{ "uniprot_canonical_ac": "P11279-1", "uniprot_ac": "P11279", "uniprot_id": "LAMP1_HUMAN", "mass": { "chemical_mass": 44882.0, "monoisotopic_mass": 44882.0 }, "refseq": { "ac": "NP_005552", "name": "lysosome-associated membrane glycoprotein 1 precursor", "summary": "The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may also play a role in tumor cell metastasis. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005552" }, "gene_names": [ { "name": "LAMP1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P11279", "id": "P11279" }, { "name": "CD107a; LAMPA; LGP120", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005552", "id": "NP_005552" }, { "name": "LAMP1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005552", "id": "NP_005552" } ], "protein_names": [ { "name": "Lysosome-associated membrane glycoprotein 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P11279" }, { "name": "CD107 antigen-like family member A", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P11279" }, { "name": "LAMP-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P11279" }, { "name": "Lysosome-associated membrane protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P11279" }, { "name": "lysosome-associated membrane glycoprotein 1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005552", "id": "NP_005552" }, { "name": "lysosome-associated membrane glycoprotein 1; LAMP-1; CD107 antigen-like family member A; lysosome-associated membrane protein 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005552", "id": "NP_005552" } ], "function": [ { "annotation": "(Microbial infection) Acts as a receptor for Lassa virus glycoprotein (PubMed:24970085, PubMed:25972533, PubMed:27605678, PubMed:28448640). Promotes also fusion of the virus with host membrane in less acidic endosomes (PubMed:29295909).", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279#function" }, { "database": "PubMed", "id": "24970085", "url": "https://glygen.org/publication/PubMed/24970085" }, { "database": "PubMed", "id": "28448640", "url": "https://glygen.org/publication/PubMed/28448640" }, { "database": "PubMed", "id": "25972533", "url": "https://glygen.org/publication/PubMed/25972533" }, { "database": "PubMed", "id": "27605678", "url": "https://glygen.org/publication/PubMed/27605678" }, { "database": "PubMed", "id": "29295909", "url": "https://glygen.org/publication/PubMed/29295909" } ] }, { "annotation": "(Microbial infection) Supports the FURIN-mediated cleavage of mumps virus fusion protein F by interacting with both FURIN and the unprocessed form but not the processed form of the viral protein F.", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279#function" }, { "database": "PubMed", "id": "32295904", "url": "https://glygen.org/publication/PubMed/32295904" } ] }, { "annotation": "Human LAMP1 accelerates Lassa virus fusion and potently promotes fusion pore dilation upon forcing viral fusion with non-endosomal membrane. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_005552", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005552" }, { "database": "PubMed", "id": "35969633", "url": "https://glygen.org/publication/PubMed/35969633" } ] }, { "annotation": "Loss of RND3/RHOE controls entosis through LAMP1 expression in hepatocellular carcinoma. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_005552", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005552" }, { "database": "PubMed", "id": "38218945", "url": "https://glygen.org/publication/PubMed/38218945" } ] }, { "annotation": "Lysosomal LAMP proteins regulate lysosomal pH by direct inhibition of the TMEM175 channel.", "evidence": [ { "database": "RefSeq", "id": "NP_005552", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005552" }, { "database": "PubMed", "id": "37390818", "url": "https://glygen.org/publication/PubMed/37390818" } ] }, { "annotation": "Lysosomal membrane glycoprotein which plays an important role in lysosome biogenesis, lysosomal pH regulation, autophagy and cholesterol homeostasis (PubMed:37390818). Acts as an important regulator of lysosomal lumen pH regulation by acting as a direct inhibitor of the proton channel TMEM175, facilitating lysosomal acidification for optimal hydrolase activity (PubMed:37390818). Also plays an important role in NK-cells cytotoxicity (PubMed:2022921, PubMed:23632890). Mechanistically, participates in cytotoxic granule movement to the cell surface and perforin trafficking to the lytic granule (PubMed:23632890). In addition, protects NK-cells from degranulation-associated damage induced by their own cytotoxic granule content (PubMed:23847195). Presents carbohydrate ligands to selectins (PubMed:7685349).", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279#function" }, { "database": "PubMed", "id": "23847195", "url": "https://glygen.org/publication/PubMed/23847195" }, { "database": "PubMed", "id": "2022921", "url": "https://glygen.org/publication/PubMed/2022921" }, { "database": "PubMed", "id": "23632890", "url": "https://glygen.org/publication/PubMed/23632890" }, { "database": "PubMed", "id": "37390818", "url": "https://glygen.org/publication/PubMed/37390818" }, { "database": "PubMed", "id": "7685349", "url": "https://glygen.org/publication/PubMed/7685349" } ] }, { "annotation": "Porcine hemagglutinating encephalomyelitis virus induces atypical autophagy via opposite regulation of expression and nuclear translocation of transcription factor EB.", "evidence": [ { "database": "RefSeq", "id": "NP_005552", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005552" }, { "database": "PubMed", "id": "33640682", "url": "https://glygen.org/publication/PubMed/33640682" } ] }, { "annotation": "The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may also play a role in tumor cell metastasis. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_005552", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005552" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs377651869", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs377651869" }, { "id": "rs377651869", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs377651869" }, { "id": "rs377651869", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs377651869#frequency_tab" }, { "id": "rs377651869", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs377651869" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 105, "end_pos": 105, "sequence_org": "T", "sequence_mut": "M", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->NFM); o-glyco-site-loss (T->M).", "chr_id": "13", "chr_pos": "113309773", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T105", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "rs1328726335", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1328726335" }, { "id": "rs1328726335", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1328726335#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 225, "end_pos": 225, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SGT->NGT); n-glyco-sequon-loss (NVS->NVN).", "chr_id": "13", "chr_pos": "113319580", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S225", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs369224631", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369224631" }, { "id": "rs369224631", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369224631" }, { "id": "rs369224631", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs369224631#frequency_tab" }, { "id": "rs369224631", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs369224631" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 64, "end_pos": 64, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMT->NMI); o-glyco-site-loss (T->I).", "chr_id": "13", "chr_pos": "113309650", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T64", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs757261971", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757261971" }, { "id": "rs757261971", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757261971" }, { "id": "rs757261971", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757261971#frequency_tab" }, { "id": "rs757261971", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757261971" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 103, "end_pos": 103, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->DFT).", "chr_id": "13", "chr_pos": "113309766", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N103", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1483329400", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1483329400" }, { "id": "rs1483329400", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1483329400#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 121, "end_pos": 121, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->DLS).", "chr_id": "13", "chr_pos": "113309820", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N121", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P11279", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P11279" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 121, "end_pos": 121, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "N", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLS->KLS).", "chr_id": "13", "chr_pos": "113309822", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "N121", "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs773621462", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773621462" }, { "id": "rs773621462", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773621462" }, { "id": "rs773621462", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773621462" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 123, "end_pos": 123, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->NLL).", "chr_id": "13", "chr_pos": "113309827", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S123", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1216166759", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1216166759" }, { "id": "rs1216166759", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1216166759" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 130, "end_pos": 130, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->DAS).", "chr_id": "13", "chr_pos": "113309847", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N130", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs763705634", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763705634" }, { "id": "rs763705634", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763705634" }, { "id": "rs763705634", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs763705634#frequency_tab" }, { "id": "rs763705634", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763705634" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 130, "end_pos": 130, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "13", "chr_pos": "113309848", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N130", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs745800693", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745800693" }, { "id": "rs745800693", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745800693" }, { "id": "rs745800693", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745800693" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 132, "end_pos": 132, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->NAR).", "chr_id": "13", "chr_pos": "113309855", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S132", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs928453372", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs928453372" }, { "id": "rs928453372", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs928453372#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 157, "end_pos": 157, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SGT->NGT).", "chr_id": "13", "chr_pos": "113310775", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S157", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P11279", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P11279" }, { "id": "rs1210069640", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1210069640" }, { "id": "rs1210069640", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1210069640" }, { "id": "rs1210069640", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1210069640" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 181, "end_pos": 181, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "13", "chr_pos": "113310847", "ref_nt": "A", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "N181", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs1311840113", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1311840113" }, { "id": "rs1311840113", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1311840113#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 199, "end_pos": 199, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "13", "chr_pos": "113319501", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T199", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1453784712", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1453784712" }, { "id": "rs1453784712", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1453784712#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 207, "end_pos": 207, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "13", "chr_pos": "113319527", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S207", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs200052831", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200052831" }, { "id": "rs200052831", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200052831" }, { "id": "rs200052831", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200052831" }, { "id": "rs200052831", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs200052831#frequency_tab" }, { "id": "rs200052831", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200052831" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 209, "end_pos": 209, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "13", "chr_pos": "113319532", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.000599", "site_lbl": "S209", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs975619683", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs975619683" }, { "id": "rs975619683", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs975619683#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 218, "end_pos": 218, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "13", "chr_pos": "113319559", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S218", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs745443481", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745443481" }, { "id": "rs745443481", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745443481" }, { "id": "rs745443481", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs745443481#frequency_tab" }, { "id": "rs745443481", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745443481" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 223, "end_pos": 223, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->SVS).", "chr_id": "13", "chr_pos": "113319574", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N223", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs760712195", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760712195" }, { "id": "rs760712195", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760712195" }, { "id": "rs760712195", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760712195" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 225, "end_pos": 225, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->NVR).", "chr_id": "13", "chr_pos": "113319581", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S225", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1005413564", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1005413564" }, { "id": "rs1005413564", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1005413564" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 228, "end_pos": 228, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->HGT).", "chr_id": "13", "chr_pos": "113319588", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N228", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1382329977", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1382329977" }, { "id": "rs1382329977", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1382329977#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 228, "end_pos": 228, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "13", "chr_pos": "113319589", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N228", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs369669372", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369669372" }, { "id": "rs369669372", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369669372" }, { "id": "rs369669372", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs369669372" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 243, "end_pos": 243, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->NLI).", "chr_id": "13", "chr_pos": "113319634", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T243", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs755576074", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755576074" }, { "id": "rs755576074", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs755576074" }, { "id": "rs755576074", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs755576074#frequency_tab" }, { "id": "rs755576074", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs755576074" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 249, "end_pos": 249, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->KTT).", "chr_id": "13", "chr_pos": "113319653", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N249", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P11279", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P11279" }, { "id": "rs370286796", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs370286796" }, { "id": "rs370286796", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs370286796" }, { "id": "rs370286796", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs370286796" }, { "id": "rs370286796", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs370286796#frequency_tab" }, { "id": "rs370286796", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs370286796" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 251, "end_pos": 251, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "M", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTT->NTM).", "chr_id": "13", "chr_pos": "113320346", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T251", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs758133363", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758133363" }, { "id": "rs758133363", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758133363" }, { "id": "rs758133363", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758133363#frequency_tab" }, { "id": "rs758133363", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758133363" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 251, "end_pos": 251, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->NTP).", "chr_id": "13", "chr_pos": "113320345", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T251", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1595464413", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1595464413" }, { "id": "rs1595464413", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1595464413" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 259, "end_pos": 259, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NIN->NIT).", "chr_id": "13", "chr_pos": "113320370", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N259", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs749315723", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749315723" }, { "id": "rs749315723", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749315723" }, { "id": "rs749315723", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749315723" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 261, "end_pos": 261, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->KKT).", "chr_id": "13", "chr_pos": "113320377", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N261", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1469959940", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1469959940" }, { "id": "rs1469959940", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1469959940" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 261, "end_pos": 261, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->SKT).", "chr_id": "13", "chr_pos": "113320376", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N261", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs774188089", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774188089" }, { "id": "rs774188089", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774188089" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 263, "end_pos": 263, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->NKI).", "chr_id": "13", "chr_pos": "113320382", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T263", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs774188089", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774188089" }, { "id": "rs774188089", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774188089" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 263, "end_pos": 263, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->NKN).", "chr_id": "13", "chr_pos": "113320382", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T263", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1595464424", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1595464424" }, { "id": "rs1595464424", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1595464424" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 263, "end_pos": 263, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->NKP).", "chr_id": "13", "chr_pos": "113320381", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T263", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs375412629", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375412629" }, { "id": "rs375412629", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375412629" }, { "id": "rs375412629", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs375412629#frequency_tab" }, { "id": "rs375412629", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375412629" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 293, "end_pos": 293, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->SAS).", "chr_id": "13", "chr_pos": "113321405", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N293", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs753635721", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753635721" }, { "id": "rs753635721", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753635721" }, { "id": "rs753635721", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs753635721#frequency_tab" }, { "id": "rs753635721", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs753635721" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 295, "end_pos": 295, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->NAR).", "chr_id": "13", "chr_pos": "113321410", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S295", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P11279", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P11279" }, { "id": "rs9577230", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs9577230" }, { "id": "rs9577230", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs9577230" }, { "id": "rs9577230", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs9577230" }, { "id": "rs9577230", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs9577230#frequency_tab" }, { "id": "rs9577230", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs9577230" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 309, "end_pos": 309, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "I", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NTI->NTT).", "chr_id": "13", "chr_pos": "113321453", "ref_nt": "T", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "I309", "disease": [ { "disease_id": "DOID:2531", "recommended_name": { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes." }, "synonyms": [ { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematologic malignancy", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematologic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematological tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "blood cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic and lymphoid system tumor", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "malignant hematopoietic neoplasm", "description": "" } ] }, { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ] }, { "evidence": [ { "id": "rs985101210", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs985101210" }, { "id": "rs985101210", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs985101210#frequency_tab" }, { "id": "rs985101210", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs985101210" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 322, "end_pos": 322, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "13", "chr_pos": "113321578", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N322", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs985101210", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs985101210" }, { "id": "rs985101210", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs985101210#frequency_tab" }, { "id": "rs985101210", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs985101210" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 322, "end_pos": 322, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->TGS).", "chr_id": "13", "chr_pos": "113321578", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N322", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P11279", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P11279" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 324, "end_pos": 324, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "C", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGS->NGC).", "chr_id": "13", "chr_pos": "113321584", "ref_nt": "C", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "S324", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1481826672", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1481826672" }, { "id": "rs1481826672", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1481826672#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 324, "end_pos": 324, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->NGF).", "chr_id": "13", "chr_pos": "113321584", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S324", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1180612685", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1180612685" }, { "id": "rs1180612685", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1180612685#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 324, "end_pos": 324, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->NGP).", "chr_id": "13", "chr_pos": "113321583", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S324", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs184787579", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs184787579" }, { "id": "rs184787579", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs184787579" }, { "id": "rs184787579", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs184787579" }, { "id": "rs184787579", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs184787579#frequency_tab" }, { "id": "rs184787579", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs184787579" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 37, "end_pos": 37, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->KGT).", "chr_id": "13", "chr_pos": "113306534", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "N37", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1206975062", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1206975062" }, { "id": "rs1206975062", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1206975062" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 381, "end_pos": 381, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->C).", "chr_id": "13", "chr_pos": "113322308", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S381", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1172407014", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1172407014" }, { "id": "rs1172407014", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1172407014" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 45, "end_pos": 45, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->KFS).", "chr_id": "13", "chr_pos": "113306558", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N45", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1401533589", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1401533589" }, { "id": "rs1401533589", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1401533589#frequency_tab" }, { "id": "23415222", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23415222" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 45, "end_pos": 45, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFS->SFS).", "chr_id": "13", "chr_pos": "113306557", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N45", "keywords": [ "ebi", "somatic" ] }, { "evidence": [ { "id": "P11279", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P11279" }, { "id": "rs1474931156", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1474931156" }, { "id": "rs1474931156", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1474931156" }, { "id": "rs1474931156", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1474931156#frequency_tab" }, { "id": "rs1474931156", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1474931156" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 69, "end_pos": 69, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "P", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->P).", "chr_id": "13", "chr_pos": "113309664", "ref_nt": "T", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "S69", "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs774558141", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774558141" }, { "id": "rs774558141", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774558141" }, { "id": "rs774558141", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs774558141#frequency_tab" }, { "id": "rs774558141", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs774558141" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 76, "end_pos": 76, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->IRS).", "chr_id": "13", "chr_pos": "113309686", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N76", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs774558141", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774558141" }, { "id": "rs774558141", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774558141" }, { "id": "rs774558141", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs774558141#frequency_tab" }, { "id": "rs774558141", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs774558141" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 76, "end_pos": 76, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->SRS).", "chr_id": "13", "chr_pos": "113309686", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N76", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs774558141", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774558141" }, { "id": "rs774558141", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774558141" }, { "id": "rs774558141", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs774558141#frequency_tab" }, { "id": "rs774558141", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs774558141" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 76, "end_pos": 76, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRS->TRS).", "chr_id": "13", "chr_pos": "113309686", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N76", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs762446154", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762446154" }, { "id": "rs762446154", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762446154" }, { "id": "rs762446154", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs762446154#frequency_tab" }, { "id": "rs762446154", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762446154" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 84, "end_pos": 84, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->TTS).", "chr_id": "13", "chr_pos": "113309710", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N84", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1257492649", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1257492649" }, { "id": "rs1257492649", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1257492649" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 85, "end_pos": 85, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->N).", "chr_id": "13", "chr_pos": "113309713", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T85", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P11279", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P11279" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 86, "end_pos": 86, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "P", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTS->NTP).", "chr_id": "13", "chr_pos": "113309715", "ref_nt": "T", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "S86", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1485609661", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1485609661" }, { "id": "rs1485609661", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1485609661#frequency_tab" }, { "id": "rs1485609661", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1485609661" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 86, "end_pos": 86, "sequence_org": "S", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->NTY).", "chr_id": "13", "chr_pos": "113309716", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S86", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 76, "end_pos": 76, "sequence_org": "N", "sequence_mut": "S", "comment": "Complete loss of interaction with Lassa virus protein GPC.", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" }, { "database": "PubMed", "id": "24970085", "url": "https://glygen.org/publication/PubMed/24970085" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "98.8", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185896", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185896" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "99.6", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185896", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185896" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "97.77", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185896", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185896" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "99.4", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185896", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185896" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "98.79", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185896", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185896" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "96.73", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185896", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185896" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "99.37", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185896", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185896" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "98.88", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185896", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185896" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "98.15", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185896", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185896" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "99.63", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185896", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185896" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "97.87", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185896", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185896" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "97.19", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185896", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185896" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "98.31", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185896", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185896" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P11279", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11279" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P11279", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11279" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P11279", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11279" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P11279", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11279" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P11279", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11279" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P11279", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11279" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P11279", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11279" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P11279", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11279" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P11279", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11279" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P11279", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11279" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P11279", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11279" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P11279", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P11279" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "common_name": "Human" } ], "gene": [ { "name": "LAMP1", "url": "https://www.uniprot.org/uniprot/P11279", "locus": { "chromosome": "13", "start_pos": 113323672, "end_pos": 113297239, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000185896", "url": "https://www.ensembl.org/id/ENSG00000185896" } ] } } ], "crossref": [ { "id": "ENSG00000185896", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185896", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P11279", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P11279", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd12087", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12087", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "LAMP1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=LAMP1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "3916", "url": "https://www.ncbi.nlm.nih.gov/gene/3916", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "6499", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=6499", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P11279", "url": "https://www.ebi.ac.uk/intact/interactors/id:P11279*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002000", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002000", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018134", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018134", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR048524", "url": "https://www.ebi.ac.uk/interpro/entry/IPR048524", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR048528", "url": "https://www.ebi.ac.uk/interpro/entry/IPR048528", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:3916", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3916", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "153330", "url": "http://www.omim.org/entry/153330", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P11279", "url": "https://www.nextprot.org/entry/NX_P11279", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P11279", "url": "https://oglcnac.org/atlas/detail/P11279", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P11279", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11279", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "CQMDQNQ", "url": "https://omabrowser.org/oma/group/CQMDQNQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5404772at2759", "url": "http://www.orthodb.org/?query=5404772at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11506", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11506", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11506:SF27", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11506:SF27", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "8ATH", "url": "https://www.rcsb.org/structure/8ATH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8FY5", "url": "https://www.rcsb.org/structure/8FY5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8FYF", "url": "https://www.rcsb.org/structure/8FYF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01299", "url": "http://pfam.xfam.org/family/PF01299", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF21222", "url": "http://pfam.xfam.org/family/PF21222", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P11279", "url": "https://pharos.nih.gov/targets/P11279", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000054853", "url": "https://proconsortium.org/app/entry/PR:000054853", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054854", "url": "https://proconsortium.org/app/entry/PR:000054854", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054855", "url": "https://proconsortium.org/app/entry/PR:000054855", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054856", "url": "https://proconsortium.org/app/entry/PR:000054856", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054857", "url": "https://proconsortium.org/app/entry/PR:000054857", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054858", "url": "https://proconsortium.org/app/entry/PR:000054858", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054859", "url": "https://proconsortium.org/app/entry/PR:000054859", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054860", "url": "https://proconsortium.org/app/entry/PR:000054860", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054861", "url": "https://proconsortium.org/app/entry/PR:000054861", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054862", "url": "https://proconsortium.org/app/entry/PR:000054862", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054863", "url": "https://proconsortium.org/app/entry/PR:000054863", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054864", "url": "https://proconsortium.org/app/entry/PR:000054864", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054865", "url": "https://proconsortium.org/app/entry/PR:000054865", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054866", "url": "https://proconsortium.org/app/entry/PR:000054866", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054867", "url": "https://proconsortium.org/app/entry/PR:000054867", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054868", "url": "https://proconsortium.org/app/entry/PR:000054868", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054869", "url": "https://proconsortium.org/app/entry/PR:000054869", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054870", "url": "https://proconsortium.org/app/entry/PR:000054870", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054871", "url": "https://proconsortium.org/app/entry/PR:000054871", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054872", "url": "https://proconsortium.org/app/entry/PR:000054872", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054873", "url": "https://proconsortium.org/app/entry/PR:000054873", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054874", "url": "https://proconsortium.org/app/entry/PR:000054874", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054875", "url": "https://proconsortium.org/app/entry/PR:000054875", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054876", "url": "https://proconsortium.org/app/entry/PR:000054876", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054877", "url": "https://proconsortium.org/app/entry/PR:000054877", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054878", "url": "https://proconsortium.org/app/entry/PR:000054878", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054879", "url": "https://proconsortium.org/app/entry/PR:000054879", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054880", "url": "https://proconsortium.org/app/entry/PR:000054880", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054881", "url": "https://proconsortium.org/app/entry/PR:000054881", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054882", "url": "https://proconsortium.org/app/entry/PR:000054882", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054883", "url": "https://proconsortium.org/app/entry/PR:000054883", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054884", "url": "https://proconsortium.org/app/entry/PR:000054884", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054885", "url": "https://proconsortium.org/app/entry/PR:000054885", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054886", "url": "https://proconsortium.org/app/entry/PR:000054886", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054887", "url": "https://proconsortium.org/app/entry/PR:000054887", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054888", "url": "https://proconsortium.org/app/entry/PR:000054888", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054889", "url": "https://proconsortium.org/app/entry/PR:000054889", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054890", "url": "https://proconsortium.org/app/entry/PR:000054890", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054891", "url": "https://proconsortium.org/app/entry/PR:000054891", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054892", "url": "https://proconsortium.org/app/entry/PR:000054892", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054893", "url": "https://proconsortium.org/app/entry/PR:000054893", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054894", "url": "https://proconsortium.org/app/entry/PR:000054894", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054895", "url": "https://proconsortium.org/app/entry/PR:000054895", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054896", "url": "https://proconsortium.org/app/entry/PR:000054896", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054897", "url": "https://proconsortium.org/app/entry/PR:000054897", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054898", "url": "https://proconsortium.org/app/entry/PR:000054898", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054899", "url": "https://proconsortium.org/app/entry/PR:000054899", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054900", "url": "https://proconsortium.org/app/entry/PR:000054900", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054901", "url": "https://proconsortium.org/app/entry/PR:000054901", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054902", "url": "https://proconsortium.org/app/entry/PR:000054902", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054903", "url": "https://proconsortium.org/app/entry/PR:000054903", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054904", "url": "https://proconsortium.org/app/entry/PR:000054904", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054905", "url": "https://proconsortium.org/app/entry/PR:000054905", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054906", "url": "https://proconsortium.org/app/entry/PR:000054906", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054907", "url": "https://proconsortium.org/app/entry/PR:000054907", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054908", "url": "https://proconsortium.org/app/entry/PR:000054908", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054909", "url": "https://proconsortium.org/app/entry/PR:000054909", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054910", "url": "https://proconsortium.org/app/entry/PR:000054910", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054911", "url": "https://proconsortium.org/app/entry/PR:000054911", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054912", "url": "https://proconsortium.org/app/entry/PR:000054912", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054913", "url": "https://proconsortium.org/app/entry/PR:000054913", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054914", "url": "https://proconsortium.org/app/entry/PR:000054914", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054915", "url": "https://proconsortium.org/app/entry/PR:000054915", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054916", "url": "https://proconsortium.org/app/entry/PR:000054916", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054917", "url": "https://proconsortium.org/app/entry/PR:000054917", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054918", "url": "https://proconsortium.org/app/entry/PR:000054918", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054919", "url": "https://proconsortium.org/app/entry/PR:000054919", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054920", "url": "https://proconsortium.org/app/entry/PR:000054920", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054921", "url": "https://proconsortium.org/app/entry/PR:000054921", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054922", "url": "https://proconsortium.org/app/entry/PR:000054922", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054923", "url": "https://proconsortium.org/app/entry/PR:000054923", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054924", "url": "https://proconsortium.org/app/entry/PR:000054924", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054925", "url": "https://proconsortium.org/app/entry/PR:000054925", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054926", "url": "https://proconsortium.org/app/entry/PR:000054926", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054927", "url": "https://proconsortium.org/app/entry/PR:000054927", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054928", "url": "https://proconsortium.org/app/entry/PR:000054928", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054929", "url": "https://proconsortium.org/app/entry/PR:000054929", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054930", "url": "https://proconsortium.org/app/entry/PR:000054930", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054931", "url": "https://proconsortium.org/app/entry/PR:000054931", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054932", "url": "https://proconsortium.org/app/entry/PR:000054932", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054933", "url": "https://proconsortium.org/app/entry/PR:000054933", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054934", "url": "https://proconsortium.org/app/entry/PR:000054934", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054935", "url": "https://proconsortium.org/app/entry/PR:000054935", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054936", "url": "https://proconsortium.org/app/entry/PR:000054936", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054937", "url": "https://proconsortium.org/app/entry/PR:000054937", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054938", "url": "https://proconsortium.org/app/entry/PR:000054938", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054939", "url": "https://proconsortium.org/app/entry/PR:000054939", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054940", "url": "https://proconsortium.org/app/entry/PR:000054940", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054941", "url": "https://proconsortium.org/app/entry/PR:000054941", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054942", "url": "https://proconsortium.org/app/entry/PR:000054942", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054943", "url": "https://proconsortium.org/app/entry/PR:000054943", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054944", "url": "https://proconsortium.org/app/entry/PR:000054944", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054945", "url": "https://proconsortium.org/app/entry/PR:000054945", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054946", "url": "https://proconsortium.org/app/entry/PR:000054946", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P11279", "url": "http://purl.obolibrary.org/obo/PR_P11279", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_005552", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005552", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P11279", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P11279-1", "url": "https://www.uniprot.org/uniprot/P11279-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P11279-2", "url": "https://www.uniprot.org/uniprot/P11279-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDTKSGPKNMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVLLFQFGMNASSSRFFLQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAFSVNIFKVWVQAFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI", "length": 417, "header": "sp|P11279-1|LAMP1_HUMAN Isoform 1 of Lysosome-associated membrane glycoprotein 1 OS=Homo sapiens OX=9606 GN=LAMP1 PE=1 SV=3 CANONICAL=P11279-1" }, "isoforms": [ { "isoform_ac": "P11279-1", "url": "", "sequence": { "sequence": "MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDTKSGPKNMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVLLFQFGMNASSSRFFLQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAFSVNIFKVWVQAFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI", "length": 417, "header": "sp|P11279-1|LAMP1_HUMAN Isoform 1 of Lysosome-associated membrane glycoprotein 1 OS=Homo sapiens OX=9606 GN=LAMP1 PE=1 SV=3 CANONICAL=P11279-1" }, "locus": { "chromosome": "13", "start_pos": 113322418, "end_pos": 113297435, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000332556.5", "url": "https://www.ensembl.org/id/ENST00000332556.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000333298.4", "url": "https://www.ensembl.org/id/ENSP00000333298.4" } ] } }, { "isoform_ac": "P11279-2", "url": "", "sequence": { "sequence": "MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDTKSGPKNMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVLLFQFGMNASSSRFFLQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAFSVNIFKVWVQAFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI", "length": 364, "header": "sp|P11279-2|LAMP1_HUMAN Isoform 2 of Lysosome-associated membrane glycoprotein 1 OS=Homo sapiens OX=9606 GN=LAMP1 PE=1 SV=3 CANONICAL=P11279-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G00406II", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G01650EU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P11279@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P11279@N103" } ] }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" }, { "id": "P11279@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P11279@N103" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G20210JR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25637MV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G28541PG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "P11279@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P11279@N103" } ] }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" }, { "id": "P11279@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P11279@N103" } ] }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" }, { "id": "P11279@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P11279@N103" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G50372IH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G55220VL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G56784JY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80966KZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84820NF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G92050GC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "P11279@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P11279@N103" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P11279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "12754519", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12754519" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 105, "start_aa": "Thr", "end_pos": 105, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr105", "evidence": [ { "id": "P11279", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11279" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "P11279", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11279" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 107, "start_aa": "Asn", "end_pos": 107, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn107", "evidence": [ { "id": "P11279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (polylactosaminoglycan) asparagine", "start_pos": 121, "start_aa": "Asn", "end_pos": 121, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn121", "evidence": [ { "id": "P11279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (polylactosaminoglycan) asparagine", "start_pos": 130, "start_aa": "Asn", "end_pos": 130, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn130", "evidence": [ { "id": "P11279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 164, "start_aa": "Asn", "end_pos": 164, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn164", "evidence": [ { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 165, "start_aa": "Asn", "end_pos": 165, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn165", "evidence": [ { "id": "P11279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" }, { "id": "2243102", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2243102" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 181, "start_aa": "Asn", "end_pos": 181, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn181", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 181, "start_aa": "Asn", "end_pos": 181, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn181", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20210JR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 181, "start_aa": "Asn", "end_pos": 181, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn181", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 181, "start_aa": "Asn", "end_pos": 181, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn181", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 181, "start_aa": "Asn", "end_pos": 181, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn181", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 181, "start_aa": "Asn", "end_pos": 181, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn181", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P11279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" }, { "id": "2243102", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2243102" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "automatic_literature_mining", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 183, "start_aa": "Ser", "end_pos": 183, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser183", "evidence": [ { "id": "8323299", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/8323299" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "SRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPS", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 185, "start_aa": "Ser", "end_pos": 218, "end_aa": "Ser", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "SRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKY", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 185, "start_aa": "Ser", "end_pos": 222, "end_aa": "Tyr", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "CEQDRPSPTTAPPAPPSPSPSPVPK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 191, "start_aa": "Cys", "end_pos": 215, "end_aa": "Lys", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-196, T-198, T-199, S-206, S-208, S-210", "start_pos": 197, "start_aa": "Ser", "end_pos": 197, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser197", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-196, T-198, T-199, S-206, S-208, S-210", "start_pos": 197, "start_aa": "Ser", "end_pos": 197, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser197", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-196, T-198, T-199, S-206, S-208, S-210", "start_pos": 197, "start_aa": "Ser", "end_pos": 197, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser197", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine; partial O-GalNAcylation", "start_pos": 197, "start_aa": "Ser", "end_pos": 197, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser197", "evidence": [ { "id": "P11279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "SPT", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 197, "start_aa": "Ser", "end_pos": 199, "end_aa": "Thr", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-196, T-198, T-199, S-206, S-208, S-210", "start_pos": 199, "start_aa": "Thr", "end_pos": 199, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr199", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 199, "start_aa": "Thr", "end_pos": 199, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr199", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-196, T-198, T-199, S-206, S-208, S-210", "start_pos": 199, "start_aa": "Thr", "end_pos": 199, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr199", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 199, "start_aa": "Thr", "end_pos": 199, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr199", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-196, T-198, T-199, S-206, S-208, S-210", "start_pos": 199, "start_aa": "Thr", "end_pos": 199, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr199", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G88713AC", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 199, "start_aa": "Thr", "end_pos": 199, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr199", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 199, "start_aa": "Thr", "end_pos": 199, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr199", "evidence": [ { "id": "P11279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 200, "start_aa": "Thr", "end_pos": 200, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr200", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 200, "start_aa": "Thr", "end_pos": 200, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr200", "evidence": [ { "id": "P11279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-196, T-198, T-199, S-206, S-208, S-210", "start_pos": 207, "start_aa": "Ser", "end_pos": 207, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser207", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G27391WQ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 207, "start_aa": "Ser", "end_pos": 207, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser207", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 207, "start_aa": "Ser", "end_pos": 207, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser207", "evidence": [ { "id": "P11279", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11279" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-196, T-198, T-199, S-206, S-208, S-210", "start_pos": 207, "start_aa": "Ser", "end_pos": 207, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser207", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-196, T-198, T-199, S-206, S-208, S-210", "start_pos": 207, "start_aa": "Ser", "end_pos": 207, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser207", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine O-GalNAcylation", "start_pos": 207, "start_aa": "Ser", "end_pos": 207, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser207", "evidence": [ { "id": "P11279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 209, "start_aa": "Ser", "end_pos": 209, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser209", "evidence": [ { "id": "P11279", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11279" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 209, "start_aa": "Ser", "end_pos": 209, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser209", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine O-GalNAcylation", "start_pos": 209, "start_aa": "Ser", "end_pos": 209, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser209", "evidence": [ { "id": "P11279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-196, T-198, T-199, S-206, S-208, S-210", "start_pos": 211, "start_aa": "Ser", "end_pos": 211, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser211", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 211, "start_aa": "Ser", "end_pos": 211, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser211", "evidence": [ { "id": "P11279", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11279" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-196, T-198, T-199, S-206, S-208, S-210", "start_pos": 211, "start_aa": "Ser", "end_pos": 211, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser211", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: S-196, T-198, T-199, S-206, S-208, S-210", "start_pos": 211, "start_aa": "Ser", "end_pos": 211, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser211", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine O-GalNAcylation", "start_pos": 211, "start_aa": "Ser", "end_pos": 211, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser211", "evidence": [ { "id": "P11279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 216, "start_aa": "Ser", "end_pos": 216, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser216", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 218, "start_aa": "Ser", "end_pos": 218, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser218", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (polylactosaminoglycan) asparagine", "start_pos": 223, "start_aa": "Asn", "end_pos": 223, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn223", "evidence": [ { "id": "P11279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (polylactosaminoglycan) asparagine", "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "P11279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G14260UH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G18878GO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G48584BU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G85582CB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P11279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G00406II", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G01650EU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G03574QJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G03596YS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G03930BU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G04672QB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G04784US", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G05933EN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06231AO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G09528DL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G10256JP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G10773YW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11009FR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12313PD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20210JR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20312EM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25079LO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25637MV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G26271XI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G27126ED", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G27622TD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G31544HA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G37399XV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39619TI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G40664HB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G41126SR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G43669FQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G43734MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G44211QA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G45504EY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G46524LG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47448YK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47737VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48584BU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G49739MP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G50073PQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G50372IH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G51640FO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G54600FO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G55216FT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G55383ZG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G56610MH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G58001LT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G58802FE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G60177UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G60923RB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G62595EF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G62894KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G65019XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66621EA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66760KM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66933CM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G74430RZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75568BH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75607BQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G77582RK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G78790NZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82119TF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G83229XP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G83646BJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84492TS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84820NF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G87051GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G92062TF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G92597CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G94854LT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "glytoucan_ac": "G95133RI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G96577RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "P11279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G00406II", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G01650EU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "G03574QJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G03930BU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G05933EN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06231AO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G09197ZW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G09528DL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G10039CR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G10773YW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11009FR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12313PD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14260UH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20210JR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20312EM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23221TW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23984SE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G24084IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G24255JV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25079LO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25637MV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G27622TD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G30769VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G31544HA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G34617SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G37399XV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39595FH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39619TI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "G44211QA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G46524LG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G46902YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47448YK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47737VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48584BU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G50372IH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G50427EO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G50757KG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G51640FO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G52890YB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G55383ZG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G56284ZY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G56610MH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G60177UT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "G62894KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G65092SV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66621EA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70375MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70894RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72398FA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G77582RK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G79286RS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82119TF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G83229XP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84820NF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G87051GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G92062TF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G92081HT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G92597CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G94854LT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G95133RI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G96577RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P11279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" }, { "id": "2243102", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2243102" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 293, "start_aa": "Asn", "end_pos": 293, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn293", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 293, "start_aa": "Asn", "end_pos": 293, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn293", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 293, "start_aa": "Asn", "end_pos": 293, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn293", "evidence": [ { "id": "P11279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25637MV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G33791AF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "P11279@N322", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P11279@N322" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80333GO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "23345538", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23345538" }, { "id": "P11279@N322", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P11279@N322" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P11279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 331, "start_aa": "Thr", "end_pos": 331, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr331", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 37, "start_aa": "Asn", "end_pos": 37, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn37", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 37, "start_aa": "Asn", "end_pos": 37, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn37", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 37, "start_aa": "Asn", "end_pos": 37, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn37", "evidence": [ { "id": "P11279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 381, "start_aa": "Ser", "end_pos": 381, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser381", "evidence": [ { "id": "P11279", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11279" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "P11279", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11279" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 381, "start_aa": "Ser", "end_pos": 381, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser381", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 45, "start_aa": "Asn", "end_pos": 45, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn45", "evidence": [ { "id": "P11279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 62, "start_aa": "Asn", "end_pos": 62, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn62", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G10773YW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 62, "start_aa": "Asn", "end_pos": 62, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn62", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20210JR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 62, "start_aa": "Asn", "end_pos": 62, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn62", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 62, "start_aa": "Asn", "end_pos": 62, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn62", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 62, "start_aa": "Asn", "end_pos": 62, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn62", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 62, "start_aa": "Asn", "end_pos": 62, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn62", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 62, "start_aa": "Asn", "end_pos": 62, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn62", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (polylactosaminoglycan) asparagine", "start_pos": 62, "start_aa": "Asn", "end_pos": 62, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn62", "evidence": [ { "id": "P11279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "12754519", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12754519" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "NMTFDLPSDATVVLN", "relation": "attached", "comment": "", "start_pos": 62, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "NMTFDLPSDATVVLNRS", "relation": "attached", "comment": "", "start_pos": 62, "start_aa": "Asn", "end_pos": 78, "end_aa": "Ser", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "NMTFDLPSDATVVLNRSS", "relation": "attached", "comment": "", "start_pos": 62, "start_aa": "Asn", "end_pos": 79, "end_aa": "Ser", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "NMTFDLPSDATVVLNRSSCG", "relation": "attached", "comment": "", "start_pos": 62, "start_aa": "Asn", "end_pos": 81, "end_aa": "Gly", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 64, "start_aa": "Thr", "end_pos": 64, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr64", "evidence": [ { "id": "P11279", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11279" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "P11279", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11279" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 69, "start_aa": "Ser", "end_pos": 69, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser69", "evidence": [ { "id": "P11279", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11279" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "P11279", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P11279" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 72, "start_aa": "Thr", "end_pos": 72, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr72", "evidence": [ { "id": "P11279", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11279" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P11279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "2243102", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2243102" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "G00406II", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "G03930BU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G05933EN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06231AO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G10773YW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12313PD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20210JR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20312EM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G22589VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G22625SJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23984SE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G24255JV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G24954UD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G27622TD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G30769VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G31596VW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G34617SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G37881RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G38663NM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G41126SR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47448YK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G50282JC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "G50427EO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G51640FO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G52890YB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G57888GL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G58001LT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G62894KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G63381RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G65019XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G69834CE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70375MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70894RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G77582RK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G79286RS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G83229XP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84349RE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "high-energy collision-induced dissociation", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "34089345", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34089345" }, { "id": "10.1007/s00018-021-03863-1", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G87051GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G92062TF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G94831VI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G95133RI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G96577RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 84, "start_aa": "Asn", "end_pos": 84, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn84", "evidence": [ { "id": "P11279", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P11279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 85, "start_aa": "Thr", "end_pos": 85, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr85", "evidence": [ { "id": "P11279", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11279" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "26374642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26374642" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "28657654", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28657654" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "36240223", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36240223" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G63628AV", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "355", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/355" }, { "id": "8323299", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8323299" } ] } ], "phosphorylation": [ { "start_pos": 351, "end_pos": 351, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11279", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11279" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser351" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Tumor cells express pauci- and oligomannosidic N-glycans in glycoproteins recognized by the mannose receptor (CD206)", "journal": "Cell Mol Life Sci", "date": "2021", "authors": "Stavenhagen K., Laan L.C., Gao C., Mehta A.Y., Heimburg-Molinaro J., Glickman J.N., van Die I., Cummings R.D.", "evidence": [ { "database": "UniCarbKB", "id": "P11279", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1007/s00018-021-03863-1", "url": "https://glygen.org/publication/DOI/10.1007/s00018-021-03863-1" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "P11279", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "Probing the O-Glycoproteome of Gastric Cancer Cell Lines for Biomarker Discovery", "journal": "Molecular & Cellular Proteomics", "date": "2015", "authors": "Campos D., Freitas D., Gomes J., Magalh\u00e3es A., Steentoft C., Gomes C., Vester-Christensen M. B., Ferreira J. A., Afonso L. P., Santos L. L., Pinto de Sousa J., Mandel U., Clausen H., Vakhrushev S. Y., Reis C. A.", "evidence": [ { "database": "UniCarbKB", "id": "P11279", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1074/mcp.M114.046862", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "title": "Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.", "journal": "Nature biotechnology", "date": "2003", "authors": "Zhang H, Li XJ, Martin DB, Aebersold R", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "reference": [ { "type": "PubMed", "id": "12754519", "url": "https://glygen.org/publication/PubMed/12754519" } ] }, { "title": "The oxysterol-binding protein homologue ORP1L interacts with Rab7 and alters functional properties of late endocytic compartments.", "journal": "Mol. Biol. Cell", "date": "2005", "authors": "Johansson Marie, Lehto Markku, Tanhuanp\u00e4\u00e4 Kimmo, Cover Timothy L, Olkkonen Vesa M", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "reference": [ { "type": "PubMed", "id": "16176980", "url": "https://glygen.org/publication/PubMed/16176980" } ] }, { "title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.", "journal": "Journal of proteome research", "date": "2005", "authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "reference": [ { "type": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "title": "Integral and associated lysosomal membrane proteins.", "journal": "Traffic", "date": "2007", "authors": "Schroder B, Wrocklage C, Pan C, Jager R, Kosters B, Schafer H, Elsasser HP, Mann M, Hasilik A", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "reference": [ { "type": "PubMed", "id": "17897319", "url": "https://glygen.org/publication/PubMed/17897319" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "P11279-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11279-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Cytotoxic T lymphocyte granules are secretory lysosomes, containing both perforin and granzymes.", "journal": "The Journal of experimental medicine", "date": "1991-05-01", "authors": "Peters P J, Borst J, Oorschot V, Fukuda M, Kr\u00e4henb\u00fchl O, Tschopp J, Slot J W, Geuze H J", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "reference": [ { "type": "PubMed", "id": "2022921", "url": "https://glygen.org/publication/PubMed/2022921" } ] }, { "title": "The polylactosaminoglycans of human lysosomal membrane glycoproteins lamp-1 and lamp-2. Localization on the peptide backbones.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Carlsson SR, Fukuda M", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "reference": [ { "type": "PubMed", "id": "2243102", "url": "https://glygen.org/publication/PubMed/2243102" } ] }, { "title": "The lysosomal polypeptide transporter TAPL is stabilized by interaction with LAMP-1 and LAMP-2.", "journal": "J. Cell Sci.", "date": "2012", "authors": "Demirel \u00d6zlem, Jan Irina, Wolters Dirk, Blanz Judith, Saftig Paul, Tamp\u00e9 Robert, Abele Rupert", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "reference": [ { "type": "PubMed", "id": "22641697", "url": "https://glygen.org/publication/PubMed/22641697" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11279", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11279" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "Glycoproteomic analysis of the secretome of human endothelial cells.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M", "evidence": [ { "database": "UniCarbKB", "id": "P11279", "url": "" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "reference": [ { "type": "PubMed", "id": "23345538", "url": "https://glygen.org/publication/PubMed/23345538" } ] }, { "title": "Evolution and impact of subclonal mutations in chronic lymphocytic leukemia.", "journal": "Cell", "date": "2013", "authors": "Landau DA, Carter SL, Stojanov P, McKenna A, Stevenson K, Lawrence MS, Sougnez C, Stewart C, Sivachenko A, Wang L, Wan Y, Zhang W, Shukla SA, Vartanov A, Fernandes SM, Saksena G, Cibulskis K, Tesar B, Gabriel S, Hacohen N, Meyerson M, Lander ES, Neuberg D, Brown JR, Getz G, Wu CJ", "evidence": [ { "database": "dbSNP", "id": "rs1401533589", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1401533589" } ], "reference": [ { "type": "PubMed", "id": "23415222", "url": "https://glygen.org/publication/PubMed/23415222" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "P11279", "url": "" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "LAMP1/CD107a is required for efficient perforin delivery to lytic granules and NK-cell cytotoxicity.", "journal": "Blood", "date": "2013-06-06", "authors": "Krzewski Konrad, Gil-Krzewska Aleksandra, Nguyen Victoria, Peruzzi Giovanna, Coligan John E", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "reference": [ { "type": "PubMed", "id": "23632890", "url": "https://glygen.org/publication/PubMed/23632890" } ] }, { "title": "Proteome profiling of human neutrophil granule subsets, secretory vesicles, and cell membrane: correlation with transcriptome profiling of neutrophil precursors.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Rorvig S, Ostergaard O, Heegaard NH, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "23650620", "url": "https://glygen.org/publication/PubMed/23650620" } ] }, { "title": "Surface CD107a/LAMP-1 protects natural killer cells from degranulation-associated damage.", "journal": "Blood", "date": "2013-08-22", "authors": "Cohnen Andr\u00e9, Chiang Samuel C, Stojanovic Ana, Schmidt Hendrik, Claus Maren, Saftig Paul, Jan\u00dfen Ottmar, Cerwenka Adelheid, Bryceson Yenan T, Watzl Carsten", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "reference": [ { "type": "PubMed", "id": "23847195", "url": "https://glygen.org/publication/PubMed/23847195" } ] }, { "title": "Arf-like GTPase Arl8b regulates lytic granule polarization and natural killer cell-mediated cytotoxicity.", "journal": "Mol. Biol. Cell", "date": "2013", "authors": "Tuli Amit, Thiery Jerome, James Ashley M, Michelet Xavier, Sharma Mahak, Garg Salil, Sanborn Keri B, Orange Jordan S, Lieberman Judy, Brenner Michael B", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "reference": [ { "type": "PubMed", "id": "24088571", "url": "https://glygen.org/publication/PubMed/24088571" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "Virus entry. Lassa virus entry requires a trigger-induced receptor switch.", "journal": "Science (New York, N.Y.)", "date": "2014", "authors": "Jae LT, Raaben M, Herbert AS, Kuehne AI, Wirchnianski AS, Soh TK, Stubbs SH, Janssen H, Damme M, Saftig P, Whelan SP, Dye JM, Brummelkamp TR", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "reference": [ { "type": "PubMed", "id": "24970085", "url": "https://glygen.org/publication/PubMed/24970085" } ] }, { "title": "Probing the O-glycoproteome of gastric cancer cell lines for biomarker discovery.", "journal": "Molecular & cellular proteomics : MCP", "date": "2015", "authors": "Campos D, Freitas D, Gomes J, Magalhaes A, Steentoft C, Gomes C, Vester-Christensen MB, Ferreira JA, Afonso LP, Santos LL, Pinto de Sousa J, Mandel U, Clausen H, Vakhrushev SY, Reis CA", "evidence": [ { "database": "UniCarbKB", "id": "P11279", "url": "" } ], "reference": [ { "type": "PubMed", "id": "25813380", "url": "https://glygen.org/publication/PubMed/25813380" } ] }, { "title": "Structure of human lysosomal membrane glycoprotein 1. Assignment of disulfide bonds and visualization of its domain arrangement.", "journal": "J. Biol. Chem.", "date": "1989", "authors": "Carlsson S R, Fukuda M", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "reference": [ { "type": "PubMed", "id": "2584229", "url": "https://glygen.org/publication/PubMed/2584229" } ] }, { "title": "Molecular Mechanism for LAMP1 Recognition by Lassa Virus.", "journal": "Journal of virology", "date": "2015-08", "authors": "Cohen-Dvashi Hadas, Cohen Nadav, Israeli Hadar, Diskin Ron", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "reference": [ { "type": "PubMed", "id": "25972533", "url": "https://glygen.org/publication/PubMed/25972533" } ] }, { "title": "Proteomic analysis of O-GlcNAcylated proteins in invasive ductal breast carcinomas with and without lymph node metastasis.", "journal": "Amino acids", "date": "2016", "authors": "Jiang K, Gao Y, Hou W, Tian F, Ying W, Li L, Bai B, Hou G, Wang PG, Zhang L", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11279", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11279" } ], "reference": [ { "type": "PubMed", "id": "26374642", "url": "https://glygen.org/publication/PubMed/26374642" } ] }, { "title": "Role of LAMP1 Binding and pH Sensing by the Spike Complex of Lassa Virus.", "journal": "Journal of virology", "date": "2016-11-15", "authors": "Cohen-Dvashi Hadas, Israeli Hadar, Shani Orly, Katz Aliza, Diskin Ron", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "reference": [ { "type": "PubMed", "id": "27605678", "url": "https://glygen.org/publication/PubMed/27605678" } ] }, { "title": "Mapping of the Lassa virus LAMP1 binding site reveals unique determinants not shared by other old world arenaviruses.", "journal": "PLoS pathogens", "date": "2017-04", "authors": "Israeli Hadar, Cohen-Dvashi Hadas, Shulman Anastasiya, Shimon Amir, Diskin Ron", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "reference": [ { "type": "PubMed", "id": "28448640", "url": "https://glygen.org/publication/PubMed/28448640" } ] }, { "title": "Quantitative proteomics identifies altered O-GlcNAcylation of structural, synaptic and memory-associated proteins in Alzheimer's disease.", "journal": "The Journal of pathology", "date": "2017", "authors": "Wang S, Yang F, Petyuk VA, Shukla AK, Monroe ME, Gritsenko MA, Rodland KD, Smith RD, Qian WJ, Gong CX, Liu T", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11279", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11279" } ], "reference": [ { "type": "PubMed", "id": "28657654", "url": "https://glygen.org/publication/PubMed/28657654" } ] }, { "title": "Purification and characterization of human lysosomal membrane glycoproteins.", "journal": "Arch. Biochem. Biophys.", "date": "1989", "authors": "Mane SM, Marzella L, Bainton DF, Holt VK, Cha Y, Hildreth JE, August JT", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "reference": [ { "type": "PubMed", "id": "2912382", "url": "https://glygen.org/publication/PubMed/2912382" } ] }, { "title": "Lamp1 Increases the Efficiency of Lassa Virus Infection by Promoting Fusion in Less Acidic Endosomal Compartments.", "journal": "mBio", "date": "2018", "authors": "Hulseberg CE, Feneant L, Szymanska KM, White JM", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "reference": [ { "type": "PubMed", "id": "29295909", "url": "https://glygen.org/publication/PubMed/29295909" } ] }, { "title": "Mapping and Quantification of Over 2000 O-linked Glycopeptides in Activated Human T Cells with Isotope-Targeted Glycoproteomics (Isotag).", "journal": "Molecular & cellular proteomics : MCP", "date": "2018", "authors": "Woo CM, Lund PJ, Huang AC, Davis MM, Bertozzi CR, Pitteri SJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11279", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11279" }, { "database": "O-GlcNAc Atlas", "id": "P11279", "url": "https://oglcnac.org/atlas/detail/P11279" }, { "database": "GlyGen", "id": "GLY_000142", "url": "https://data.glygen.org/GLY_000142" } ], "reference": [ { "type": "PubMed", "id": "29351928", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "title": "Large-scale intact glycopeptide identification by Mascot database search.", "journal": "Scientific reports", "date": "2018", "authors": "Bollineni RC, Koehler CJ, Gislefoss RE, Anonsen JH, Thiede B", "evidence": [ { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "reference": [ { "type": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "title": "Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and alpha-1B-Glycoprotein.", "journal": "Analytical chemistry", "date": "2018", "authors": "Sun S, Hu Y, Jia L, Eshghi ST, Liu Y, Shah P, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P11279", "url": "" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "reference": [ { "type": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P11279", "url": "" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).", "journal": "Molecular systems biology", "date": "2018", "authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P11279", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30459171", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "title": "Molecular cloning of cDNAs encoding lamp A, a human lysosomal membrane glycoprotein with apparent Mr approximately equal to 120,000.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1988", "authors": "Viitala J, Carlsson S R, Siebert P D, Fukuda M", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "reference": [ { "type": "PubMed", "id": "3131762", "url": "https://glygen.org/publication/PubMed/3131762" } ] }, { "title": "Cloning of cDNAs encoding human lysosomal membrane glycoproteins, h-lamp-1 and h-lamp-2. Comparison of their deduced amino acid sequences.", "journal": "J. Biol. Chem.", "date": "1988", "authors": "Fukuda M, Viitala J, Matteson J, Carlsson S R", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "reference": [ { "type": "PubMed", "id": "3198605", "url": "https://glygen.org/publication/PubMed/3198605" } ] }, { "title": "Engineering a Proximity-Directed O-GlcNAc Transferase for Selective Protein O-GlcNAcylation in Cells.", "journal": "ACS chemical biology", "date": "2020", "authors": "Ramirez DH, Aonbangkhen C, Wu HY, Naftaly JA, Tang S, O'Meara TR, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11279", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11279" } ], "reference": [ { "type": "PubMed", "id": "32119511", "url": "https://glygen.org/publication/PubMed/32119511" } ] }, { "title": "Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes.", "journal": "Journal of proteome research", "date": "2020", "authors": "Zhu J, Lin YH, Dingess KA, Mank M, Stahl B, Heck AJR", "evidence": [ { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "reference": [ { "type": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "title": "Lysosome-Associated Membrane Proteins Support the Furin-Mediated Processing of the Mumps Virus Fusion Protein.", "journal": "Journal of virology", "date": "2020", "authors": "Ueo A, Kubota M, Shirogane Y, Ohno S, Hashiguchi T, Yanagi Y", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "reference": [ { "type": "PubMed", "id": "32295904", "url": "https://glygen.org/publication/PubMed/32295904" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11279", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11279" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "A new tandem enrichment strategy for the simultaneous profiling of O-GlcNAcylation and phosphorylation in RNA-binding proteome.", "journal": "The Analyst", "date": "2021", "authors": "Fan Z, Li J, Liu T, Zhang Z, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11279", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11279" }, { "database": "O-GlcNAc Atlas", "id": "P11279", "url": "https://oglcnac.org/atlas/detail/P11279" } ], "reference": [ { "type": "PubMed", "id": "33465208", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "title": "Porcine hemagglutinating encephalomyelitis virus induces atypical autophagy via opposite regulation of expression and nuclear translocation of transcription factor EB.", "journal": "Veterinary microbiology", "date": "2021", "authors": "Wang Z, Song D, Wang G, Li C, Liu X, Wang X, Li Z, Guan J, Zhao K, He W, Gao F, Lan Y", "evidence": [ { "database": "RefSeq", "id": "NP_005552", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005552" } ], "reference": [ { "type": "PubMed", "id": "33640682", "url": "https://glygen.org/publication/PubMed/33640682" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11279", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11279" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Tumor cells express pauci- and oligomannosidic N-glycans in glycoproteins recognized by the mannose receptor (CD206).", "journal": "Cellular and molecular life sciences : CMLS", "date": "2021", "authors": "Stavenhagen K, Laan LC, Gao C, Mehta AY, Heimburg-Molinaro J, Glickman JN, van Die I, Cummings RD", "evidence": [ { "database": "UniCarbKB", "id": "P11279", "url": "" } ], "reference": [ { "type": "PubMed", "id": "34089345", "url": "https://glygen.org/publication/PubMed/34089345" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11279", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11279" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "Endo-M Mediated Chemoenzymatic Approach Enables Reversible Glycopeptide Labeling for O-GlcNAcylation Analysis.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2022", "authors": "Chen Y, Tang F, Qin H, Yue X, Nie Y, Huang W, Ye M", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11279", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11279" } ], "reference": [ { "type": "PubMed", "id": "35289036", "url": "https://glygen.org/publication/PubMed/35289036" } ] }, { "title": "Human LAMP1 accelerates Lassa virus fusion and potently promotes fusion pore dilation upon forcing viral fusion with non-endosomal membrane.", "journal": "PLoS pathogens", "date": "2022", "authors": "Zhang Y, Carlos de la Torre J, Melikyan GB", "evidence": [ { "database": "RefSeq", "id": "NP_005552", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005552" } ], "reference": [ { "type": "PubMed", "id": "35969633", "url": "https://glygen.org/publication/PubMed/35969633" } ] }, { "title": "Design and Preparation of Novel Nitro-Oxide-Grafted Nanospheres with Enhanced Hydrogen Bonding Interaction for O-GlcNAc Analysis.", "journal": "ACS applied materials & interfaces", "date": "2022-10-26", "authors": "Wu Ci, Shi Song, Hou Chunyan, Luo Yang, Byers Stephen, Ma Junfeng", "evidence": [ { "database": "O-GlcNAc Database", "id": "P11279", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P11279" } ], "reference": [ { "type": "PubMed", "id": "36240223", "url": "https://glygen.org/publication/PubMed/36240223" } ] }, { "title": "Lysosomal LAMP proteins regulate lysosomal pH by direct inhibition of the TMEM175 channel.", "journal": "Molecular cell", "date": "2023-07-20", "authors": "Zhang Jiyuan, Zeng Weizhong, Han Yan, Lee Wan-Ru, Liou Jen, Jiang Youxing", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" }, { "database": "RefSeq", "id": "NP_005552", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005552" } ], "reference": [ { "type": "PubMed", "id": "37390818", "url": "https://glygen.org/publication/PubMed/37390818" } ] }, { "title": "Loss of RND3/RHOE controls entosis through LAMP1 expression in hepatocellular carcinoma.", "journal": "Cell death & disease", "date": "2024-01-13", "authors": "Basbous Sara, Dif Lydia, Dantzer Camille, Di-Tommaso Sylvaine, Dupuy Jean-William, Bioulac-Sage Paulette, Raymond Anne-Aur\u00e9lie, Desdouets Chantal, Saltel Fr\u00e9d\u00e9ric, Moreau Violaine", "evidence": [ { "database": "RefSeq", "id": "NP_005552", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005552" } ], "reference": [ { "type": "PubMed", "id": "38218945", "url": "https://glygen.org/publication/PubMed/38218945" } ] }, { "title": "E-selectin-dependent adhesion efficiency of colonic carcinoma cells is increased by genetic manipulation of their cell surface lysosomal membrane glycoprotein-1 expression levels.", "journal": "The Journal of biological chemistry", "date": "1993-06-15", "authors": "Sawada R, Lowe J B, Fukuda M", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "reference": [ { "type": "PubMed", "id": "7685349", "url": "https://glygen.org/publication/PubMed/7685349" } ] }, { "title": "Assignment of O-glycan attachment sites to the hinge-like regions of human lysosomal membrane glycoproteins lamp-1 and lamp-2.", "journal": "Archives of biochemistry and biophysics", "date": "1993", "authors": "Carlsson SR, Lycksell PO, Fukuda M", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279#ptm_processing" }, { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" }, { "database": "UniCarbKB", "id": "P11279", "url": "" }, { "database": "Automatic Literature Mining", "id": "8323299", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/8323299" }, { "database": "GlyConnect", "id": "355", "url": "https://glyconnect.expasy.org/browser/proteins/355" } ], "reference": [ { "type": "PubMed", "id": "8323299", "url": "https://glygen.org/publication/PubMed/8323299" } ] }, { "title": "The genes of major lysosomal membrane glycoproteins, lamp-1 and lamp-2. 5'-flanking sequence of lamp-2 gene and comparison of exon organization in two genes.", "journal": "J. Biol. Chem.", "date": "1993", "authors": "Sawada R, Jardine K A, Fukuda M", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "reference": [ { "type": "PubMed", "id": "8517882", "url": "https://glygen.org/publication/PubMed/8517882" } ] }, { "title": "Targeting of proteins to granule subsets is determined by timing and not by sorting: The specific granule protein NGAL is localized to azurophil granules when expressed in HL-60 cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Le Cabec V, Cowland JB, Calafat J, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "8692836", "url": "https://glygen.org/publication/PubMed/8692836" } ] } ], "pathway": [ { "id": "hsa:3916", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3916", "resource": "KEGG Pathway" }, { "id": "R-HSA-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" } ], "orthologs": [ { "uniprot_canonical_ac": "P11438-1", "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "Lamp1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAAPGARRPLLLLLLAGLAHGASALFEVKNNGTTCIMASFSASFLTTYETANGSQIVNISLPASAEVLKNGSSCGKENVSDPSLTITFGRGYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISKEIYTMDSTTDIKADINKAYRCVSDIRVYMKNVTVVLRDATIQAYLSSGNFSKEETHCTQDGPSPTTGPPSPSPPLVPTNPTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEECVQDGNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI", "length": 406 }, "evidence": [ { "id": "45923391", "url": "http://www.informatics.jax.org/homology/45923391", "database": "MGI" }, { "id": "P11279", "url": "https://omabrowser.org/oma/group/P11279/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P14562-1", "protein_name": "Lysosome-associated membrane glycoprotein 1", "gene_name": "Lamp1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAAPGARRPLLLLLLAGLAHSAPALFEVKDNNGTACIMASFSASFLTTYDAGHVSKVSNMTLPASAEVLKNSSSCGEKNASEPTLAITFGEGYLLKLTFTKNTTRYSVQHMYFTYNLSDTQFFPNASSKGPDTVDSTTDIKADINKTYRCVSDIRVYMKNVTIVLWDATIQAYLPSSNFSKEETRCPQDQPSPTTGPPSPSPPLVPTNPSVSKYNVTGDNGTCLLASMALQLNITYMKKDNTTVTRAFNINPSDKYSGTCGAQLVTLKVGNKSRVLELQFGMNATSSLFFLQGVQLNMTLPDAIEPTFSTSNYSLKALQASVGNSYKCNSEEHIFVSKALALNVFSVQVQAFRVESDRFGSVEECVQDGNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI", "length": 407 }, "evidence": [ { "id": "45923391", "url": "http://www.informatics.jax.org/homology/45923391", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "establishment of protein localization to organelle", "id": "GO:0072594", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072594", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "protein stabilization", "id": "GO:0050821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050821", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "Golgi to lysosome transport", "id": "GO:0090160", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090160", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "positive regulation of natural killer cell degranulation", "id": "GO:0043323", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043323", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "positive regulation of natural killer cell mediated cytotoxicity", "id": "GO:0045954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045954", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "lysosomal lumen acidification", "id": "GO:0007042", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007042", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "regulation of organelle transport along microtubule", "id": "GO:1902513", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902513", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "granzyme-mediated programmed cell death signaling pathway", "id": "GO:0140507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140507", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 22, "go_terms": [ { "name": "autophagosome membrane", "id": "GO:0000421", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000421", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "lysosome", "id": "GO:0005764", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005764", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "lysosomal membrane", "id": "GO:0005765", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005765", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "late endosome membrane", "id": "GO:0031902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031902", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "melanosome", "id": "GO:0042470", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042470", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "ficolin-1-rich granule membrane", "id": "GO:0101003", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0101003", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "late endosome", "id": "GO:0005770", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005770", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "endosome membrane", "id": "GO:0010008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010008", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "azurophil granule membrane", "id": "GO:0035577", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035577", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "sarcolemma", "id": "GO:0042383", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042383", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "synaptic vesicle", "id": "GO:0008021", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008021", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "multivesicular body", "id": "GO:0005771", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005771", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "autolysosome", "id": "GO:0044754", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044754", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "phagolysosome membrane", "id": "GO:0061474", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061474", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "cytolytic granule membrane", "id": "GO:0101004", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0101004", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "protein domain specific binding", "id": "GO:0019904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019904", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "virus receptor activity", "id": "GO:0001618", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001618", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" }, { "name": "ion channel inhibitor activity", "id": "GO:0008200", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008200", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 1 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-103 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G01650EU. Example: UniProtKB:P11279-1, Asn-103, MOD:00160~GNO:G01650EU. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054853", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054853" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 2 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-103 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G31852PQ. Example: UniProtKB:P11279-1, Asn-103, MOD:00160~GNO:G31852PQ. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000054854", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054854" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 3 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-103 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G41247ZX. Example: UniProtKB:P11279-1, Asn-103, MOD:00160~GNO:G41247ZX. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000054855", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054855" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 4 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-103 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G50372IH. Example: UniProtKB:P11279-1, Asn-103, MOD:00160~GNO:G50372IH. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054856", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054856" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 5 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-103 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P11279-1, Asn-103, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054857", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054857" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 6 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-241 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G85582CB. Example: UniProtKB:P11279-1, Asn-241, MOD:00160~GNO:G85582CB. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000054858", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054858" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 7 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000054859", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054859" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 8 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G01650EU. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G01650EU. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054860", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054860" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 9 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G03574QJ. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G03574QJ. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054861", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054861" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 10 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G03596YS. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G03596YS. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000054862", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054862" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 11 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G03930BU. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G03930BU. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054863", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054863" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 12 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G04784US. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G04784US. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054864", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054864" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 13 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G05933EN. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G05933EN. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054865", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054865" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 14 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G06231AO. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G06231AO. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054866", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054866" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 15 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G06247RL. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G06247RL. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000054867", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054867" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 16 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G08293MJ. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G08293MJ. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000054868", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054868" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 17 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G09528DL. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G09528DL. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054869", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054869" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 18 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G11009FR. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G11009FR. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054870", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054870" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 19 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G22018FP. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G22018FP. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054871", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054871" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 20 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G25079LO. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G25079LO. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054872", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054872" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 21 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G26271XI. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G26271XI. [PRO:DNx, PMID:23345538, PMID:29741879]", "evidence": [ { "id": "PR:000054873", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054873" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 22 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G27126ED. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G27126ED. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054874", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054874" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 23 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G27622TD. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G27622TD. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054875", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054875" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 24 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G27947YN. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G27947YN. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000054876", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054876" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 25 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G37399XV. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G37399XV. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054877", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054877" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 26 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G40664HB. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G40664HB. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054878", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054878" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 27 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G41126SR. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G41126SR. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054879", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054879" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 28 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G43669FQ. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G43669FQ. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054880", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054880" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 29 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G43734MM. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G43734MM. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054881", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054881" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 30 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G44211QA. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G44211QA. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054882", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054882" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 31 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G45504EY. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G45504EY. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054883", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054883" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 32 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G47737VJ. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G47737VJ. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054884", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054884" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 33 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G49739MP. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G49739MP. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054885", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054885" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 34 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G50073PQ. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G50073PQ. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054886", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054886" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 35 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G50372IH. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G50372IH. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054887", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054887" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 36 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G54600FO. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G54600FO. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054888", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054888" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 37 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G55216FT. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G55216FT. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000054889", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054889" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 38 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G56610MH. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G56610MH. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054890", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054890" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 39 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G58001LT. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054891", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054891" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 40 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G58802FE. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G58802FE. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054892", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054892" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 41 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054893", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054893" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 42 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G60923RB. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G60923RB. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054894", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054894" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 43 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G62595EF. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G62595EF. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054895", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054895" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 44 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G66933CM. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G66933CM. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054896", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054896" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 45 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G75568BH. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G75568BH. [PRO:DNx, PMID:23345538, PMID:29741879]", "evidence": [ { "id": "PR:000054897", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054897" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 46 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G83646BJ. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G83646BJ. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054898", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054898" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 47 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G84492TS. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G84492TS. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054899", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054899" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 48 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G85144OK. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G85144OK. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000054900", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054900" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 49 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G87051GH. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G87051GH. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054901", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054901" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 50 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000054902", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054902" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 51 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G92597CK. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G92597CK. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054903", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054903" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 52 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-249 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G94917XT. Example: UniProtKB:P11279-1, Asn-249, MOD:00160~GNO:G94917XT. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000054904", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054904" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 53 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-261 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G01650EU. Example: UniProtKB:P11279-1, Asn-261, MOD:00160~GNO:G01650EU. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054905", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054905" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 54 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-261 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G03574QJ. Example: UniProtKB:P11279-1, Asn-261, MOD:00160~GNO:G03574QJ. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054906", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054906" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 55 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-261 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G03930BU. Example: UniProtKB:P11279-1, Asn-261, MOD:00160~GNO:G03930BU. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054907", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054907" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 56 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-261 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G05933EN. Example: UniProtKB:P11279-1, Asn-261, MOD:00160~GNO:G05933EN. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054908", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054908" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 57 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-261 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G06231AO. Example: UniProtKB:P11279-1, Asn-261, MOD:00160~GNO:G06231AO. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054909", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054909" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 58 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-261 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G09197ZW. Example: UniProtKB:P11279-1, Asn-261, MOD:00160~GNO:G09197ZW. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054910", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054910" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 59 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-261 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G09528DL. Example: UniProtKB:P11279-1, Asn-261, MOD:00160~GNO:G09528DL. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054911", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054911" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 60 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-261 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G11009FR. Example: UniProtKB:P11279-1, Asn-261, MOD:00160~GNO:G11009FR. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054912", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054912" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 61 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-261 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G24255JV. Example: UniProtKB:P11279-1, Asn-261, MOD:00160~GNO:G24255JV. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054913", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054913" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 62 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-261 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G25079LO. Example: UniProtKB:P11279-1, Asn-261, MOD:00160~GNO:G25079LO. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054914", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054914" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 63 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-261 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G27622TD. Example: UniProtKB:P11279-1, Asn-261, MOD:00160~GNO:G27622TD. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054915", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054915" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 64 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-261 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G37399XV. Example: UniProtKB:P11279-1, Asn-261, MOD:00160~GNO:G37399XV. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054916", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054916" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 65 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-261 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G44211QA. Example: UniProtKB:P11279-1, Asn-261, MOD:00160~GNO:G44211QA. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054917", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054917" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 66 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-261 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G47737VJ. Example: UniProtKB:P11279-1, Asn-261, MOD:00160~GNO:G47737VJ. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054918", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054918" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 67 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-261 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G50372IH. Example: UniProtKB:P11279-1, Asn-261, MOD:00160~GNO:G50372IH. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054919", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054919" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 68 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-261 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G56610MH. Example: UniProtKB:P11279-1, Asn-261, MOD:00160~GNO:G56610MH. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054920", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054920" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 69 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-261 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G87051GH. Example: UniProtKB:P11279-1, Asn-261, MOD:00160~GNO:G87051GH. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054921", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054921" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 70 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-261 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G92597CK. Example: UniProtKB:P11279-1, Asn-261, MOD:00160~GNO:G92597CK. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054922", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054922" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 71 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G62765YT. Example: UniProtKB:P11279-1, Asn-322, MOD:00160~GNO:G62765YT. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000054923", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054923" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 72 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-322 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G80920RR. Example: UniProtKB:P11279-1, Asn-322, MOD:00160~GNO:G80920RR. [PRO:DNx, PMID:23345538]", "evidence": [ { "id": "PR:000054924", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054924" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 73 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-62 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P11279-1, Asn-62, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054925", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054925" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 74 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-84 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G03930BU. Example: UniProtKB:P11279-1, Asn-84, MOD:00160~GNO:G03930BU. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054926", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054926" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 75 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-84 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G05933EN. Example: UniProtKB:P11279-1, Asn-84, MOD:00160~GNO:G05933EN. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054927", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054927" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 76 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-84 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G06231AO. Example: UniProtKB:P11279-1, Asn-84, MOD:00160~GNO:G06231AO. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054928", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054928" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 77 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-84 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G22589VJ. Example: UniProtKB:P11279-1, Asn-84, MOD:00160~GNO:G22589VJ. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054929", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054929" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 78 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-84 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G24255JV. Example: UniProtKB:P11279-1, Asn-84, MOD:00160~GNO:G24255JV. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054930", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054930" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 79 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-84 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G27622TD. Example: UniProtKB:P11279-1, Asn-84, MOD:00160~GNO:G27622TD. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054931", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054931" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 80 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-84 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G41126SR. Example: UniProtKB:P11279-1, Asn-84, MOD:00160~GNO:G41126SR. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054932", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054932" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 81 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-84 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P11279-1, Asn-84, MOD:00160~GNO:G58001LT. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054933", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054933" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 N-glycosylated 82 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been N-glycosylated at the residue equivalent to Asn-84 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G87051GH. Example: UniProtKB:P11279-1, Asn-84, MOD:00160~GNO:G87051GH. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054934", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054934" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 O-glycosylated 1 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been O-glycosylated at the residue equivalent to Ser-197 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P11279-1, Ser-197, MOD:00002~GNO:G00031MO. [PRO:DNx, PMID:8323299]", "evidence": [ { "id": "PR:000054935", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054935" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 O-glycosylated 2 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been O-glycosylated at the residue equivalent to Ser-197 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P11279-1, Ser-197, MOD:00002~GNO:G64973KT. [PRO:DNx, PMID:8323299]", "evidence": [ { "id": "PR:000054936", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054936" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 O-glycosylated 3 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been O-glycosylated at the residue equivalent to Ser-207 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P11279-1, Ser-207, MOD:00002~GNO:G00031MO. [PRO:DNx, PMID:8323299]", "evidence": [ { "id": "PR:000054937", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054937" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 O-glycosylated 4 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been O-glycosylated at the residue equivalent to Ser-207 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G27391WQ. Example: UniProtKB:P11279-1, Ser-207, MOD:00002~GNO:G27391WQ. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000054938", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054938" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 O-glycosylated 5 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been O-glycosylated at the residue equivalent to Ser-207 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P11279-1, Ser-207, MOD:00002~GNO:G64973KT. [PRO:DNx, PMID:8323299]", "evidence": [ { "id": "PR:000054939", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054939" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 O-glycosylated 6 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been O-glycosylated at the residue equivalent to Ser-211 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P11279-1, Ser-211, MOD:00002~GNO:G00031MO. [PRO:DNx, PMID:8323299]", "evidence": [ { "id": "PR:000054940", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054940" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 O-glycosylated 7 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been O-glycosylated at the residue equivalent to Ser-211 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P11279-1, Ser-211, MOD:00002~GNO:G64973KT. [PRO:DNx, PMID:8323299]", "evidence": [ { "id": "PR:000054941", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054941" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 O-glycosylated 8 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been O-glycosylated at the residue equivalent to Thr-199 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan structure is represented by GlyTouCan:G00031MO. Example: UniProtKB:P11279-1, Thr-199, MOD:00005~GNO:G00031MO. [PRO:DNx, PMID:8323299]", "evidence": [ { "id": "PR:000054942", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054942" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 O-glycosylated 9 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been O-glycosylated at the residue equivalent to Thr-199 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:P11279-1, Thr-199, MOD:00005~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000054943", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054943" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 O-glycosylated 10 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been O-glycosylated at the residue equivalent to Thr-199 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G58001LT. Example: UniProtKB:P11279-1, Thr-199, MOD:00005~GNO:G58001LT. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000054944", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054944" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 O-glycosylated 11 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been O-glycosylated at the residue equivalent to Thr-199 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan structure is represented by GlyTouCan:G64973KT. Example: UniProtKB:P11279-1, Thr-199, MOD:00005~GNO:G64973KT. [PRO:DNx, PMID:8323299]", "evidence": [ { "id": "PR:000054945", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054945" } ] }, { "name": "lysosome-associated membrane glycoprotein 1 O-glycosylated 12 (human)", "definition": "A lysosome-associated membrane glycoprotein 1 (human) that has been O-glycosylated at the residue equivalent to Thr-199 of the amino acid sequence represented by UniProtKB:P11279-1, in which the glycan composition is represented by GlyTouCan:G88713AC. Example: UniProtKB:P11279-1, Thr-199, MOD:00005~GNO:G88713AC. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000054946", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054946" } ] } ], "site_annotation": [ { "start_pos": 103, "end_pos": 105, "annotation": "n_glycosylation_sequon" }, { "start_pos": 107, "end_pos": 109, "annotation": "n_glycosylation_sequon" }, { "start_pos": 121, "end_pos": 123, "annotation": "n_glycosylation_sequon" }, { "start_pos": 130, "end_pos": 132, "annotation": "n_glycosylation_sequon" }, { "start_pos": 165, "end_pos": 167, "annotation": "n_glycosylation_sequon" }, { "start_pos": 181, "end_pos": 183, "annotation": "n_glycosylation_sequon" }, { "start_pos": 223, "end_pos": 225, "annotation": "n_glycosylation_sequon" }, { "start_pos": 228, "end_pos": 230, "annotation": "n_glycosylation_sequon" }, { "start_pos": 241, "end_pos": 243, "annotation": "n_glycosylation_sequon" }, { "start_pos": 249, "end_pos": 251, "annotation": "n_glycosylation_sequon" }, { "start_pos": 261, "end_pos": 263, "annotation": "n_glycosylation_sequon" }, { "start_pos": 293, "end_pos": 295, "annotation": "n_glycosylation_sequon" }, { "start_pos": 322, "end_pos": 324, "annotation": "n_glycosylation_sequon" }, { "start_pos": 37, "end_pos": 39, "annotation": "n_glycosylation_sequon" }, { "start_pos": 45, "end_pos": 47, "annotation": "n_glycosylation_sequon" }, { "start_pos": 62, "end_pos": 64, "annotation": "n_glycosylation_sequon" }, { "start_pos": 76, "end_pos": 78, "annotation": "n_glycosylation_sequon" }, { "start_pos": 84, "end_pos": 86, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "(Microbial infection) The glycosylation of Asn-76 is essential for Lassa virus entry into cells.", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" }, { "database": "PubMed", "id": "24970085", "url": "https://glygen.org/publication/PubMed/24970085" } ] }, { "annotation": "O- and N-glycosylated; some of the 18 N-linked glycans are polylactosaminoglycans.", "evidence": [ { "database": "UniProtKB", "id": "P11279", "url": "https://www.uniprot.org/uniprot/P11279" }, { "database": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" }, { "database": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" }, { "database": "PubMed", "id": "12754519", "url": "https://glygen.org/publication/PubMed/12754519" }, { "database": "PubMed", "id": "8323299", "url": "https://glygen.org/publication/PubMed/8323299" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 37, 45, 62, 76, 84, 103, 107, 121, 130, 164, 165, 181, 223, 228, 241, 249, 261, 293, 322 ], "o_linked_sites": [ 64, 69, 72, 85, 105, 183, 185, 191, 197, 199, 200, 207, 209, 211, 216, 218, 331, 381 ], "snv_sites": [ 37, 45, 64, 69, 76, 84, 85, 86, 103, 105, 121, 123, 130, 132, 157, 181, 199, 207, 209, 218, 223, 225, 228, 243, 249, 251, 259, 261, 263, 293, 295, 309, 322, 324, 381 ], "glycation_sites": [], "phosphorylation_sites": [ 351 ], "sequon_annotation_sites": [ { "start_pos": 103, "end_pos": 105 }, { "start_pos": 107, "end_pos": 109 }, { "start_pos": 121, "end_pos": 123 }, { "start_pos": 130, "end_pos": 132 }, { "start_pos": 165, "end_pos": 167 }, { "start_pos": 181, "end_pos": 183 }, { "start_pos": 223, "end_pos": 225 }, { "start_pos": 228, "end_pos": 230 }, { "start_pos": 241, "end_pos": 243 }, { "start_pos": 249, "end_pos": 251 }, { "start_pos": 261, "end_pos": 263 }, { "start_pos": 293, "end_pos": 295 }, { "start_pos": 322, "end_pos": 324 }, { "start_pos": 37, "end_pos": 39 }, { "start_pos": 45, "end_pos": 47 }, { "start_pos": 62, "end_pos": 64 }, { "start_pos": 76, "end_pos": 78 }, { "start_pos": 84, "end_pos": 86 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 410 }, { "field": "total_sites", "count": 36 }, { "field": "n_linked_glycans", "count": 169 }, { "field": "n_linked_glycan_sites", "count": 33 }, { "field": "o_linked_glycans", "count": 11 }, { "field": "o_linked_glycan_sites", "count": 23 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 29 }, { "field": "total_sites", "count": 25 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 23 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 6 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 380 }, { "field": "total_sites", "count": 26 }, { "field": "n_linked_glycans", "count": 169 }, { "field": "n_linked_glycan_sites", "count": 10 }, { "field": "o_linked_glycans", "count": 11 }, { "field": "o_linked_glycan_sites", "count": 16 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 50 }, { "field": "total_sites", "count": 35 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 43 }, { "field": "total_sites", "count": 32 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 57 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }