at distinct mitotic stages.", "journal": "Journal of proteome research", "date": "2009", "authors": "Malik R, Lenobel R, Santamaria A, Ries A, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ] }, { "title": "Metal ion interactions in the DNA cleavage/ligation active site of human topoisomerase IIalpha.", "journal": "Biochemistry", "date": "2009", "authors": "Deweese JE, Guengerich FP, Burgin AB, Osheroff N", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "19697956", "url": "https://glygen.org/publication/PubMed/19697956" } ] }, { "title": "Exploring the human leukocyte phosphoproteome using a microfluidic reversed-phase-TiO2-reversed-phase high-performance liquid chromatography phosphochip coupled to a quadrupole time-of-flight mass spectrometer.", "journal": "Analytical chemistry", "date": "2010", "authors": "Raijmakers R, Kraiczek K, de Jong AP, Mohammed S, Heck AJ", "evidence": [ { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" } ] }, { "title": "Extensive crosstalk between O-GlcNAcylation and phosphorylation regulates cytokinesis.", "journal": "Science signaling", "date": "2010", "authors": "Wang Z, Udeshi ND, Slawson C, Compton PD, Sakabe K, Cheung WD, Shabanowitz J, Hunt DF, Hart GW", "evidence": [ { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "20068230", "url": "https://glygen.org/publication/PubMed/20068230" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Metnase promotes restart and repair of stalled and collapsed replication forks.", "journal": "Nucleic Acids Res.", "date": "2010", "authors": "De Haro Leyma P, Wray Justin, Williamson Elizabeth A, Durant Stephen T, Corwin Lori, Gentry Amanda C, Osheroff Neil, Lee Suk-Hee, Hromas Robert, Nickoloff Jac A", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "20457750", "url": "https://glygen.org/publication/PubMed/20457750" } ] }, { "title": "SUMOylation modulates the function of Aurora-B kinase.", "journal": "Journal of cell science", "date": "2010", "authors": "Fernandez-Miranda G, Perez de Castro I, Carmena M, Aguirre-Portoles C, Ruchaud S, Fant X, Montoya G, Earnshaw WC, Malumbres M", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "20663916", "url": "https://glygen.org/publication/PubMed/20663916" } ] }, { "title": "Crystal structure of SUMO-modified proliferating cell nuclear antigen.", "journal": "Journal of molecular biology", "date": "2011", "authors": "Freudenthal BD, Brogie JE, Gakhar L, Kondratick CM, Washington MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "21167178", "url": "https://glygen.org/publication/PubMed/21167178" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "DYRK1A protein kinase promotes quiescence and senescence through DREAM complex assembly.", "journal": "Genes & development", "date": "2011", "authors": "Litovchick L, Florens LA, Swanson SK, Washburn MP, DeCaprio JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362277", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362277" } ], "reference": [ { "type": "PubMed", "id": "21498570", "url": "https://glygen.org/publication/PubMed/21498570" } ] }, { "title": "Mitotic kinase Aurora-B is regulated by SUMO-2/3 conjugation/deconjugation during mitosis.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2011", "authors": "Ban R, Nishida T, Urano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "21554500", "url": "https://glygen.org/publication/PubMed/21554500" } ] }, { "title": "Phosphorylation and stabilization of topoisomerase IIalpha protein by p38gamma mitogen-activated protein kinase sensitize breast cancer cells to its poisons.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Qi X, Hou S, Lepp A, Li R, Basir Z, Lou Z, Chen G", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" } ], "reference": [ { "type": "PubMed", "id": "21878638", "url": "https://glygen.org/publication/PubMed/21878638" } ] }, { "title": "RECQL5 cooperates with Topoisomerase II alpha in DNA decatenation and cell cycle progression.", "journal": "Nucleic acids research", "date": "2012-02", "authors": "Ramamoorthy Mahesh, Tadokoro Takashi, Rybanska Ivana, Ghosh Avik K, Wersto Robert, May Alfred, Kulikowicz Tomasz, Sykora Peter, Croteau Deborah L, Bohr Vilhelm A", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "22013166", "url": "https://glygen.org/publication/PubMed/22013166" } ] }, { "title": "DNA cleavage and opening reactions of human topoisomerase IIalpha are regulated via Mg2+-mediated dynamic bending of gate-DNA.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Lee S, Jung SR, Heo K, Byl JA, Deweese JE, Osheroff N, Hohng S", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "22323612", "url": "https://glygen.org/publication/PubMed/22323612" } ] }, { "title": "Role of SUMO modification of human PCNA at stalled replication fork.", "journal": "Nucleic acids research", "date": "2012", "authors": "Gali H, Juhasz S, Morocz M, Hajdu I, Fatyol K, Szukacsov V, Burkovics P, Haracska L", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "22457066", "url": "https://glygen.org/publication/PubMed/22457066" } ] }, { "title": "The RanBP2/RanGAP1*SUMO1/Ubc9 complex is a multisubunit SUMO E3 ligase.", "journal": "Molecular cell", "date": "2012", "authors": "Werner A, Flotho A, Melchior F", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "22464730", "url": "https://glygen.org/publication/PubMed/22464730" } ] }, { "title": "The structure of DNA-bound human topoisomerase II alpha: conformational mechanisms for coordinating inter-subunit interactions with DNA cleavage.", "journal": "Journal of molecular biology", "date": "2012", "authors": "Wendorff TJ, Schmidt BH, Heslop P, Austin CA, Berger JM", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "22841979", "url": "https://glygen.org/publication/PubMed/22841979" } ] }, { "title": "Structure of a topoisomerase II-DNA-nucleotide complex reveals a new control mechanism for ATPase activity.", "journal": "Nature structural & molecular biology", "date": "2012", "authors": "Schmidt BH, Osheroff N, Berger JM", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "23022727", "url": "https://glygen.org/publication/PubMed/23022727" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "GANP regulates recruitment of AID to immunoglobulin variable regions by modulating transcription and nucleosome occupancy.", "journal": "Nat. Commun.", "date": "2013", "authors": "Singh SK, Maeda K, Eid MM, Almofty SA, Ono M, Pham P, Goodman MF, Sakaguchi N", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "23652018", "url": "https://glygen.org/publication/PubMed/23652018" } ] }, { "title": "Proteome-wide identification of SUMO2 modification sites.", "journal": "Science signaling", "date": "2014", "authors": "Tammsalu T, Matic I, Jaffray EG, Ibrahim AFM, Tatham MH, Hay RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "24782567", "url": "https://glygen.org/publication/PubMed/24782567" } ] }, { "title": "Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2014", "authors": "Impens F, Radoshevich L, Cossart P, Ribet D", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "25114211", "url": "https://glygen.org/publication/PubMed/25114211" } ] }, { "title": "Structure of the N-terminal Gyrase B fragment in complex with ADPPi reveals rigid-body motion induced by ATP hydrolysis.", "journal": "PLoS ONE", "date": "2014", "authors": "Stanger FV, Dehio C, Schirmer T", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "25202966", "url": "https://glygen.org/publication/PubMed/25202966" } ] }, { "title": "Uncovering global SUMOylation signaling networks in a site-specific manner.", "journal": "Nat. Struct. Mol. Biol.", "date": "2014", "authors": "Hendriks IA, D'Souza RC, Yang B, Verlaan-de Vries M, Mann M, Vertegaal AC", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "25218447", "url": "https://glygen.org/publication/PubMed/25218447" } ] }, { "title": "System-wide analysis of SUMOylation dynamics in response to replication stress reveals novel small ubiquitin-like modified target proteins and acceptor lysines relevant for genome stability.", "journal": "Mol. Cell. Proteomics", "date": "2015", "authors": "Xiao Zhenyu, Chang Jer-Gung, Hendriks Ivo A, Sigur\u00f0sson J\u00f3n Otti, Olsen Jesper V, Vertegaal Alfred C O", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "25755297", "url": "https://glygen.org/publication/PubMed/25755297" } ] }, { "title": "SUMO-2 orchestrates chromatin modifiers in response to DNA damage.", "journal": "Cell Rep.", "date": "2015", "authors": "Hendriks Ivo A, Treffers Louise W, Verlaan-de Vries Matty, Olsen Jesper V, Vertegaal Alfred C O", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "25772364", "url": "https://glygen.org/publication/PubMed/25772364" } ] }, { "title": "Identification of Novel Proteins Co-Purifying with Cockayne Syndrome Group B (CSB) Reveals Potential Roles for CSB in RNA Metabolism and Chromatin Dynamics.", "journal": "PLoS ONE", "date": "2015", "authors": "Nicolai S, Filippi S, Caputo M, Cipak L, Gregan J, Ammerer G, Frontini M, Willems D, Prantera G, Balajee AS, Proietti-De-Santis L", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "26030138", "url": "https://glygen.org/publication/PubMed/26030138" } ] }, { "title": "DDK dependent regulation of TOP2A at centromeres revealed by a chemical genetics approach.", "journal": "Nucleic acids research", "date": "2016", "authors": "Wu KZ, Wang GN, Fitzgerald J, Quachthithu H, Rainey MD, Cattaneo A, Bachi A, Santocanale C", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" } ], "reference": [ { "type": "PubMed", "id": "27407105", "url": "https://glygen.org/publication/PubMed/27407105" } ] }, { "title": "Cloning and sequencing of cDNA encoding human DNA topoisomerase II and localization of the gene to chromosome region 17q21-22.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1988", "authors": "Tsai-Pflugfelder M, Liu LF, Liu AA, Tewey KM, Whang-Peng J, Knutsen T, Huebner K, Croce CM, Wang JC", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "2845399", "url": "https://glygen.org/publication/PubMed/2845399" } ] }, { "title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.", "journal": "Analytical chemistry", "date": "2017", "authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11388", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11388" } ], "reference": [ { "type": "PubMed", "id": "28510447", "url": "https://glygen.org/publication/PubMed/28510447" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11388", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11388" }, { "database": "O-GlcNAc Atlas", "id": "P11388", "url": "https://oglcnac.org/atlas/detail/P11388" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "title": "The Impact of the C-Terminal Region on the Interaction of Topoisomerase II Alpha with Mitotic Chromatin.", "journal": "International journal of molecular sciences", "date": "2019-03-12", "authors": "Antoniou-Kourounioti Melissa, Mimmack Michael L, Porter Andrew C G, Farr Christine J", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" } ], "reference": [ { "type": "PubMed", "id": "30871006", "url": "https://glygen.org/publication/PubMed/30871006" } ] }, { "title": "Engineering a Proximity-Directed O-GlcNAc Transferase for Selective Protein O-GlcNAcylation in Cells.", "journal": "ACS chemical biology", "date": "2020", "authors": "Ramirez DH, Aonbangkhen C, Wu HY, Naftaly JA, Tang S, O'Meara TR, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11388", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11388" } ], "reference": [ { "type": "PubMed", "id": "32119511", "url": "https://glygen.org/publication/PubMed/32119511" } ] }, { "title": "Methylation-directed glycosylation of chromatin factors represses retrotransposon promoters.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2020", "authors": "Boulard M, Rucli S, Edwards JR, Bestor TH", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11388", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11388" } ], "reference": [ { "type": "PubMed", "id": "32522876", "url": "https://glygen.org/publication/PubMed/32522876" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11388", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11388" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "A new tandem enrichment strategy for the simultaneous profiling of O-GlcNAcylation and phosphorylation in RNA-binding proteome.", "journal": "The Analyst", "date": "2021", "authors": "Fan Z, Li J, Liu T, Zhang Z, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11388", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11388" }, { "database": "O-GlcNAc Atlas", "id": "P11388", "url": "https://oglcnac.org/atlas/detail/P11388" } ], "reference": [ { "type": "PubMed", "id": "33465208", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11388", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11388" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "The Epstein-Barr virus deubiquitinating enzyme BPLF1 regulates the activity of topoisomerase II during productive infection.", "journal": "PLoS pathogens", "date": "2021-09", "authors": "Li Jinlin, Nagy Noemi, Liu Jiangnan, Gupta Soham, Frisan Teresa, Hennig Thomas, Cameron Donald P, Baranello Laura, Masucci Maria G", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "34543352", "url": "https://glygen.org/publication/PubMed/34543352" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11388", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11388" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "O-GlcNAcylation promotes fatty acid synthase activity under nutritional stress as a pro-survival mechanism in cancer cells.", "journal": "Proteomics", "date": "2022", "authors": "Wong YK, Wang J, Lim TK, Lin Q, Yap CT, Shen HM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11388", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11388" } ], "reference": [ { "type": "PubMed", "id": "35083852", "url": "https://glygen.org/publication/PubMed/35083852" } ] }, { "title": "Role of TOP2A and CDC6 in liver cancer.", "journal": "Medicine", "date": "2023-10-20", "authors": "Jia Wei, Liu Xiang, Zhang Zhilei", "evidence": [ { "database": "RefSeq", "id": "NP_001058", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001058" } ], "reference": [ { "type": "PubMed", "id": "37861550", "url": "https://glygen.org/publication/PubMed/37861550" } ] }, { "title": "Association of TOP2A and ADH1B with lipid levels and prognosis in patients with lung adenocarcinoma and squamous cell carcinoma.", "journal": "The clinical respiratory journal", "date": "2023-12", "authors": "Yin Dongdong, Zhang Yinci, Li Hui, Cheng Longqiang", "evidence": [ { "database": "RefSeq", "id": "NP_001058", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001058" } ], "reference": [ { "type": "PubMed", "id": "37985446", "url": "https://glygen.org/publication/PubMed/37985446" } ] }, { "title": "EZH2-H3K27me3-mediated silencing of mir-139-5p inhibits cellular senescence in hepatocellular carcinoma by activating TOP2A.", "journal": "Journal of experimental & clinical cancer research : CR", "date": "2023-11-27", "authors": "Wang Ke, Jiang Xunliang, Jiang Yu, Liu Jun, Du Yongtao, Zhang Zecheng, Li Yunlong, Zhao Xinhui, Li Jipeng, Zhang Rui", "evidence": [ { "database": "RefSeq", "id": "NP_001058", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001058" } ], "reference": [ { "type": "PubMed", "id": "38008711", "url": "https://glygen.org/publication/PubMed/38008711" } ] }, { "title": "ERK2-topoisomerase II regulatory axis is important for gene activation in immediate early genes.", "journal": "Nature communications", "date": "2023-12-14", "authors": "Bunch Heeyoun, Kim Deukyeong, Naganuma Masahiro, Nakagawa Reiko, Cong Anh, Jeong Jaehyeon, Ehara Haruhiko, Vu Hongha, Chang Jeong Ho, Schellenberg Matthew J, Sekine Shun-Ichi", "evidence": [ { "database": "RefSeq", "id": "NP_001058", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001058" } ], "reference": [ { "type": "PubMed", "id": "38097570", "url": "https://glygen.org/publication/PubMed/38097570" } ] }, { "title": "Cell cycle phase-specific phosphorylation of human topoisomerase II alpha. Evidence of a role for protein kinase C.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Wells NJ, Fry AM, Guano F, Norbury C, Hickson ID", "evidence": [ { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "7499337", "url": "https://glygen.org/publication/PubMed/7499337" } ] }, { "title": "Cellular targets for activation by the E2F1 transcription factor include DNA synthesis- and G1/S-regulatory genes.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "DeGregori J, Kowalik T, Nevins JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362277", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362277" } ], "reference": [ { "type": "PubMed", "id": "7623816", "url": "https://glygen.org/publication/PubMed/7623816" } ] }, { "title": "Human topoisomerase II alpha is phosphorylated in a cell-cycle phase-dependent manner by a proline-directed kinase.", "journal": "European journal of biochemistry", "date": "1995", "authors": "Wells NJ, Hickson ID", "evidence": [ { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "7635160", "url": "https://glygen.org/publication/PubMed/7635160" } ] }, { "title": "Serine 1524 is a major site of phosphorylation on human topoisomerase II alpha protein in vivo and is a substrate for casein kinase II in vitro.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Wells NJ, Addison CM, Fry AM, Ganapathi R, Hickson ID", "evidence": [ { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "7961967", "url": "https://glygen.org/publication/PubMed/7961967" } ] }, { "title": "Developmental control of a G1-S transcriptional program in Drosophila.", "journal": "Development (Cambridge, England)", "date": "1994", "authors": "Duronio RJ, O'Farrell PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362277", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362277" } ], "reference": [ { "type": "PubMed", "id": "8050359", "url": "https://glygen.org/publication/PubMed/8050359" } ] }, { "title": "Discrete localization of different DNA topoisomerases in HeLa and K562 cell nuclei and subnuclear fractions.", "journal": "Exp. Cell Res.", "date": "1994", "authors": "Zini N, Santi S, Ognibene A, Bavelloni A, Neri L M, Valmori A, Mariani E, Negri C, Astaldi-Ricotti G C, Maraldi N M", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "8299728", "url": "https://glygen.org/publication/PubMed/8299728" } ] }, { "title": "Use of yeast in the study of anticancer drugs targeting DNA topoisomerases: expression of a functional recombinant human DNA topoisomerase II alpha in yeast.", "journal": "Cancer Res.", "date": "1993", "authors": "Wasserman R A, Austin C A, Fisher L M, Wang J C", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "8393377", "url": "https://glygen.org/publication/PubMed/8393377" } ] }, { "title": "Cdc25 cell-cycle phosphatase as a target of c-myc.", "journal": "Nature", "date": "1996", "authors": "Galaktionov K, Chen X, Beach D", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362277", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362277" } ], "reference": [ { "type": "PubMed", "id": "8700224", "url": "https://glygen.org/publication/PubMed/8700224" } ] }, { "title": "Threonine 1342 in human topoisomerase IIalpha is phosphorylated throughout the cell cycle.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Ishida R, Iwai M, Marsh KL, Austin CA, Yano T, Shibata M, Nozaki N, Hara A", "evidence": [ { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "8939955", "url": "https://glygen.org/publication/PubMed/8939955" } ] }, { "title": "The distribution and expression of the two isoforms of DNA topoisomerase II in normal and neoplastic human tissues.", "journal": "Br. J. Cancer", "date": "1997", "authors": "Turley H, Comley M, Houlbrook S, Nozaki N, Kikuchi A, Hickson I D, Gatter K, Harris A L", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "9155056", "url": "https://glygen.org/publication/PubMed/9155056" } ] }, { "title": "Cdc6 is regulated by E2F and is essential for DNA replication in mammalian cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Yan Z, DeGregori J, Shohet R, Leone G, Stillman B, Nevins JR, Williams RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362277", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362277" } ], "reference": [ { "type": "PubMed", "id": "9520412", "url": "https://glygen.org/publication/PubMed/9520412" } ] }, { "title": "Cell volume in cell proliferation and apoptotic cell death.", "journal": "Contributions to nephrology", "date": "1998", "authors": "Lang F, Lepple-Wienhues A, Szabo I, Siemen D, Gulbins E", "evidence": [ { "database": "iPTMnet", "id": "P11388", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388" } ], "reference": [ { "type": "PubMed", "id": "9761967", "url": "https://glygen.org/publication/PubMed/9761967" } ] }, { "title": "Regulation of cell growth-dependent expression of mammalian CDC6 gene by the cell cycle transcription factor E2F.", "journal": "Oncogene", "date": "1998", "authors": "Ohtani K, Tsujimoto A, Ikeda M, Nakamura M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362277", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362277" } ], "reference": [ { "type": "PubMed", "id": "9778043", "url": "https://glygen.org/publication/PubMed/9778043" } ] }, { "title": "Structural organization of the human TOP2A and TOP2B genes.", "journal": "Gene", "date": "1998", "authors": "Lang A J, Mirski S E, Cummings H J, Yu Q, Gerlach J H, Cole S P", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "reference": [ { "type": "PubMed", "id": "9795238", "url": "https://glygen.org/publication/PubMed/9795238" } ] }, { "title": "Casein kinase II catalyzes a mitotic phosphorylation on threonine 1342 of human DNA topoisomerase IIalpha, which is recognized by the 3F3/2 phosphoepitope antibody.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Daum JR, Gorbsky GJ", "evidence": [ { "database": "iPTMnet", "id": "P11388-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11388-1" } ], "reference": [ { "type": "PubMed", "id": "9804834", "url": "https://glygen.org/publication/PubMed/9804834" } ] } ], "pathway": [ { "id": "hsa:7153", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7153", "resource": "KEGG Pathway" }, { "id": "R-HSA-1362277", "name": "Transcription of E2F targets under negative control by DREAM complex", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362277", "resource": "Reactome", "description": "Transcription of E2F targets under negative control by DREAM complex" }, { "id": "R-HSA-4615885", "name": "SUMOylation of DNA replication proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885", "resource": "Reactome", "description": "SUMOylation of DNA replication proteins" } ], "orthologs": [ { "uniprot_canonical_ac": "O46374-1", "protein_name": "DNA topoisomerase 2-alpha", "gene_name": "TOP2A", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MEVSPLQPVNENMQVNKTKKNEEAKKRLSIERIYQKKTQLEHILLRPDTYIGSVESVTQQMWVYDEDIGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWNNGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDEEKKVTGGRNGYGAKLCNIFSTKFTVETASREYKKMFKQTWMDNMGRAGEMELKPFNGEDYTCITFHPDLSKFKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDLYLKDKVDETGNPLKIIHEQVNHRWEVCLTMSEKGFQQISFVNSIATSKGGRHVDYVADQIVAKLVDVVKKKNKGGVAVKAHQVKNHMWIFVNALIENPTFDSQTKENMTLQVKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQVQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEMAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQIDDRKEWLTHFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSPLARLLFPPKDDHTLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDVREVVNNIRLLMDGEEPLPMLPSYKNFKGTIEELAPNQYVISGEVAILNSTTIEISELPIRTWTQTYKEQVLEPMLNGTEKTPPLITDYREYHTDTTVKFVVKMTEEKLAEAERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILRDFFELRLKYYGLRKEWLLGMLGAESAKLNNQARFILEKIDGKIIIENKPKKELIKVLIQRGYDSDPVKAWKEAQQKVPDEEENEESDNEKEADKSDSVADSGPTFNYLLDMPLWYLTKEKKDELCKLRNEKEQELETLKRKSPSDLWKEDLAAFIEELEAVEAKEKQDEQIGLPGKGGKAKGKKTQMAEVLPSPCGKRVIPRVTVEMKAEAEKKIKKKIKSENTEGSPQEDGMEVEGLKQRLEKKQKREPGTKTKKQTTLPFKPIKKAKKRNPWSDSESDISSDESNFNVPPREKEPRRAAAKTKFTVDLDSDEDFSDADEKTRDEDFVPSDTSPQKAETSPKHTNKEPKPQKSTPSVSDFDADDAKDNVPPSPSSPVADFPAVTETIKPVSKKNVTVKKTAAKSQSSTSTTGAKKRAAPKGAKKDPDLDSDVSKKPNPPKPKGRRKRKPSTSDDSDSNFEKMISKAVTSKKPKGESDDFHLDLDLAVASRAKSGRTKKPIKYLEESDEDDLF", "length": 1533 }, "evidence": [ { "id": "P11388", "url": "https://omabrowser.org/oma/group/P11388/", "database": "OMA" } ], "common_name": "Pig" }, { "uniprot_canonical_ac": "Q01320-1", "protein_name": "DNA topoisomerase 2-alpha", "gene_name": "Top2a", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MELSPLQPVNENMLMNKKKNEDGKKRLSIERIYQKKTQLEHILLRPDTYIGSVELVTQQMWVYDEDVGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNVISIWNNGKGIPVVEHKVEKIYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETASREYKKMFKQTWMDNMGRAGDMELKPFSGEDYTCITFQPDLSKFKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNSLPVKGFRSYVDLYLKDKVDETGNSLKVIHEQVNPRWEVCLTMSERGFQQISFVNSIATSKGGRHVDYVADQIVSKLVDVVKKKNKGGVAVKAHQVKNHMWIFVNALIENPTFDSQTKENMTLQAKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQIQLNKKCSAVKHTKIKGIPKLDDANDAGSRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEIAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQVDDRKEWLTNFMEDRRQRKLLGLPEDYLYGQSTSYLTYNDFINKELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSPLARLLFPPKDDHTLRFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDVREVVNNIRRLLDGEEPLPMLPSYKNFKGTIEELASNQYVINGEVAILDSTTIEISELPIRTWTQTYKEQVLEPMLNGTEKTPSLITDYREYHTDTTVKFVIKMTEEKLAEAERVGLHKVFKLQSSLTCNSMVLFDHVGCLKKYDTVLDILRDFFELRLKYYGLRKEWLLGMLGAESSKLNNQARFILEKIDGKIVIENKPKKELIKVLIQRGYDSDPVKAWKEAQQKVPDEEENEESDTETSTSDSAAEAGPTFNYLLDMPLWYLTKEKKDELCKQRNEKEQELNTLKQKSPSDLWKEDLAVFIEELEVVEAKEKQDEQVGLPGKAGKAKGKKAQMCADVLPSPRGKRVIPQVTVEMKAEAEKKIRKKIKSENVEGTPAEDGAEPGSLRQRIEKKQKKEPGAKKQTTLPFKPVKKGRKKNPWSDSESDVSSNESNVDVPPRQKEQRSAAAKAKFTVDLDSDEDFSGLDEKDEDEDFLPLDATPPKAKIPPKNTKKALKTQGSSMSVVDLESDVKDSVPASPGVPAADFPAETEQSKPSKKTVGVKKTATKSQSSVSTAGTKKRAAPKGTKSDSALSARVSEKPAPAKAKNSRKRKPSSSDSSDSDFERAISKGATSKKAKGEEQDFPVDLEDTIAPRAKSDRARKPIKYLEESDDDDDLF", "length": 1528 }, "evidence": [ { "id": "45928181", "url": "http://www.informatics.jax.org/homology/45928181", "database": "MGI" }, { "id": "P11388", "url": "https://omabrowser.org/oma/group/P11388/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 16, "go_terms": [ { "name": "resolution of meiotic recombination intermediates", "id": "GO:0000712", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000712", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "chromosome segregation", "id": "GO:0007059", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007059", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "positive regulation of apoptotic process", "id": "GO:0043065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043065", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "DNA damage response", "id": "GO:0006974", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006974", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "embryonic cleavage", "id": "GO:0040016", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0040016", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "apoptotic chromosome condensation", "id": "GO:0030263", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030263", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "regulation of circadian rhythm", "id": "GO:0042752", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042752", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "rhythmic process", "id": "GO:0048511", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048511", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "female meiotic nuclear division", "id": "GO:0007143", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007143", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "hematopoietic progenitor cell differentiation", "id": "GO:0002244", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002244", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "DNA ligation", "id": "GO:0006266", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006266", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "DNA topological change", "id": "GO:0006265", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006265", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "sister chromatid segregation", "id": "GO:0000819", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000819", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "positive regulation of single stranded viral RNA replication via double stranded DNA intermediate", "id": "GO:0045870", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045870", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "negative regulation of DNA duplex unwinding", "id": "GO:1905463", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905463", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 12, "go_terms": [ { "name": "DNA binding, bending", "id": "GO:0008301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008301", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity", "id": "GO:0003918", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003918", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "magnesium ion binding", "id": "GO:0000287", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000287", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "chromatin binding", "id": "GO:0003682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003682", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "protein heterodimerization activity", "id": "GO:0046982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "protein kinase C binding", "id": "GO:0005080", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005080", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "ubiquitin binding", "id": "GO:0043130", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043130", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "ATP-dependent activity, acting on DNA", "id": "GO:0008094", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008094", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 10, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "chromosome, centromeric region", "id": "GO:0000775", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000775", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "condensed chromosome", "id": "GO:0000793", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000793", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "male germ cell nucleus", "id": "GO:0001673", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001673", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "ribonucleoprotein complex", "id": "GO:1990904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990904", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" }, { "name": "DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) complex", "id": "GO:0009330", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009330", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 1413, "end_pos": 1415, "annotation": "n_glycosylation_sequon" }, { "start_pos": 380, "end_pos": 382, "annotation": "n_glycosylation_sequon" }, { "start_pos": 451, "end_pos": 453, "annotation": "n_glycosylation_sequon" }, { "start_pos": 917, "end_pos": 919, "annotation": "n_glycosylation_sequon" }, { "start_pos": 945, "end_pos": 947, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "(Microbial infection) Deubiquitinated by Epstein-Barr virus BPLF1; leading to stabilized SUMOylated TOP2A trapped in cleavage complexes, which halts the DNA damage response to TOP2A-induced double-strand DNA breaks.", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "34543352", "url": "https://glygen.org/publication/PubMed/34543352" } ] }, { "annotation": "Phosphorylation has no effect on catalytic activity. However, phosphorylation at Ser-1106 by CSNK1D/CK1 promotes DNA cleavable complex formation.", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "19043076", "url": "https://glygen.org/publication/PubMed/19043076" }, { "database": "PubMed", "id": "10942766", "url": "https://glygen.org/publication/PubMed/10942766" }, { "database": "PubMed", "id": "18062778", "url": "https://glygen.org/publication/PubMed/18062778" } ] }, { "annotation": "SUMOylated.", "evidence": [ { "database": "UniProtKB", "id": "P11388", "url": "https://www.uniprot.org/uniprot/P11388" }, { "database": "PubMed", "id": "34543352", "url": "https://glygen.org/publication/PubMed/34543352" } ] } ], "interactions": [], "reactions": [ { "id": "R-HSA-4641342", "name": "SUMOylation of TOP2A with SUMO1", "equation": "", "summary": "TOP2A is SUMOylated with SUMO1 (Mao et al. 2000, Dawlaty et al. 2008, Matafora et al. 2009, Impens et al. 2014). SUMOylation is observed in response to TOP2A-mediated DNA damage induced by teniposide.", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [ "R-HSA-4641367" ], "enzyme_list": [ "P63279-1", "P11388-1" ], "evidence": [ { "id": "R-HSA-4641342", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641342" } ] }, { "id": "R-HSA-4641350", "name": "PIAS4 SUMOylates TOP2A with SUMO2,3", "equation": "", "summary": "PIAS4 SUMOylates TOP2A with SUMO2,3 (Diaz-Martinez et al. 2006, Agostinho et al. 2008, Impens et al. 2014, Tammsalu et al. 2014). SUMOylation is observed in interphase and mitosis in response to inhibitors of topoisomerase. SUMOylated TOP2A is localized to centromeres during mitosis.", "cellular_location": "nucleoplasm", "input_participant_list": [ "R-HSA-1362276" ], "output_participant_list": [ "R-HSA-4641298" ], "enzyme_list": [ "P63279-1", "P11388-1", "Q8N2W9-1" ], "evidence": [ { "id": "R-HSA-4641350", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641350" } ] }, { "id": "R-HSA-5228525", "name": "RANBP2 SUMOylates TOP2A with SUMO1", "equation": "", "summary": "RANBP2 of the nuclear pore complex SUMOylates TOP2A with SUMO1 (Dawlaty et al. 2008, Impens et al. 2014). SUMOylated TOP2A is localized to centromeres. As inferred from mouse homologs, SUMOylation of TOP2A by RANBP2 is required for resolution of sister centromeres (Dawlaty et al. 2008).", "cellular_location": "nuclear envelope, nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P63279-1", "P11388-1", "P49792-1" ], "evidence": [ { "id": "R-HSA-5228525", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5228525" } ] }, { "id": "R-HSA-8964531", "name": "TOP2A gene gene expression is repressed by the DREAM complex", "equation": "", "summary": "The DREAM complex directly represses the TOP2A gene transcription (Litovchick et al. 2007).", "cellular_location": "nucleoplasm", "input_participant_list": [ "R-HSA-8962659" ], "output_participant_list": [], "enzyme_list": [ "P11388-1" ], "evidence": [ { "id": "R-HSA-8964531", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964531" } ] } ], "reaction_participants": [ { "participant_id": "R-HSA-1362276", "participant_name": "TOP2A [nucleoplasm]", "crossref": [ { "id": "P11388", "database": "UniProt", "url": "" }, { "id": "TOP2A_HUMAN", "database": "ZINC - Substances", "url": "" }, { "id": "5GWK", "database": "PDB", "url": "" }, { "id": "ENSP00000411532", "database": "Ensembl", "url": "" }, { "id": "ENST00000423485", "database": "Ensembl", "url": "" }, { "id": "TOP2A_HUMAN", "database": "ZINC - FDA approved", "url": "" }, { "id": "P11388", "database": "PRO", "url": "" }, { "id": "TOP2A_HUMAN", "database": "ZINC - World Drugs", "url": "" }, { "id": "5NNE", "database": "PDB", "url": "" }, { "id": "1ZXN", "database": "PDB", "url": "" }, { "id": "HMDBP10697", "database": "HMDB Protein", "url": "" }, { "id": "P11388", "database": "Pharos - Targets", "url": "" }, { "id": "4FM9", "database": "PDB", "url": "" }, { "id": "4R1F", "database": "PDB", "url": "" }, { "id": "ENSG00000131747-TOP2A", "database": "HPA", "url": "" }, { "id": "6ZY7", "database": "PDB", "url": "" }, { "id": "6ZY8", "database": "PDB", "url": "" }, { "id": "ENSG00000131747", "database": "OpenTargets", "url": "" }, { "id": "TOP2A_HUMAN", "database": "ZINC - Biogenic", "url": "" }, { "id": "TOP2A_HUMAN", "database": "ZINC - Metabolites", "url": "" }, { "id": "1ZXM", "database": "PDB", "url": "" }, { "id": "TOP2A_HUMAN", "database": "ZINC - Predictions - Purchasable", "url": "" }, { "id": "NP_001058.2", "database": "RefSeq", "url": "" }, { "id": "22148", "database": "Orphanet", "url": "" }, { "id": "P11388", "database": "ZINC target", "url": "" }, { "id": "6ZY5", "database": "PDB", "url": "" }, { "id": "ENSG00000131747", "database": "Ensembl", "url": "" }, { "id": "2637", "database": "Guide to Pharmacology - Targets", "url": "" }, { "id": "6ZY6", "database": "PDB", "url": "" }, { "id": "P11388", "database": "GeneCards", "url": "" } ] }, { "participant_id": "R-HSA-4641298", "participant_name": "polySUMO2,3-TOP2A [nucleoplasm]", "crossref": [ { "id": "TOP2A_HUMAN", "database": "ZINC - Biogenic", "url": "" }, { "id": "ENSG00000131747", "database": "Ensembl", "url": "" }, { "id": "HMDBP10697", "database": "HMDB Protein", "url": "" }, { "id": "5GWK", "database": "PDB", "url": "" }, { "id": "ENSG00000131747-TOP2A", "database": "HPA", "url": "" }, { "id": "NP_001058.2", "database": "RefSeq", "url": "" }, { "id": "P11388", "database": "PRO", "url": "" }, { "id": "6ZY6", "database": "PDB", "url": "" }, { "id": "6ZY8", "database": "PDB", "url": "" }, { "id": "5NNE", "database": "PDB", "url": "" }, { "id": "P11388", "database": "ZINC target", "url": "" }, { "id": "ENST00000423485", "database": "Ensembl", "url": "" }, { "id": "1ZXM", "database": "PDB", "url": "" }, { "id": "4FM9", "database": "PDB", "url": "" }, { "id": "P11388", "database": "UniProt", "url": "" }, { "id": "6ZY7", "database": "PDB", "url": "" }, { "id": "22148", "database": "Orphanet", "url": "" }, { "id": "TOP2A_HUMAN", "database": "ZINC - World Drugs", "url": "" }, { "id": "2637", "database": "Guide to Pharmacology - Targets", "url": "" }, { "id": "P11388", "database": "Pharos - Targets", "url": "" }, { "id": "ENSP00000411532", "database": "Ensembl", "url": "" }, { "id": "TOP2A_HUMAN", "database": "ZINC - Metabolites", "url": "" }, { "id": "P11388", "database": "GeneCards", "url": "" }, { "id": "4R1F", "database": "PDB", "url": "" }, { "id": "TOP2A_HUMAN", "database": "ZINC - FDA approved", "url": "" }, { "id": "TOP2A_HUMAN", "database": "ZINC - Predictions - Purchasable", "url": "" }, { "id": "TOP2A_HUMAN", "database": "ZINC - Substances", "url": "" }, { "id": "1ZXN", "database": "PDB", "url": "" }, { "id": "6ZY5", "database": "PDB", "url": "" }, { "id": "ENSG00000131747", "database": "OpenTargets", "url": "" } ] }, { "participant_id": "R-HSA-4641367", "participant_name": "monoSUMO1-K-TOP2A [nucleoplasm]", "crossref": [ { "id": "6ZY7", "database": "PDB", "url": "" }, { "id": "22148", "database": "Orphanet", "url": "" }, { "id": "TOP2A_HUMAN", "database": "ZINC - World Drugs", "url": "" }, { "id": "ENSP00000411532", "database": "Ensembl", "url": "" }, { "id": "TOP2A_HUMAN", "database": "ZINC - Metabolites", "url": "" }, { "id": "2637", "database": "Guide to Pharmacology - Targets", "url": "" }, { "id": "P11388", "database": "Pharos - Targets", "url": "" }, { "id": "P11388", "database": "GeneCards", "url": "" }, { "id": "4R1F", "database": "PDB", "url": "" }, { "id": "TOP2A_HUMAN", "database": "ZINC - FDA approved", "url": "" }, { "id": "TOP2A_HUMAN", "database": "ZINC - Predictions - Purchasable", "url": "" }, { "id": "TOP2A_HUMAN", "database": "ZINC - Substances", "url": "" }, { "id": "ENSG00000131747", "database": "OpenTargets", "url": "" }, { "id": "6ZY5", "database": "PDB", "url": "" }, { "id": "1ZXN", "database": "PDB", "url": "" }, { "id": "P11388", "database": "UniProt", "url": "" }, { "id": "ENSG00000131747-TOP2A", "database": "HPA", "url": "" }, { "id": "NP_001058.2", "database": "RefSeq", "url": "" }, { "id": "P11388", "database": "PRO", "url": "" }, { "id": "ENSG00000131747", "database": "Ensembl", "url": "" }, { "id": "HMDBP10697", "database": "HMDB Protein", "url": "" }, { "id": "5GWK", "database": "PDB", "url": "" }, { "id": "TOP2A_HUMAN", "database": "ZINC - Biogenic", "url": "" }, { "id": "6ZY6", "database": "PDB", "url": "" }, { "id": "6ZY8", "database": "PDB", "url": "" }, { "id": "5NNE", "database": "PDB", "url": "" }, { "id": "P11388", "database": "ZINC target", "url": "" }, { "id": "ENST00000423485", "database": "Ensembl", "url": "" }, { "id": "1ZXM", "database": "PDB", "url": "" }, { "id": "4FM9", "database": "PDB", "url": "" } ] }, { "participant_id": "R-HSA-8962659", "participant_name": "TOP2A gene [nucleoplasm]", "crossref": [ { "id": "ENSG00000131747", "database": "ENSEMBL", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "P11388", "gene_name": "TOP2A", "activity": [ { "ec_number": "5.6.2.2", "activity": "ATP-dependent breakage, passage and rejoining of double-stranded DNA.", "evidence": [ { "id": "P11388", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11388" } ] }, { "ec_number": "5.6.2.2", "activity": "", "evidence": [ { "id": "P11388", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11388" } ] } ] }, { "uniprot_ac": "P49792", "gene_name": "RANBP2", "activity": [ { "ec_number": "2.3.2.-", "activity": "", "evidence": [ { "id": "P49792", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49792" } ] }, { "ec_number": "5.2.1.8", "activity": "[protein]-peptidylproline (omega=180) = [protein]-peptidylproline (omega=0).", "evidence": [ { "id": "P49792", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49792" } ] }, { "ec_number": "5.2.1.8", "activity": "", "evidence": [ { "id": "P49792", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49792" } ] } ] }, { "uniprot_ac": "P63279", "gene_name": "UBE2I", "activity": [ { "ec_number": "2.3.2.-", "activity": "", "evidence": [ { "id": "P63279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63279" } ] } ] }, { "uniprot_ac": "Q8N2W9", "gene_name": "PIAS4", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8N2W9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N2W9" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8N2W9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N2W9" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 387, 390, 395, 641, 654, 1374, 1423, 1425, 1426, 1427, 1428, 1469, 1470, 1471, 1487, 1488 ], "snv_sites": [ 93, 260, 371, 387, 545, 600, 641, 654, 689, 692, 739, 835, 1000, 1052, 1243, 1352, 1374, 1385, 1423, 1426, 1427, 1428, 1471, 1483, 1487, 1488 ], "glycation_sites": [], "phosphorylation_sites": [ 4, 29, 230, 282, 285, 707, 1106, 1115, 1117, 1162, 1164, 1205, 1213, 1244, 1247, 1295, 1297, 1299, 1302, 1303, 1306, 1327, 1332, 1337, 1343, 1351, 1354, 1358, 1360, 1361, 1365, 1374, 1377, 1387, 1391, 1392, 1393, 1397, 1403, 1449, 1452, 1469, 1470, 1471, 1474, 1476, 1491, 1495, 1504, 1521, 1525 ], "sequon_annotation_sites": [ { "start_pos": 1413, "end_pos": 1415 }, { "start_pos": 380, "end_pos": 382 }, { "start_pos": 451, "end_pos": 453 }, { "start_pos": 917, "end_pos": 919 }, { "start_pos": 945, "end_pos": 947 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 16 }, { "field": "total_sites", "count": 16 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 16 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 16 }, { "field": "total_sites", "count": 16 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 16 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 76 }, { "field": "total_sites", "count": 51 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 27 }, { "field": "total_sites", "count": 26 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 23 }, { "field": "total_sites", "count": 22 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 112 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }