{ "uniprot_canonical_ac": "P10909-1", "uniprot_ac": "P10909", "uniprot_id": "CLUS_HUMAN", "mass": { "chemical_mass": 52495.0, "monoisotopic_mass": 52495.0 }, "refseq": { "ac": "NP_001822", "name": "clusterin isoform 1 preproprotein", "summary": "The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.[provided by RefSeq, May 2011].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001822" }, "gene_names": [ { "name": "CLU", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P10909", "id": "P10909" }, { "name": "AAG4; APO-J; APOJ; CLI; CLU1; CLU2; KUB1; NA1/NA2; SGP-2; SGP2; SP-40; TRPM-2; TRPM2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001822", "id": "NP_001822" }, { "name": "AAG4", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P10909", "id": "P10909" }, { "name": "APOJ", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P10909", "id": "P10909" }, { "name": "CLI", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P10909", "id": "P10909" }, { "name": "CLU", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001822", "id": "NP_001822" }, { "name": "KUB1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P10909", "id": "P10909" } ], "protein_names": [ { "name": "Clusterin", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P10909" }, { "name": "Aging-associated gene 4 protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10909" }, { "name": "Apo-J", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10909" }, { "name": "ApoJalpha", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10909" }, { "name": "ApoJbeta", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10909" }, { "name": "Apolipoprotein J", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10909" }, { "name": "CLI", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10909" }, { "name": "Complement cytolysis inhibitor a chain", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10909" }, { "name": "Complement cytolysis inhibitor b chain", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10909" }, { "name": "Complement cytolysis inhibitor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10909" }, { "name": "Complement-associated protein SP-40,40", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10909" }, { "name": "Ku70-binding protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10909" }, { "name": "NA1/NA2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10909" }, { "name": "SGP-2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10909" }, { "name": "SP-40,40 alpha-chain", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10909" }, { "name": "SP-40,40 beta-chain", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10909" }, { "name": "Sulfated glycoprotein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10909" }, { "name": "TRPM-2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10909" }, { "name": "Testosterone-repressed prostate message 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10909" }, { "name": "clusterin isoform 1 preproprotein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001822", "id": "NP_001822" }, { "name": "complement lysis inhibitor; testosterone-repressed prostate message 2; aging-associated protein 4; sulfated glycoprotein 2; apolipoprotein J; ku70-binding protein 1; complement cytolysis inhibitor; complement-associated protein SP-40,40; epididymis secretory sperm binding protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001822", "id": "NP_001822" } ], "function": [ { "annotation": "Clusterin Is a Prognostic Biomarker of Lower-Grade Gliomas and Is Associated with Immune Cell Infiltration. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001822", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001822" }, { "database": "PubMed", "id": "37686218", "url": "https://glygen.org/publication/PubMed/37686218" } ] }, { "annotation": "Clusterin protects mature dendritic cells from reactive oxygen species mediated cell death. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001822", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001822" }, { "database": "PubMed", "id": "38125724", "url": "https://glygen.org/publication/PubMed/38125724" } ] }, { "annotation": "Does not affect caspase or BAX-mediated intrinsic apoptosis and TNF-induced NF-kappa-B-activity (PubMed:24073260). Promotes cell death through interaction with BCL2L1 that releases and activates BAX (PubMed:21567405).", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909#function" }, { "database": "PubMed", "id": "24073260", "url": "https://glygen.org/publication/PubMed/24073260" }, { "database": "PubMed", "id": "21567405", "url": "https://glygen.org/publication/PubMed/21567405" } ] }, { "annotation": "Does not affect caspase or BAX-mediated intrinsic apoptosis and TNF-induced NF-kappa-B-activity.", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909#function" }, { "database": "PubMed", "id": "24073260", "url": "https://glygen.org/publication/PubMed/24073260" } ] }, { "annotation": "Functions as extracellular chaperone that prevents aggregation of non native proteins (PubMed:11123922, PubMed:19535339). Prevents stress-induced aggregation of blood plasma proteins (PubMed:11123922, PubMed:12176985, PubMed:17260971, PubMed:19996109). Inhibits formation of amyloid fibrils by APP, APOC2, B2M, CALCA, CSN3, SNCA and aggregation-prone LYZ variants (in vitro) (PubMed:12047389, PubMed:17412999, PubMed:17407782). Does not require ATP (PubMed:11123922). Maintains partially unfolded proteins in a state appropriate for subsequent refolding by other chaperones, such as HSPA8/HSC70 (PubMed:11123922). Does not refold proteins by itself (PubMed:11123922). Binding to cell surface receptors triggers internalization of the chaperone-client complex and subsequent lysosomal or proteasomal degradation (PubMed:21505792). Protects cells against apoptosis and against cytolysis by complement (PubMed:2780565). Intracellular forms interact with ubiquitin and SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes and promote the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:20068069). Promotes proteasomal degradation of COMMD1 and IKBKB (PubMed:20068069). Modulates NF-kappa-B transcriptional activity (PubMed:12882985). A mitochondrial form suppresses BAX-dependent release of cytochrome c into the cytoplasm and inhibit apoptosis (PubMed:16113678, PubMed:17689225). Plays a role in the regulation of cell proliferation (PubMed:19137541). An intracellular form suppresses stress-induced apoptosis by stabilizing mitochondrial membrane integrity through interaction with HSPA5 (PubMed:22689054). Secreted form does not affect caspase or BAX-mediated intrinsic apoptosis and TNF-induced NF-kappa-B-activity (PubMed:24073260). Secreted form act as an important modulator during neuronal differentiation through interaction with STMN3 (By similarity). Plays a role in the clearance of immune complexes that arise during cell injury (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909#function" }, { "database": "PubMed", "id": "17412999", "url": "https://glygen.org/publication/PubMed/17412999" }, { "database": "PubMed", "id": "17260971", "url": "https://glygen.org/publication/PubMed/17260971" }, { "database": "PubMed", "id": "17689225", "url": "https://glygen.org/publication/PubMed/17689225" }, { "database": "PubMed", "id": "2780565", "url": "https://glygen.org/publication/PubMed/2780565" }, { "database": "PubMed", "id": "16113678", "url": "https://glygen.org/publication/PubMed/16113678" }, { "database": "PubMed", "id": "11123922", "url": "https://glygen.org/publication/PubMed/11123922" }, { "database": "PubMed", "id": "19137541", "url": "https://glygen.org/publication/PubMed/19137541" }, { "database": "PubMed", "id": "17407782", "url": "https://glygen.org/publication/PubMed/17407782" }, { "database": "PubMed", "id": "12047389", "url": "https://glygen.org/publication/PubMed/12047389" }, { "database": "PubMed", "id": "22689054", "url": "https://glygen.org/publication/PubMed/22689054" }, { "database": "PubMed", "id": "24073260", "url": "https://glygen.org/publication/PubMed/24073260" }, { "database": "UniProtKB", "id": "Q06890", "url": "https://www.uniprot.org/uniprot/Q06890#function" }, { "database": "PubMed", "id": "19535339", "url": "https://glygen.org/publication/PubMed/19535339" }, { "database": "PubMed", "id": "12176985", "url": "https://glygen.org/publication/PubMed/12176985" }, { "database": "PubMed", "id": "20068069", "url": "https://glygen.org/publication/PubMed/20068069" }, { "database": "UniProtKB", "id": "P05371", "url": "https://www.uniprot.org/uniprot/P05371#function" }, { "database": "PubMed", "id": "19996109", "url": "https://glygen.org/publication/PubMed/19996109" }, { "database": "PubMed", "id": "12882985", "url": "https://glygen.org/publication/PubMed/12882985" }, { "database": "PubMed", "id": "21505792", "url": "https://glygen.org/publication/PubMed/21505792" } ] }, { "annotation": "Regulation of psoriasis, colitis, and the intestinal microbiota by clusterin. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001822", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001822" }, { "database": "PubMed", "id": "37717073", "url": "https://glygen.org/publication/PubMed/37717073" } ] }, { "annotation": "The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.[provided by RefSeq, May 2011].", "evidence": [ { "database": "RefSeq", "id": "NP_001822", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001822" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs201024088", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201024088" }, { "id": "rs201024088", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs201024088" }, { "id": "rs201024088", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201024088#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 376, "end_pos": 376, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->NLM); o-glyco-site-loss (T->M).", "chr_id": "8", "chr_pos": "27599817", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T376", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs754785720", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754785720" }, { "id": "rs754785720", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754785720" }, { "id": "rs754785720", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs754785720#frequency_tab" }, { "id": "rs754785720", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754785720" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 105, "end_pos": 105, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->NEI).", "chr_id": "8", "chr_pos": "27606457", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T105", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1343749062", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1343749062" }, { "id": "rs1343749062", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1343749062" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 145, "end_pos": 145, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQS->KQS).", "chr_id": "8", "chr_pos": "27605318", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N145", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1000466509", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1000466509" }, { "id": "rs1000466509", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1000466509#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 210, "end_pos": 210, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "8", "chr_pos": "27605123", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S210", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs563432916", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs563432916" }, { "id": "rs563432916", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs563432916" }, { "id": "rs563432916", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs563432916" }, { "id": "rs563432916", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs563432916#frequency_tab" }, { "id": "rs563432916", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs563432916" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 293, "end_pos": 293, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->NSK).", "chr_id": "8", "chr_pos": "27604347", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T293", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs563432916", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs563432916" }, { "id": "rs563432916", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs563432916" }, { "id": "rs563432916", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs563432916" }, { "id": "rs563432916", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs563432916#frequency_tab" }, { "id": "rs563432916", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs563432916" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 293, "end_pos": 293, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->NSM).", "chr_id": "8", "chr_pos": "27604347", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T293", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs563432916", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs563432916" }, { "id": "rs563432916", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs563432916" }, { "id": "rs563432916", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs563432916" }, { "id": "rs563432916", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs563432916#frequency_tab" }, { "id": "rs563432916", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs563432916" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 293, "end_pos": 293, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->NSR).", "chr_id": "8", "chr_pos": "27604347", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T293", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs9331938", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs9331938" }, { "id": "rs9331938", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs9331938" }, { "id": "rs9331938", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs9331938" }, { "id": "rs9331938", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs9331938#frequency_tab" }, { "id": "rs9331938", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs9331938" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 328, "end_pos": 328, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DES->NES).", "chr_id": "8", "chr_pos": "27599962", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.01198", "site_lbl": "D328", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1180580726", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1180580726" }, { "id": "rs1180580726", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1180580726" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 356, "end_pos": 356, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->NTF).", "chr_id": "8", "chr_pos": "27599877", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S356", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs13494", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs13494" }, { "id": "rs13494", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs13494" }, { "id": "rs13494", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs13494" }, { "id": "rs13494", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs13494#frequency_tab" }, { "id": "rs13494", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs13494" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 396, "end_pos": 396, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->L).", "chr_id": "8", "chr_pos": "27598613", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.008187", "site_lbl": "S396", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs13494", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs13494" }, { "id": "rs13494", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs13494" }, { "id": "rs13494", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs13494" }, { "id": "rs13494", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs13494#frequency_tab" }, { "id": "rs13494", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs13494" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 396, "end_pos": 396, "sequence_org": "S", "sequence_mut": "W", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->W).", "chr_id": "8", "chr_pos": "27598613", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.008187", "site_lbl": "S396", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1313161587", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1313161587" }, { "id": "rs1313161587", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1313161587" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 86, "end_pos": 86, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->YET).", "chr_id": "8", "chr_pos": "27606515", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N86", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs146635793", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs146635793" }, { "id": "rs146635793", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs146635793" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 91, "end_pos": 91, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SET->NET).", "chr_id": "8", "chr_pos": "27605070", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S91", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 103, "end_pos": 103, "sequence_org": "N", "sequence_mut": "Q", "comment": "Decreases molecular mass of beta chain; when associated with Q-86 and Q-145.", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" }, { "database": "PubMed", "id": "22689054", "url": "https://glygen.org/publication/PubMed/22689054" } ] }, { "start_pos": 145, "end_pos": 145, "sequence_org": "N", "sequence_mut": "Q", "comment": "Decreases molecular mass of beta chain; when associated with Q-86 and Q-103.", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" }, { "database": "PubMed", "id": "22689054", "url": "https://glygen.org/publication/PubMed/22689054" } ] }, { "start_pos": 226, "end_pos": 226, "sequence_org": "V", "sequence_mut": "T", "comment": "Does not affect proteolytic cleavage.", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" }, { "database": "PubMed", "id": "25402950", "url": "https://glygen.org/publication/PubMed/25402950" } ] }, { "start_pos": 227, "end_pos": 227, "sequence_org": "R", "sequence_mut": "Q", "comment": "Affects proteolytic cleavage.", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" }, { "database": "PubMed", "id": "25402950", "url": "https://glygen.org/publication/PubMed/25402950" } ] }, { "start_pos": 291, "end_pos": 291, "sequence_org": "N", "sequence_mut": "Q", "comment": "Decreases molecular mass of alpha chain; when associated with Q-354 and Q-374. Decreases secretion; when associated with Q-354 and Q-374.", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" }, { "database": "PubMed", "id": "22689054", "url": "https://glygen.org/publication/PubMed/22689054" } ] }, { "start_pos": 354, "end_pos": 354, "sequence_org": "N", "sequence_mut": "Q", "comment": "Decreases molecular mass of alpha chain; when associated with Q-291 and Q-374. Decreases secretion; when associated with Q-291 and Q-374.", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" }, { "database": "PubMed", "id": "22689054", "url": "https://glygen.org/publication/PubMed/22689054" } ] }, { "start_pos": 374, "end_pos": 374, "sequence_org": "N", "sequence_mut": "Q", "comment": "Decreases molecular mass of alpha chain; when associated with Q-291 and Q-354. Decreases secretion; when associated with Q-291 and Q-354.", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" }, { "database": "PubMed", "id": "22689054", "url": "https://glygen.org/publication/PubMed/22689054" } ] }, { "start_pos": 86, "end_pos": 86, "sequence_org": "N", "sequence_mut": "Q", "comment": "Decreases molecular mass of beta chain; when associated with Q-103 and Q-145.", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" }, { "database": "PubMed", "id": "22689054", "url": "https://glygen.org/publication/PubMed/22689054" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "97.75", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000120885", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120885" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "98.29", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000120885", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120885" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "99.54", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000120885", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120885" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "99.51", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000120885", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120885" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.9", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000120885", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120885" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "99.23", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000120885", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120885" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "97.39", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000120885", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120885" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "99.5", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000120885", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120885" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "99.9", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000120885", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120885" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "99.11", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000120885", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120885" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "99.83", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000120885", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120885" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "99.63", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000120885", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120885" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "99.58", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000120885", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120885" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P10909", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10909" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P10909", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10909" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P10909", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10909" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P10909", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10909" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P10909", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10909" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P10909", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10909" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P10909", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10909" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P10909", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10909" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P10909", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10909" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P10909", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10909" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P10909", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10909" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P10909", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10909" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "common_name": "Human" } ], "gene": [ { "name": "CLU", "url": "https://www.uniprot.org/uniprot/P10909", "locus": { "chromosome": "8", "start_pos": 27596917, "end_pos": 27614700, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000120885", "url": "https://www.ensembl.org/id/ENSG00000120885" } ] } } ], "crossref": [ { "id": "ENSG00000120885", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120885", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "CLU", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CLU", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "1191", "url": "https://www.ncbi.nlm.nih.gov/gene/1191", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "2095", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=2095", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P10909", "url": "https://www.ebi.ac.uk/intact/interactors/id:P10909*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000753", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000753", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016014", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016014", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016015", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016015", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016016", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016016", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033986", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033986", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:1191", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1191", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "185430", "url": "http://www.omim.org/entry/185430", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P10909", "url": "https://www.nextprot.org/entry/NX_P10909", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P10909", "url": "https://oglcnac.org/atlas/detail/P10909", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "P10909", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P10909", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "QGSKYIN", "url": "https://omabrowser.org/oma/group/QGSKYIN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4321242at2759", "url": "http://www.orthodb.org/?query=4321242at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10970", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10970", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10970:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10970:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "7ZET", "url": "https://www.rcsb.org/structure/7ZET", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7ZEU", "url": "https://www.rcsb.org/structure/7ZEU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01093", "url": "http://pfam.xfam.org/family/PF01093", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P10909", "url": "https://pharos.nih.gov/targets/P10909", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000054795", "url": "https://proconsortium.org/app/entry/PR:000054795", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054796", "url": "https://proconsortium.org/app/entry/PR:000054796", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054797", "url": "https://proconsortium.org/app/entry/PR:000054797", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054798", "url": "https://proconsortium.org/app/entry/PR:000054798", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054799", "url": "https://proconsortium.org/app/entry/PR:000054799", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054800", "url": "https://proconsortium.org/app/entry/PR:000054800", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054801", "url": "https://proconsortium.org/app/entry/PR:000054801", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054802", "url": "https://proconsortium.org/app/entry/PR:000054802", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054803", "url": "https://proconsortium.org/app/entry/PR:000054803", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054804", "url": "https://proconsortium.org/app/entry/PR:000054804", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054805", "url": "https://proconsortium.org/app/entry/PR:000054805", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054806", "url": "https://proconsortium.org/app/entry/PR:000054806", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054807", "url": "https://proconsortium.org/app/entry/PR:000054807", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054808", "url": "https://proconsortium.org/app/entry/PR:000054808", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054809", "url": "https://proconsortium.org/app/entry/PR:000054809", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054810", "url": "https://proconsortium.org/app/entry/PR:000054810", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054811", "url": "https://proconsortium.org/app/entry/PR:000054811", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054812", "url": "https://proconsortium.org/app/entry/PR:000054812", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054813", "url": "https://proconsortium.org/app/entry/PR:000054813", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054814", "url": "https://proconsortium.org/app/entry/PR:000054814", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054815", "url": "https://proconsortium.org/app/entry/PR:000054815", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054816", "url": "https://proconsortium.org/app/entry/PR:000054816", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054817", "url": "https://proconsortium.org/app/entry/PR:000054817", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054818", "url": "https://proconsortium.org/app/entry/PR:000054818", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054819", "url": "https://proconsortium.org/app/entry/PR:000054819", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054820", "url": "https://proconsortium.org/app/entry/PR:000054820", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054821", "url": "https://proconsortium.org/app/entry/PR:000054821", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054822", "url": "https://proconsortium.org/app/entry/PR:000054822", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054823", "url": "https://proconsortium.org/app/entry/PR:000054823", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054824", "url": "https://proconsortium.org/app/entry/PR:000054824", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054825", "url": "https://proconsortium.org/app/entry/PR:000054825", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054826", "url": "https://proconsortium.org/app/entry/PR:000054826", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054827", "url": "https://proconsortium.org/app/entry/PR:000054827", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054828", "url": "https://proconsortium.org/app/entry/PR:000054828", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054829", "url": "https://proconsortium.org/app/entry/PR:000054829", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054830", "url": "https://proconsortium.org/app/entry/PR:000054830", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054831", "url": "https://proconsortium.org/app/entry/PR:000054831", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054832", "url": "https://proconsortium.org/app/entry/PR:000054832", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054833", "url": "https://proconsortium.org/app/entry/PR:000054833", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054834", "url": "https://proconsortium.org/app/entry/PR:000054834", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054835", "url": "https://proconsortium.org/app/entry/PR:000054835", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054836", "url": "https://proconsortium.org/app/entry/PR:000054836", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054837", "url": "https://proconsortium.org/app/entry/PR:000054837", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054838", "url": "https://proconsortium.org/app/entry/PR:000054838", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054839", "url": "https://proconsortium.org/app/entry/PR:000054839", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054840", "url": "https://proconsortium.org/app/entry/PR:000054840", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054841", "url": "https://proconsortium.org/app/entry/PR:000054841", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054842", "url": "https://proconsortium.org/app/entry/PR:000054842", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054843", "url": "https://proconsortium.org/app/entry/PR:000054843", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P10909", "url": "http://purl.obolibrary.org/obo/PR_P10909", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-166665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166665", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001822", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001822", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P10909", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "E5RG36", "url": "https://www.uniprot.org/uniprot/E5RG36", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RG36-1", "url": "https://www.uniprot.org/uniprot/E5RG36-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RGB0", "url": "https://www.uniprot.org/uniprot/E5RGB0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RGB0-1", "url": "https://www.uniprot.org/uniprot/E5RGB0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RH61", "url": "https://www.uniprot.org/uniprot/E5RH61", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RH61-1", "url": "https://www.uniprot.org/uniprot/E5RH61-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RJD6", "url": "https://www.uniprot.org/uniprot/E5RJD6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RJD6-1", "url": "https://www.uniprot.org/uniprot/E5RJD6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RJZ5", "url": "https://www.uniprot.org/uniprot/E5RJZ5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RJZ5-1", "url": "https://www.uniprot.org/uniprot/E5RJZ5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7ERK6", "url": "https://www.uniprot.org/uniprot/E7ERK6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7ERK6-1", "url": "https://www.uniprot.org/uniprot/E7ERK6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7ETB4", "url": "https://www.uniprot.org/uniprot/E7ETB4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7ETB4-1", "url": "https://www.uniprot.org/uniprot/E7ETB4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YAS8", "url": "https://www.uniprot.org/uniprot/H0YAS8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YAS8-1", "url": "https://www.uniprot.org/uniprot/H0YAS8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YC35", "url": "https://www.uniprot.org/uniprot/H0YC35", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YC35-1", "url": "https://www.uniprot.org/uniprot/H0YC35-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YLK8", "url": "https://www.uniprot.org/uniprot/H0YLK8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YLK8-1", "url": "https://www.uniprot.org/uniprot/H0YLK8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10909-1", "url": "https://www.uniprot.org/uniprot/P10909-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10909-2", "url": "https://www.uniprot.org/uniprot/P10909-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10909-3", "url": "https://www.uniprot.org/uniprot/P10909-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10909-4", "url": "https://www.uniprot.org/uniprot/P10909-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10909-5", "url": "https://www.uniprot.org/uniprot/P10909-5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10909-6", "url": "https://www.uniprot.org/uniprot/P10909-6", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE", "length": 449, "header": "sp|P10909-1|CLUS_HUMAN Isoform 1 of Clusterin OS=Homo sapiens OX=9606 GN=CLU PE=1 SV=1 CANONICAL=P10909-1" }, "isoforms": [ { "isoform_ac": "E5RG36-1", "url": "", "sequence": { "sequence": "MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKE", "length": 82, "header": "tr|E5RG36-1|CLUS_HUMAN Computationally mapped isoform of Clusterin OS=Homo sapiens OX=9606 GN=CLU PE=1 SV=1 CANONICAL=P10909-1" }, "locus": { "chromosome": "8", "start_pos": 27610571, "end_pos": 27608938, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000523396.1", "url": "https://www.ensembl.org/id/ENST00000523396.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000428526.1", "url": "https://www.ensembl.org/id/ENSP00000428526.1" } ] } }, { "isoform_ac": "E5RGB0-1", "url": "", "sequence": { "sequence": "MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVC", "length": 129, "header": "tr|E5RGB0-1|CLUS_HUMAN Computationally mapped isoform of Clusterin OS=Homo sapiens OX=9606 GN=CLU PE=1 SV=1 CANONICAL=P10909-1" }, "locus": { "chromosome": "8", "start_pos": 27610571, "end_pos": 27606384, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000522413.5", "url": "https://www.ensembl.org/id/ENST00000522413.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000428779.1", "url": "https://www.ensembl.org/id/ENSP00000428779.1" } ] } }, { "isoform_ac": "E5RH61-1", "url": "", "sequence": { "sequence": "MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGL", "length": 135, "header": "tr|E5RH61-1|E5RH61_HUMAN Computationally mapped isoform of Clusterin OS=Homo sapiens OX=9606 GN=CLU PE=1 SV=8 CANONICAL=P10909-1" }, "locus": { "chromosome": "8", "start_pos": 27610571, "end_pos": 27606366, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000520491.5", "url": "https://www.ensembl.org/id/ENST00000520491.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000429881.1", "url": "https://www.ensembl.org/id/ENSP00000429881.1" } ] } }, { "isoform_ac": "E5RJD6-1", "url": "", "sequence": { "sequence": "MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQ", "length": 32, "header": "tr|E5RJD6-1|E5RJD6_HUMAN Computationally mapped isoform of Clusterin OS=Homo sapiens OX=9606 GN=CLU PE=1 SV=1 CANONICAL=P10909-1" }, "locus": { "chromosome": "8", "start_pos": 27610571, "end_pos": 27610476, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000522238.1", "url": "https://www.ensembl.org/id/ENST00000522238.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000429087.1", "url": "https://www.ensembl.org/id/ENSP00000429087.1" } ] } }, { "isoform_ac": "E5RJZ5-1", "url": "", "sequence": { "sequence": "MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQ", "length": 139, "header": "tr|E5RJZ5-1|CLUS_HUMAN Computationally mapped isoform of Clusterin OS=Homo sapiens OX=9606 GN=CLU PE=1 SV=1 CANONICAL=P10909-1" }, "locus": { "chromosome": "8", "start_pos": 27610571, "end_pos": 27606354, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000519742.5", "url": "https://www.ensembl.org/id/ENST00000519742.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000431026.1", "url": "https://www.ensembl.org/id/ENSP00000431026.1" } ] } }, { "isoform_ac": "E7ERK6-1", "url": "", "sequence": { "sequence": "MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTY", "length": 204, "header": "tr|E7ERK6-1|CLUS_HUMAN Computationally mapped isoform of Clusterin OS=Homo sapiens OX=9606 GN=CLU PE=1 SV=1 CANONICAL=P10909-1" }, "locus": { "chromosome": "8", "start_pos": 27610571, "end_pos": 27605141, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000520796.5", "url": "https://www.ensembl.org/id/ENST00000520796.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000429336.1", "url": "https://www.ensembl.org/id/ENSP00000429336.1" } ] } }, { "isoform_ac": "E7ETB4-1", "url": "", "sequence": { "sequence": "MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKC", "length": 271, "header": "tr|E7ETB4-1|CLUS_HUMAN Computationally mapped isoform of Clusterin OS=Homo sapiens OX=9606 GN=CLU PE=1 SV=1 CANONICAL=P10909-1" }, "locus": { "chromosome": "8", "start_pos": 27610571, "end_pos": 27604310, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000523589.5", "url": "https://www.ensembl.org/id/ENST00000523589.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000431070.1", "url": "https://www.ensembl.org/id/ENSP00000431070.1" } ] } }, { "isoform_ac": "H0YAS8-1", "url": "", "sequence": { "sequence": "XADCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE", "length": 140, "header": "tr|H0YAS8-1|H0YAS8_HUMAN Computationally mapped isoform of Clusterin OS=Homo sapiens OX=9606 GN=CLU PE=1 SV=1 CANONICAL=P10909-1" }, "locus": { "chromosome": "8", "start_pos": 27600015, "end_pos": 27598243, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000521770.1", "url": "https://www.ensembl.org/id/ENST00000521770.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000428033.1", "url": "https://www.ensembl.org/id/ENSP00000428033.1" } ] } }, { "isoform_ac": "H0YC35-1", "url": "", "sequence": { "sequence": "XQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPV", "length": 284, "header": "tr|H0YC35-1|CLUS_HUMAN Computationally mapped isoform of Clusterin OS=Homo sapiens OX=9606 GN=CLU PE=1 SV=1 CANONICAL=P10909-1" }, "locus": { "chromosome": "8", "start_pos": 27605339, "end_pos": 27598537, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000522098.1", "url": "https://www.ensembl.org/id/ENST00000522098.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000430821.1", "url": "https://www.ensembl.org/id/ENSP00000430821.1" } ] } }, { "isoform_ac": "H0YLK8-1", "url": "", "sequence": { "sequence": "MEACKDSRIGGMMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCR", "length": 297, "header": "tr|H0YLK8-1|CLUS_HUMAN Computationally mapped isoform of Clusterin OS=Homo sapiens OX=9606 GN=CLU PE=1 SV=1 CANONICAL=P10909-1" }, "locus": { "chromosome": "8", "start_pos": 27611604, "end_pos": 27604367, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000560566.5", "url": "https://www.ensembl.org/id/ENST00000560566.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000453247.1", "url": "https://www.ensembl.org/id/ENSP00000453247.1" } ] } }, { "isoform_ac": "P10909-1", "url": "", "sequence": { "sequence": "MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE", "length": 449, "header": "sp|P10909-1|CLUS_HUMAN Isoform 1 of Clusterin OS=Homo sapiens OX=9606 GN=CLU PE=1 SV=1 CANONICAL=P10909-1" }, "locus": { "chromosome": "8", "start_pos": 27610571, "end_pos": 27598244, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000523500.5", "url": "https://www.ensembl.org/id/ENST00000523500.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000429620.1", "url": "https://www.ensembl.org/id/ENSP00000429620.1" } ] } }, { "isoform_ac": "P10909-2", "url": "", "sequence": { "sequence": "MQVCSQPQRGCVREQSAINTAPPSAHNAASPGGARGHRVPLTEACKDSRIGGMMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE", "length": 501, "header": "sp|P10909-2|CLUS_HUMAN Isoform 2 of Clusterin OS=Homo sapiens OX=9606 GN=CLU PE=1 SV=1 CANONICAL=P10909-1" }, "locus": {} }, { "isoform_ac": "P10909-3", "url": "", "sequence": { "sequence": "MQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE", "length": 274, "header": "sp|P10909-3|CLUS_HUMAN Isoform 3 of Clusterin OS=Homo sapiens OX=9606 GN=CLU PE=1 SV=1 CANONICAL=P10909-1" }, "locus": {} }, { "isoform_ac": "P10909-4", "url": "", "sequence": { "sequence": "MSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE", "length": 416, "header": "sp|P10909-4|CLUS_HUMAN Isoform 4 of Clusterin OS=Homo sapiens OX=9606 GN=CLU PE=1 SV=1 CANONICAL=P10909-1" }, "locus": {} }, { "isoform_ac": "P10909-5", "url": "", "sequence": { "sequence": "MEACKDSRIGGMMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE", "length": 460, "header": "sp|P10909-5|CLUS_HUMAN Isoform 5 of Clusterin OS=Homo sapiens OX=9606 GN=CLU PE=1 SV=1 CANONICAL=P10909-1" }, "locus": {} }, { "isoform_ac": "P10909-6", "url": "", "sequence": { "sequence": "MGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE", "length": 429, "header": "sp|P10909-6|CLUS_HUMAN Isoform 6 of Clusterin OS=Homo sapiens OX=9606 GN=CLU PE=1 SV=1 CANONICAL=P10909-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P10909@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N103" } ] }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G04672QB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "P10909@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N103" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G10256JP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "P10909@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N103" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11911BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12313PD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12341GU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G13694XX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G20312EM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G22625SJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G24835MQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G24954UD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "P10909@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N103" } ] }, { "glytoucan_ac": "G31596VW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G32332VU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "P10909@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N103" } ] }, { "glytoucan_ac": "G41882MT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G47448YK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G47737VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "P10909@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N103" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G50757KG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G51413EV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G51640FO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G54740VA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G55383ZG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G57888GL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G63381RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G65019XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70418MS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G71146HJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G72667IM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G76417NN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G77582RK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81198YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G86234IN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "P10909@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N103" } ] }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G92081HT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G94854LT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "P10909@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N103" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "P10909", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10909#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "9336835", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9336835" }, { "id": "1551440", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1551440" }, { "id": "2721499", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2721499" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 145, "start_aa": "Asn", "end_pos": 145, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn145", "evidence": [ { "id": "P10909@N145", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N145" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 145, "start_aa": "Asn", "end_pos": 145, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn145", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 145, "start_aa": "Asn", "end_pos": 145, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn145", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 145, "start_aa": "Asn", "end_pos": 145, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn145", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G60923RB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 145, "start_aa": "Asn", "end_pos": 145, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn145", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 145, "start_aa": "Asn", "end_pos": 145, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn145", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 145, "start_aa": "Asn", "end_pos": 145, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn145", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 145, "start_aa": "Asn", "end_pos": 145, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn145", "evidence": [ { "id": "P10909", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10909#ptm_processing" }, { "id": "9336835", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9336835" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "2721499", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2721499" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "1551440", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1551440" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 155, "start_aa": "Asn", "end_pos": 155, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn155", "evidence": [ { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "EPQDTYHYLPFSLPHR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 199, "start_aa": "Glu", "end_pos": 214, "end_aa": "Arg", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 210, "start_aa": "Ser", "end_pos": 210, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser210", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 239, "start_aa": "Asn", "end_pos": 239, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn239", "evidence": [ { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P10909@N291", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N291" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "P10909@N291", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N291" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "P10909@N291", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N291" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G37881RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G42962KI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G51413EV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G57818FI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "P10909@N291", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N291" } ] }, { "glytoucan_ac": "G61937QU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G62837OZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G71146HJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G77459ND", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "P10909@N291", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N291" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P10909", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10909#ptm_processing" }, { "id": "18780401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18780401" }, { "id": "1551440", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1551440" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "2721499", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/2721499" }, { "id": "9336835", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9336835" } ] }, { "glytoucan_ac": "G00406II", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "P10909@N354", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N354" } ] }, { "glytoucan_ac": "G03382KH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G04672QB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G10256JP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "P10909@N354", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N354" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G20312EM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G24835MQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G24954UD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25418HZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G28096RS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G35235RT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G44211QA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "P10909@N354", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N354" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47448YK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G48584BU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G50757KG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G51640FO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G55383ZG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G56284ZY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70418MS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70822IO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G71146HJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G74430RZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G78790NZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81198YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G82592ZH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G86752LQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G92081HT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G94854LT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G96577RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "P10909", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10909#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "12754519", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/12754519" }, { "id": "9336835", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9336835" }, { "id": "1551440", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1551440" }, { "id": "29427759", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/29427759" }, { "id": "29427759", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29427759" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P10909@N374", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N374" } ] }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G02315DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G02628JF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G03596YS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G04784US", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" }, { "id": "P10909@N374", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N374" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G08110WX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G10256JP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909@N374", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N374" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G11911BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12313PD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G12341GU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909@N374", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N374" } ] }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G19972YZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G20312EM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G22589VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G22625SJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G24954UD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G26271XI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P10909@N374", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N374" } ] }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G31118FR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G31544HA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G31596VW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G32332VU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G33791AF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G34617SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G38398KX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39595FH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G39689FZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G41126SR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G42962KI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G44211QA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G46823ME", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G47448YK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G47737VJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" }, { "id": "P10909@N374", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N374" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "24279413", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24279413" }, { "id": "24530628", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G50427EO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G50757KG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G51413EV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G51640FO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G52890YB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G54612UD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G54740VA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G55383ZG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G55412XP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G56284ZY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G57220OY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G57818FI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G57888GL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "P10909@N374", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N374" } ] }, { "glytoucan_ac": "G60923RB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G62894KT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G63381RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G65019XG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G66760KM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66933CM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G69834CE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70418MS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70822IO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G71146HJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G72667IM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G72886NH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G73918EY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G74430RZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G76417NN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "glytoucan_ac": "G77582RK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G78644BR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "glytoucan_ac": "G78790NZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G78811TO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G79286RS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G79635DB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G80333GO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81128KB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G81198YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G82592ZH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82830MN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G83229XP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G83555HU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G86500WE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G87051GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G87875QF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G91158SA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G92081HT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G92597CK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G94854LT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" }, { "id": "P10909@N374", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N374" } ] }, { "glytoucan_ac": "G95977AE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G96416FQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G96577RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G99966GV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "19838169", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19838169" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P10909", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10909#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "9336835", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9336835" }, { "id": "18780401", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/18780401" }, { "id": "16740002", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16740002" }, { "id": "1551440", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1551440" }, { "id": "19139490", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19139490" }, { "id": "16263699", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16263699" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "25855029", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/25855029" }, { "id": "25855029", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25855029" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 376, "start_aa": "Thr", "end_pos": 376, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr376", "evidence": [ { "id": "P10909", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P10909" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "P10909", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P10909" }, { "id": "34846842", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34846842" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "VTTVASHTSDSDVPSGVTEVVVK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 386, "start_aa": "Val", "end_pos": 408, "end_aa": "Lys", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "TT", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 387, "start_aa": "Thr", "end_pos": 388, "end_aa": "Thr", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 396, "start_aa": "Ser", "end_pos": 396, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser396", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "P10909@N86", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N86" } ] }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" }, { "id": "P10909@N86", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N86" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G20312EM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G22625SJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G24954UD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G26271XI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G34617SM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G37881RL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G39619TI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39689FZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "P10909@N86", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N86" } ] }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G42962KI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G43769HG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G50427EO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G51413EV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G54612UD", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G54740VA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G57818FI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G57888GL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66163OV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G67506FN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G71146HJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G75607BQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G77459ND", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G77582RK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G78811TO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G81198YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G86234IN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G86795LJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "30237853", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30237853" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G91158SA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "glytoucan_ac": "G93683YO", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "26791533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26791533" }, { "id": "P10909@N86", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N86" } ] }, { "glytoucan_ac": "G95678HJ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "P10909@N86", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P10909@N86" } ] }, { "glytoucan_ac": "G95977AE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G96577RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "P10909", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "P10909", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10909#ptm_processing" }, { "id": "9336835", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9336835" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "19139490", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19139490" }, { "id": "1551440", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1551440" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" } ] } ], "phosphorylation": [ { "start_pos": 133, "end_pos": 133, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "P10909", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10909" } ], "site_lbl": "Ser133" }, { "start_pos": 393, "end_pos": 393, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10909", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10909" }, { "database": "PubMed", "id": "22906254", "url": "https://glygen.org/publication/PubMed/22906254" } ], "site_lbl": "Thr393" }, { "start_pos": 394, "end_pos": 394, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10909", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10909" }, { "database": "PubMed", "id": "22906254", "url": "https://glygen.org/publication/PubMed/22906254" } ], "site_lbl": "Ser394" }, { "start_pos": 396, "end_pos": 396, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "P10909", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10909" }, { "database": "PubMed", "id": "22906254", "url": "https://glygen.org/publication/PubMed/22906254" } ], "site_lbl": "Ser396" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "P10909", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "Decay accelerating activity of complement receptor type 1 (CD35). Two active sites are required for dissociating C5 convertases.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Krych-Goldberg M, Hauhart RE, Subramanian VB, Yurcisin BM 2nd, Crimmins DL, Hourcade DE, Atkinson JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "10531307", "url": "https://glygen.org/publication/PubMed/10531307" } ] }, { "title": "Control of the amplification convertase of complement by the plasma protein beta1H.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1976", "authors": "Weiler JM, Daha MR, Austen KF, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "1067618", "url": "https://glygen.org/publication/PubMed/1067618" } ] }, { "title": "Granulysin, a T cell product, kills bacteria by altering membrane permeability.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2000", "authors": "Ernst WA, Thoma-Uszynski S, Teitelbaum R, Ko C, Hanson DA, Clayberger C, Krensky AM, Leippe M, Bloom BR, Ganz T, Modlin RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "11120840", "url": "https://glygen.org/publication/PubMed/11120840" } ] }, { "title": "Clusterin is an ATP-independent chaperone with very broad substrate specificity that stabilizes stressed proteins in a folding-competent state.", "journal": "Biochemistry", "date": "2000-12-26", "authors": "Poon S, Easterbrook-Smith S B, Rybchyn M S, Carver J A, Wilson M R", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "11123922", "url": "https://glygen.org/publication/PubMed/11123922" } ] }, { "title": "Human intelectin is a novel soluble lectin that recognizes galactofuranose in carbohydrate chains of bacterial cell wall.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Tsuji S, Uehori J, Matsumoto M, Suzuki Y, Matsuhisa A, Toyoshima K, Seya T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "11313366", "url": "https://glygen.org/publication/PubMed/11313366" } ] }, { "title": "Human cathelicidin, hCAP-18, is processed to the antimicrobial peptide LL-37 by extracellular cleavage with proteinase 3.", "journal": "Blood", "date": "2001", "authors": "Sorensen OE, Follin P, Johnsen AH, Calafat J, Tjabringa GS, Hiemstra PS, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "11389039", "url": "https://glygen.org/publication/PubMed/11389039" } ] }, { "title": "Decay-accelerating factor (DAF), complement receptor 1 (CR1), and factor H dissociate the complement AP C3 convertase (C3bBb) via sites on the type A domain of Bb.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Hourcade DE, Mitchell L, Kuttner-Kondo LA, Atkinson JP, Medof ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "11694537", "url": "https://glygen.org/publication/PubMed/11694537" } ] }, { "title": "Inactivation of C3a and C5a octapeptides by carboxypeptidase R and carboxypeptidase N.", "journal": "Microbiology and immunology", "date": "2002", "authors": "Campbell WD, Lazoura E, Okada N, Okada H", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "11939578", "url": "https://glygen.org/publication/PubMed/11939578" } ] }, { "title": "PLUNC: a novel family of candidate host defence proteins expressed in the upper airways and nasopharynx.", "journal": "Human molecular genetics", "date": "2002", "authors": "Bingle CD, Craven CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "11971875", "url": "https://glygen.org/publication/PubMed/11971875" } ] }, { "title": "Suppression of apolipoprotein C-II amyloid formation by the extracellular chaperone, clusterin.", "journal": "European journal of biochemistry", "date": "2002-06", "authors": "Hatters Danny M, Wilson Mark R, Easterbrook-Smith Simon B, Howlett Geoffrey J", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "12047389", "url": "https://glygen.org/publication/PubMed/12047389" } ] }, { "title": "Role of membrane cofactor protein (CD46) in regulation of C4b and C3b deposited on cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2002", "authors": "Barilla-LaBarca ML, Liszewski MK, Lambris JD, Hourcade D, Atkinson JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "12055245", "url": "https://glygen.org/publication/PubMed/12055245" } ] }, { "title": "Mildly acidic pH activates the extracellular molecular chaperone clusterin.", "journal": "The Journal of biological chemistry", "date": "2002-10-18", "authors": "Poon Stephen, Rybchyn Mark S, Easterbrook-Smith Simon B, Carver John A, Pankhurst Greg J, Wilson Mark R", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "12176985", "url": "https://glygen.org/publication/PubMed/12176985" } ] }, { "title": "Isolation and biochemical characterization of LEAP-2, a novel blood peptide expressed in the liver.", "journal": "Protein science : a publication of the Protein Society", "date": "2003", "authors": "Krause A, Sillard R, Kleemeier B, Kluver E, Maronde E, Conejo-Garcia JR, Forssmann WG, Schulz-Knappe P, Nehls MC, Wattler F, Wattler S, Adermann K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "12493837", "url": "https://glygen.org/publication/PubMed/12493837" } ] }, { "title": "Synthesis and functional analyses of nuclear clusterin, a cell death protein.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Leskov KS, Klokov DY, Li J, Kinsella TJ, Boothman DA", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "12551933", "url": "https://glygen.org/publication/PubMed/12551933" } ] }, { "title": "Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.", "journal": "Nature biotechnology", "date": "2003", "authors": "Zhang H, Li XJ, Martin DB, Aebersold R", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909#ptm_processing" }, { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "12754519", "url": "https://glygen.org/publication/PubMed/12754519" } ] }, { "title": "Essential requirement of apolipoprotein J (clusterin) signaling for IkappaB expression and regulation of NF-kappaB activity.", "journal": "The Journal of biological chemistry", "date": "2003-10-03", "authors": "Santilli Giorgia, Aronow Bruce J, Sala Arturo", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "12882985", "url": "https://glygen.org/publication/PubMed/12882985" } ] }, { "title": "Mechanism of lysozyme catalysis: role of ground-state strain in subsite D in hen egg-white and human lysozymes.", "journal": "Biochemistry", "date": "1977", "authors": "Schindler M, Assaf Y, Sharon N, Chipman DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "13816", "url": "https://glygen.org/publication/PubMed/13816" } ] }, { "title": "Factor I-dependent inactivation of human complement C4b of the classical pathway by C3b/C4b receptor (CR1, CD35) and membrane cofactor protein (MCP, CD46).", "journal": "Journal of biochemistry", "date": "1992", "authors": "Masaki T, Matsumoto M, Nakanishi I, Yasuda R, Seya T", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "1386357", "url": "https://glygen.org/publication/PubMed/1386357" } ] }, { "title": "Isolation of dense granules from human platelets.", "journal": "Methods in enzymology", "date": "1992", "authors": "Fukami MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "1435334", "url": "https://glygen.org/publication/PubMed/1435334" } ] }, { "title": "Human peptidoglycan recognition protein-L is an N-acetylmuramoyl-L-alanine amidase.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Wang ZM, Li X, Cocklin RR, Wang M, Wang M, Fukase K, Inamura S, Kusumoto S, Gupta D, Dziarski R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "14506276", "url": "https://glygen.org/publication/PubMed/14506276" } ] }, { "title": "Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.", "journal": "Blood", "date": "2004", "authors": "Coppinger JA, Cagney G, Toomey S, Kislinger T, Belton O, McRedmond JP, Cahill DJ, Emili A, Fitzgerald DJ, Maguire PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "14630798", "url": "https://glygen.org/publication/PubMed/14630798" } ] }, { "title": "Phylogenetic and evolutionary analysis of the PLUNC gene family.", "journal": "Protein science : a publication of the Protein Society", "date": "2004", "authors": "Bingle CD, LeClair EE, Havard S, Bingle L, Gillingham P, Craven CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "14739326", "url": "https://glygen.org/publication/PubMed/14739326" } ] }, { "title": "Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.", "journal": "Proteomics", "date": "2004", "authors": "Bunkenborg J, Pilch BJ, Podtelejnikov AV, Wisniewski JR", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909#ptm_processing" }, { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "14760718", "url": "https://glygen.org/publication/PubMed/14760718" } ] }, { "title": "Identification of the disulfide bonds in human plasma protein SP-40,40 (apolipoprotein-J).", "journal": "J. Biochem.", "date": "1992", "authors": "Choi-Miura NH, Takahashi Y, Nakano Y, Tobe T, Tomita M", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "1491011", "url": "https://glygen.org/publication/PubMed/1491011" } ] }, { "title": "Human bactericidal/permeability-increasing protein and a recombinant NH2-terminal fragment cause killing of serum-resistant gram-negative bacteria in whole blood and inhibit tumor necrosis factor release induced by the bacteria.", "journal": "The Journal of clinical investigation", "date": "1992", "authors": "Weiss J, Elsbach P, Shu C, Castillo J, Grinna L, Horwitz A, Theofan G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "1522221", "url": "https://glygen.org/publication/PubMed/1522221" } ] }, { "title": "Antimicrobial activity of human EPPIN, an androgen-regulated, sperm-bound protein with a whey acidic protein motif.", "journal": "Biology of reproduction", "date": "2004", "authors": "Yenugu S, Richardson RT, Sivashanmugam P, Wang Z, O'rand MG, French FS, Hall SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "15229136", "url": "https://glygen.org/publication/PubMed/15229136" } ] }, { "title": "The nucleotide transporter MRP4 (ABCC4) is highly expressed in human platelets and present in dense granules, indicating a role in mediator storage.", "journal": "Blood", "date": "2004", "authors": "Jedlitschky G, Tirschmann K, Lubenow LE, Nieuwenhuis HK, Akkerman JW, Greinacher A, Kroemer HK", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "15297306", "url": "https://glygen.org/publication/PubMed/15297306" } ] }, { "title": "Isolation and characterization of a novel gene CLUAP1 whose expression is frequently upregulated in colon cancer.", "journal": "Oncogene", "date": "2004", "authors": "Takahashi M, Lin YM, Nakamura Y, Furukawa Y", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "15480429", "url": "https://glygen.org/publication/PubMed/15480429" } ] }, { "title": "SP-40,40, a protein involved in the control of the complement pathway, possesses a unique array of disulphide bridges.", "journal": "FEBS letters", "date": "1992", "authors": "Kirszbaum L, Bozas SE, Walker ID", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909#ptm_processing" }, { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "1551440", "url": "https://glygen.org/publication/PubMed/1551440" } ] }, { "title": "Uptake of granulysin via lipid rafts leads to lysis of intracellular Listeria innocua.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Walch M, Eppler E, Dumrese C, Barman H, Groscurth P, Ziegler U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "15778384", "url": "https://glygen.org/publication/PubMed/15778384" } ] }, { "title": "Crystal structure of a peptidoglycan recognition protein (PGRP) in complex with a muramyl tripeptide from Gram-positive bacteria.", "journal": "Journal of endotoxin research", "date": "2005", "authors": "Guan R, Roychowdury A, Ember B, Kumar S, Boons GJ, Mariuzza RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "15826377", "url": "https://glygen.org/publication/PubMed/15826377" } ] }, { "title": "Human peptidoglycan recognition protein S is an effector of neutrophil-mediated innate immunity.", "journal": "Blood", "date": "2005", "authors": "Cho JH, Fraser IP, Fukase K, Kusumoto S, Fujimoto Y, Stahl GL, Ezekowitz RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "15956276", "url": "https://glygen.org/publication/PubMed/15956276" } ] }, { "title": "Identification of serum N-acetylmuramoyl-l-alanine amidase as liver peptidoglycan recognition protein 2.", "journal": "Biochimica et biophysica acta", "date": "2005", "authors": "Zhang Y, van der Fits L, Voerman JS, Melief MJ, Laman JD, Wang M, Wang H, Wang M, Li X, Walls CD, Gupta D, Dziarski R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "16054449", "url": "https://glygen.org/publication/PubMed/16054449" } ] }, { "title": "Insights into the human CD59 complement binding interface toward engineering new therapeutics.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Huang Y, Smith CA, Song H, Morgan BP, Abagyan R, Tomlinson S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "16079145", "url": "https://glygen.org/publication/PubMed/16079145" } ] }, { "title": "Clusterin inhibits apoptosis by interacting with activated Bax.", "journal": "Nature cell biology", "date": "2005-09", "authors": "Zhang Honglai, Kim Jin Koo, Edwards Chris A, Xu Zhaohui, Taichman Russell, Wang Cun-Yu", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "16113678", "url": "https://glygen.org/publication/PubMed/16113678" } ] }, { "title": "Binding of complement factor H to endothelial cells is mediated by the carboxy-terminal glycosaminoglycan binding site.", "journal": "The American journal of pathology", "date": "2005", "authors": "Jokiranta TS, Cheng ZZ, Seeberger H, Jozsi M, Heinen S, Noris M, Remuzzi G, Ormsby R, Gordon DL, Meri S, Hellwage J, Zipfel PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "16192651", "url": "https://glygen.org/publication/PubMed/16192651" } ] }, { "title": "Human antimicrobial peptides: defensins, cathelicidins and histatins.", "journal": "Biotechnology letters", "date": "2005", "authors": "De Smet K, Contreras R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "16215847", "url": "https://glygen.org/publication/PubMed/16215847" } ] }, { "title": "Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach.", "journal": "Molecular & cellular proteomics : MCP", "date": "2006", "authors": "Lewandrowski U, Moebius J, Walter U, Sickmann A", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909#ptm_processing" }, { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "16263699", "url": "https://glygen.org/publication/PubMed/16263699" } ] }, { "title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.", "journal": "Journal of proteome research", "date": "2005", "authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909#ptm_processing" }, { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "title": "SLPI and elafin: one glove, many fingers.", "journal": "Clinical science (London, England : 1979)", "date": "2006", "authors": "Williams SE, Brown TI, Roghanian A, Sallenave JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "16336202", "url": "https://glygen.org/publication/PubMed/16336202" } ] }, { "title": "Peptidoglycan recognition proteins are a new class of human bactericidal proteins.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Lu X, Wang M, Qi J, Wang H, Li X, Gupta D, Dziarski R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "16354652", "url": "https://glygen.org/publication/PubMed/16354652" } ] }, { "title": "Cathepsin D is present in human eccrine sweat and involved in the postsecretory processing of the antimicrobial peptide DCD-1L.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Baechle D, Flad T, Cansier A, Steffen H, Schittek B, Tolson J, Herrmann T, Dihazi H, Beck A, Mueller GA, Mueller M, Stevanovic S, Garbe C, Mueller CA, Kalbacher H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "16354654", "url": "https://glygen.org/publication/PubMed/16354654" } ] }, { "title": "Generation of multiple stable dermcidin-derived antimicrobial peptides in sweat of different body sites.", "journal": "The Journal of investigative dermatology", "date": "2006", "authors": "Rieg S, Seeber S, Steffen H, Humeny A, Kalbacher H, Stevanovic S, Kimura A, Garbe C, Schittek B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "16374474", "url": "https://glygen.org/publication/PubMed/16374474" } ] }, { "title": "Transcriptomic and proteomic analyses of rhabdomyosarcoma cells reveal differential cellular gene expression in response to enterovirus 71 infection.", "journal": "Cell. Microbiol.", "date": "2006", "authors": "Leong WF, Chow VT", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "16548883", "url": "https://glygen.org/publication/PubMed/16548883" } ] }, { "title": "Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.", "journal": "Journal of proteome research", "date": "2006", "authors": "Ramachandran P, Boontheung P, Xie Y, Sondej M, Wong DT, Loo JA", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909#ptm_processing" }, { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "16740002", "url": "https://glygen.org/publication/PubMed/16740002" } ] }, { "title": "Neutrophil serine proteases: specific regulators of inflammation.", "journal": "Nature reviews. Immunology", "date": "2006", "authors": "Pham CT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "16799473", "url": "https://glygen.org/publication/PubMed/16799473" } ] }, { "title": "Symbiotic bacteria direct expression of an intestinal bactericidal lectin.", "journal": "Science (New York, N.Y.)", "date": "2006", "authors": "Cash HL, Whitham CV, Behrendt CL, Hooper LV", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "16931762", "url": "https://glygen.org/publication/PubMed/16931762" } ] }, { "title": "Identification of RNase 8 as a novel human antimicrobial protein.", "journal": "Antimicrobial agents and chemotherapy", "date": "2006", "authors": "Rudolph B, Podschun R, Sahly H, Schubert S, Schroder JM, Harder J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "16940129", "url": "https://glygen.org/publication/PubMed/16940129" } ] }, { "title": "Levels of expression of complement regulatory proteins CD46, CD55 and CD59 on resting and activated human peripheral blood leucocytes.", "journal": "Immunology", "date": "2006", "authors": "Christmas SE, de la Mata Espinosa CT, Halliday D, Buxton CA, Cummerson JA, Johnson PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "16999828", "url": "https://glygen.org/publication/PubMed/16999828" } ] }, { "title": "Differential regulation of clusterin and its isoforms by androgens in prostate cells.", "journal": "J. Biol. Chem.", "date": "2007", "authors": "Cochrane Dawn R, Wang Zhou, Muramaki Motosugu, Gleave Martin E, Nelson Colleen C", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "17148459", "url": "https://glygen.org/publication/PubMed/17148459" } ] }, { "title": "Decay-accelerating factor must bind both components of the complement alternative pathway C3 convertase to mediate efficient decay.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007", "authors": "Harris CL, Pettigrew DM, Lea SM, Morgan BP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "17182573", "url": "https://glygen.org/publication/PubMed/17182573" } ] }, { "title": "Effects of glycosylation on the structure and function of the extracellular chaperone clusterin.", "journal": "Biochemistry", "date": "2007", "authors": "Stewart EM, Aquilina JA, Easterbrook-Smith SB, Murphy-Durland D, Jacobsen C, Moestrup S, Wilson MR", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "17260971", "url": "https://glygen.org/publication/PubMed/17260971" } ] }, { "title": "Clusterin expression in normal mucosa and colorectal cancer.", "journal": "Mol. Cell. Proteomics", "date": "2007", "authors": "Andersen Claus Lindbjerg, Schepeler Troels, Thorsen Kasper, Birkenkamp-Demtr\u00f6der Karin, Mansilla Francisco, Aaltonen Lauri A, Laurberg S\u00f8ren, \u00d8rntoft Torben Falck", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "17322305", "url": "https://glygen.org/publication/PubMed/17322305" } ] }, { "title": "Peptidoglycan recognition proteins: pleiotropic sensors and effectors of antimicrobial defences.", "journal": "Nature reviews. Microbiology", "date": "2007", "authors": "Royet J, Dziarski R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "17363965", "url": "https://glygen.org/publication/PubMed/17363965" } ] }, { "title": "The extracellular chaperone clusterin potently inhibits human lysozyme amyloid formation by interacting with prefibrillar species.", "journal": "Journal of molecular biology", "date": "2007-05-25", "authors": "Kumita Janet R, Poon Stephen, Caddy Gemma L, Hagan Christine L, Dumoulin Mireille, Yerbury Justin J, Stewart Elise M, Robinson Carol V, Wilson Mark R, Dobson Christopher M", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "17407782", "url": "https://glygen.org/publication/PubMed/17407782" } ] }, { "title": "The extracellular chaperone clusterin influences amyloid formation and toxicity by interacting with prefibrillar structures.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2007-08", "authors": "Yerbury Justin J, Poon Stephen, Meehan Sarah, Thompson Brianna, Kumita Janet R, Dobson Christopher M, Wilson Mark R", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "17412999", "url": "https://glygen.org/publication/PubMed/17412999" } ] }, { "title": "The apolipoprotein A-I binding protein of placenta and the SP-40,40 protein of human blood are different proteins which both bind to apolipoprotein A-I.", "journal": "Biochim. Biophys. Acta", "date": "1991", "authors": "Ehnholm C, Bozas S E, Tenkanen H, Kirszbaum L, Metso J, Murphy B, Walker I D", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "1742316", "url": "https://glygen.org/publication/PubMed/1742316" } ] }, { "title": "Stress-induced retrotranslocation of clusterin/ApoJ into the cytosol.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2007", "authors": "Nizard P, Tetley S, Le Drean Y, Watrin T, Le Goff P, Wilson MR, Michel D", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "17451556", "url": "https://glygen.org/publication/PubMed/17451556" } ] }, { "title": "Structural insights into the bactericidal mechanism of human peptidoglycan recognition proteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Cho S, Wang Q, Swaminathan CP, Hesek D, Lee M, Boons GJ, Mobashery S, Mariuzza RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "17502600", "url": "https://glygen.org/publication/PubMed/17502600" } ] }, { "title": "Crystal structure of CD59: implications for molecular recognition of the complement proteins C8 and C9 in the membrane-attack complex.", "journal": "Acta crystallographica. Section D, Biological crystallography", "date": "2007", "authors": "Huang Y, Fedarovich A, Tomlinson S, Davies C", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "17505110", "url": "https://glygen.org/publication/PubMed/17505110" } ] }, { "title": "Characterization of an eppin protein complex from human semen and spermatozoa.", "journal": "Biol. Reprod.", "date": "2007", "authors": "Wang Z, Widgren EE, Richardson RT, O'Rand MG", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" }, { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "17567961", "url": "https://glygen.org/publication/PubMed/17567961" } ] }, { "title": "Multiple pathways regulating the anti-apoptotic protein clusterin in breast cancer.", "journal": "Biochimica et biophysica acta", "date": "2007-09", "authors": "Ranney Melissa K, Ahmed Ikhlas S A, Potts Kelly R, Craven Rolf J", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "17689225", "url": "https://glygen.org/publication/PubMed/17689225" } ] }, { "title": "Multifaceted roles of human elafin and secretory leukocyte proteinase inhibitor (SLPI), two serine protease inhibitors of the chelonianin family.", "journal": "Biochimie", "date": "2008", "authors": "Moreau T, Baranger K, Dade S, Dallet-Choisy S, Guyot N, Zani ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "17964057", "url": "https://glygen.org/publication/PubMed/17964057" } ] }, { "title": "Neutrophil elastase, proteinase 3 and cathepsin G: physicochemical properties, activity and physiopathological functions.", "journal": "Biochimie", "date": "2008", "authors": "Korkmaz B, Moreau T, Gauthier F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "18021746", "url": "https://glygen.org/publication/PubMed/18021746" } ] }, { "title": "Expression of cathelicidin LL-37 during Mycobacterium tuberculosis infection in human alveolar macrophages, monocytes, neutrophils, and epithelial cells.", "journal": "Infection and immunity", "date": "2008", "authors": "Rivas-Santiago B, Hernandez-Pando R, Carranza C, Juarez E, Contreras JL, Aguilar-Leon D, Torres M, Sada E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "18160480", "url": "https://glygen.org/publication/PubMed/18160480" } ] }, { "title": "The neuroendocrine peptide catestatin is a cutaneous antimicrobial and induced in the skin after injury.", "journal": "The Journal of investigative dermatology", "date": "2008", "authors": "Radek KA, Lopez-Garcia B, Hupe M, Niesman IR, Elias PM, Taupenot L, Mahata SK, O'Connor DT, Gallo RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "18185531", "url": "https://glygen.org/publication/PubMed/18185531" } ] }, { "title": "The antipathogen activities of eosinophil cationic protein.", "journal": "Current pharmaceutical biotechnology", "date": "2008", "authors": "Boix E, Torrent M, Sanchez D, Nogues MV", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "18673279", "url": "https://glygen.org/publication/PubMed/18673279" } ] }, { "title": "Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.", "journal": "Proteomics", "date": "2008", "authors": "Picariello G, Ferranti P, Mamone G, Roepstorff P, Addeo F", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909#ptm_processing" }, { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "18780401", "url": "https://glygen.org/publication/PubMed/18780401" } ] }, { "title": "Characterization of a human high density lipoprotein-associated protein, NA1/NA2. Identity with SP-40,40, an inhibitor of complement-mediated cytolysis.", "journal": "Arterioscler. Thromb.", "date": "1991", "authors": "James R W, Hochstrasser A C, Borghini I, Martin B, Pometta D, Hochstrasser D", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "1903064", "url": "https://glygen.org/publication/PubMed/1903064" } ] }, { "title": "Regulation of C-type lectin antimicrobial activity by a flexible N-terminal prosegment.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Mukherjee S, Partch CL, Lehotzky RE, Whitham CV, Chu H, Bevins CL, Gardner KH, Hooper LV", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "19095652", "url": "https://glygen.org/publication/PubMed/19095652" } ] }, { "title": "Clusterin is a short half-life, poly-ubiquitinated protein, which controls the fate of prostate cancer cells.", "journal": "Journal of cellular physiology", "date": "2009", "authors": "Rizzi F, Caccamo AE, Belloni L, Bettuzzi S", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "19137541", "url": "https://glygen.org/publication/PubMed/19137541" } ] }, { "title": "A strategy for precise and large scale identification of core fucosylated glycoproteins.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909#ptm_processing" }, { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "19139490", "url": "https://glygen.org/publication/PubMed/19139490" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909#ptm_processing" }, { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "Lysozyme and microbiota in relation to gingivitis and periodontitis.", "journal": "Medical science monitor : international medical journal of experimental and clinical research", "date": "2009", "authors": "Surna A, Kubilius R, Sakalauskiene J, Vitkauskiene A, Jonaitis J, Saferis V, Gleiznys A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "19179970", "url": "https://glygen.org/publication/PubMed/19179970" } ] }, { "title": "Human gliomas and epileptic foci express high levels of a mRNA related to rat testicular sulfated glycoprotein 2, a purported marker of cell death.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1991", "authors": "Danik M, Chabot J G, Mercier C, Benabid A L, Chauvin C, Quirion R, Suh M", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "1924317", "url": "https://glygen.org/publication/PubMed/1924317" } ] }, { "title": "Proteolytic activation of human pancreatitis-associated protein is required for peptidoglycan binding and bacterial aggregation.", "journal": "The Biochemical journal", "date": "2009", "authors": "Medveczky P, Szmola R, Sahin-Toth M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "19254208", "url": "https://glygen.org/publication/PubMed/19254208" } ] }, { "title": "Structural characterization of clusterin-chaperone client protein complexes.", "journal": "The Journal of biological chemistry", "date": "2009-08-14", "authors": "Wyatt Amy R, Yerbury Justin J, Wilson Mark R", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "19535339", "url": "https://glygen.org/publication/PubMed/19535339" } ] }, { "title": "Apolipoprotein J: structure and tissue distribution.", "journal": "Biochemistry", "date": "1990", "authors": "de Silva H V, Harmony J A, Stuart W D, Gil C M, Robbins J", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "1974459", "url": "https://glygen.org/publication/PubMed/1974459" } ] }, { "title": "Catalytic and non-catalytic functions of human IIA phospholipase A2.", "journal": "Trends in biochemical sciences", "date": "2010", "authors": "Birts CN, Barton CH, Wilton DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "19818633", "url": "https://glygen.org/publication/PubMed/19818633" } ] }, { "title": "Enrichment of glycopeptides for glycan structure and attachment site identification.", "journal": "Nature methods", "date": "2009", "authors": "Nilsson J, Ruetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909#ptm_processing" }, { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" }, { "database": "UniCarbKB", "id": "P10909", "url": "" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "reference": [ { "type": "PubMed", "id": "19838169", "url": "https://glygen.org/publication/PubMed/19838169" } ] }, { "title": "Identification of human plasma proteins as major clients for the extracellular chaperone clusterin.", "journal": "The Journal of biological chemistry", "date": "2010-02-05", "authors": "Wyatt Amy R, Wilson Mark R", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "19996109", "url": "https://glygen.org/publication/PubMed/19996109" } ] }, { "title": "Clusterin facilitates COMMD1 and I-kappaB degradation to enhance NF-kappaB activity in prostate cancer cells.", "journal": "Molecular cancer research : MCR", "date": "2010", "authors": "Zoubeidi A, Ettinger S, Beraldi E, Hadaschik B, Zardan A, Klomp LW, Nelson CC, Rennie PS, Gleave ME", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "20068069", "url": "https://glygen.org/publication/PubMed/20068069" } ] }, { "title": "Membrane structure and interactions of human catestatin by multidimensional solution and solid-state NMR spectroscopy.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2010", "authors": "Sugawara M, Resende JM, Moraes CM, Marquette A, Chich JF, Metz-Boutigue MH, Bechinger B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "20103720", "url": "https://glygen.org/publication/PubMed/20103720" } ] }, { "title": "Comparison of human RNase 3 and RNase 7 bactericidal action at the Gram-negative and Gram-positive bacterial cell wall.", "journal": "The FEBS journal", "date": "2010", "authors": "Torrent M, Badia M, Moussaoui M, Sanchez D, Nogues MV, Boix E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "20180804", "url": "https://glygen.org/publication/PubMed/20180804" } ] }, { "title": "Molecular basis for peptidoglycan recognition by a bactericidal lectin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Lehotzky RE, Partch CL, Mukherjee S, Cash HL, Goldman WE, Gardner KH, Hooper LV", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "20382864", "url": "https://glygen.org/publication/PubMed/20382864" } ] }, { "title": "Secretory leukocyte protease inhibitor and elafin/trappin-2: versatile mucosal antimicrobials and regulators of immunity.", "journal": "American journal of respiratory cell and molecular biology", "date": "2010", "authors": "Sallenave JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "20395631", "url": "https://glygen.org/publication/PubMed/20395631" } ] }, { "title": "Analysis of the solution structure of the human antibiotic peptide dermcidin and its interaction with phospholipid vesicles.", "journal": "BMB reports", "date": "2010", "authors": "Jung HH, Yang ST, Sim JY, Lee S, Lee JY, Kim HH, Shin SY, Kim JI", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "20510021", "url": "https://glygen.org/publication/PubMed/20510021" } ] }, { "title": "Structural and functional analysis of human liver-expressed antimicrobial peptide 2.", "journal": "Chembiochem : a European journal of chemical biology", "date": "2010", "authors": "Henriques ST, Tan CC, Craik DJ, Clark RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "20845358", "url": "https://glygen.org/publication/PubMed/20845358" } ] }, { "title": "Clusterin facilitates in vivo clearance of extracellular misfolded proteins.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2011-12", "authors": "Wyatt Amy R, Yerbury Justin J, Berghofer Paula, Greguric Ivan, Katsifis Andrew, Dobson Christopher M, Wilson Mark R", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "21505792", "url": "https://glygen.org/publication/PubMed/21505792" } ] }, { "title": "Human nuclear clusterin mediates apoptosis by interacting with Bcl-XL through C-terminal coiled coil domain.", "journal": "Journal of cellular physiology", "date": "2012-03", "authors": "Kim Nayoung, Yoo Jae Cheal, Han Jae Yoon, Hwang Eun Mi, Kim Yoon Sook, Jeong Eun Young, Sun Choong-Hyun, Yi Gwan-Su, Roh Gu Seob, Kim Hyun Joon, Kang Sang Soo, Cho Gyeong Jae, Park Jae-Yong, Choi Wan Sung", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "21567405", "url": "https://glygen.org/publication/PubMed/21567405" } ] }, { "title": "Distant cousins: genomic and sequence diversity within the BPI fold-containing (BPIF)/PLUNC protein family.", "journal": "Biochemical Society transactions", "date": "2011", "authors": "Bingle CD, Bingle L, Craven CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "21787330", "url": "https://glygen.org/publication/PubMed/21787330" } ] }, { "title": "Unique structure of iC3b resolved at a resolution of 24 A by 3D-electron microscopy.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Alcorlo M, Martinez-Barricarte R, Fernandez FJ, Rodriguez-Gallego C, Round A, Vega MC, Harris CL, de Cordoba SR, Llorca O", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "21788512", "url": "https://glygen.org/publication/PubMed/21788512" } ] }, { "title": "Structure-activity analysis of the dermcidin-derived peptide DCD-1L, an anionic antimicrobial peptide present in human sweat.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Paulmann M, Arnold T, Linke D, Ozdirekcan S, Kopp A, Gutsmann T, Kalbacher H, Wanke I, Schuenemann VJ, Habeck M, Burck J, Ulrich AS, Schittek B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "22262861", "url": "https://glygen.org/publication/PubMed/22262861" } ] }, { "title": "Antimicrobial RNases in cutaneous defense.", "journal": "Journal of innate immunity", "date": "2012", "authors": "Simanski M, Koten B, Schroder JM, Glaser R, Harder J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "22327069", "url": "https://glygen.org/publication/PubMed/22327069" } ] }, { "title": "The multiple facets of dermcidin in cell survival and host defense.", "journal": "Journal of innate immunity", "date": "2012", "authors": "Schittek B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "22455996", "url": "https://glygen.org/publication/PubMed/22455996" } ] }, { "title": "GRP78 regulates clusterin stability, retrotranslocation and mitochondrial localization under ER stress in prostate cancer.", "journal": "Oncogene", "date": "2013", "authors": "Li N, Zoubeidi A, Beraldi E, Gleave ME", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "22689054", "url": "https://glygen.org/publication/PubMed/22689054" } ] }, { "title": "Induction of the human cathelicidin LL-37 as a novel treatment against bacterial infections.", "journal": "Journal of leukocyte biology", "date": "2012", "authors": "van der Does AM, Bergman P, Agerberth B, Lindbom L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "22701042", "url": "https://glygen.org/publication/PubMed/22701042" } ] }, { "title": "Thrombin generates previously unidentified C5 products that support the terminal complement activation pathway.", "journal": "Blood", "date": "2012", "authors": "Krisinger MJ, Goebeler V, Lu Z, Meixner SC, Myles T, Pryzdial EL, Conway EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "22802338", "url": "https://glygen.org/publication/PubMed/22802338" } ] }, { "title": "Mass spectrometry quantification of clusterin in the human brain.", "journal": "Molecular neurodegeneration", "date": "2012", "authors": "Chen J, Wang M, Turko IV", "evidence": [ { "database": "iPTMnet", "id": "P10909", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10909" } ], "reference": [ { "type": "PubMed", "id": "22906254", "url": "https://glygen.org/publication/PubMed/22906254" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "Ribonuclease 7, an antimicrobial peptide upregulated during infection, contributes to microbial defense of the human urinary tract.", "journal": "Kidney international", "date": "2013", "authors": "Spencer JD, Schwaderer AL, Wang H, Bartz J, Kline J, Eichler T, DeSouza KR, Sims-Lucas S, Baker P, Hains DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "23302724", "url": "https://glygen.org/publication/PubMed/23302724" } ] }, { "title": "Crystal structure and functional mechanism of a human antimicrobial membrane channel.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Song C, Weichbrodt C, Salnikov ES, Dynowski M, Forsberg BO, Bechinger B, Steinem C, de Groot BL, Zachariae U, Zeth K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "23426625", "url": "https://glygen.org/publication/PubMed/23426625" } ] }, { "title": "Dimerization of complement factor H-related proteins modulates complement activation in vivo.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Goicoechea de Jorge E, Caesar JJ, Malik TH, Patel M, Colledge M, Johnson S, Hakobyan S, Morgan BP, Harris CL, Pickering MC, Lea SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "23487775", "url": "https://glygen.org/publication/PubMed/23487775" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "P10909", "url": "" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "High precision platelet releasate definition by quantitative reversed protein profiling--brief report.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2013", "authors": "Wijten P, van Holten T, Woo LL, Bleijerveld OB, Roest M, Heck AJ, Scholten A", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "23640497", "url": "https://glygen.org/publication/PubMed/23640497" } ] }, { "title": "Purification and characterization of apolipoprotein J.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "de Silva HV, Stuart WD, Park YB, Mao SJ, Gil CM, Wetterau JR, Busch SJ, Harmony JA", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "2387851", "url": "https://glygen.org/publication/PubMed/2387851" } ] }, { "title": "Non-secreted clusterin isoforms are translated in rare amounts from distinct human mRNA variants and do not affect Bax-mediated apoptosis or the NF-kappaB signaling pathway.", "journal": "PloS one", "date": "2013", "authors": "Prochnow H, Gollan R, Rohne P, Hassemer M, Koch-Brandt C, Baiersdorfer M", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "24073260", "url": "https://glygen.org/publication/PubMed/24073260" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "Endogenous association of decay-accelerating factor (DAF) with C4b and C3b on cell membranes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1986", "authors": "Kinoshita T, Medof ME, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2420889", "url": "https://glygen.org/publication/PubMed/2420889" } ] }, { "title": "Histatins: salivary peptides with copper(II)- and zinc(II)-binding motifs: perspectives for biomedical applications.", "journal": "The FEBS journal", "date": "2014", "authors": "Melino S, Santone C, Di Nardo P, Sarkar B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "24219363", "url": "https://glygen.org/publication/PubMed/24219363" } ] }, { "title": "Antibacterial membrane attack by a pore-forming intestinal C-type lectin.", "journal": "Nature", "date": "2014", "authors": "Mukherjee S, Zheng H, Derebe MG, Callenberg KM, Partch CL, Rollins D, Propheter DC, Rizo J, Grabe M, Jiang QX, Hooper LV", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "24256734", "url": "https://glygen.org/publication/PubMed/24256734" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" }, { "database": "iPTMnet", "id": "P10909", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10909" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Computational framework for identification of intact glycopeptides in complex samples.", "journal": "Analytical chemistry", "date": "2014", "authors": "Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H", "evidence": [ { "database": "UniCarbKB", "id": "P10909", "url": "" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "reference": [ { "type": "PubMed", "id": "24279413", "url": "https://glygen.org/publication/PubMed/24279413" } ] }, { "title": "Clusterin is a ligand for apolipoprotein E receptor 2 (ApoER2) and very low density lipoprotein receptor (VLDLR) and signals via the Reelin-signaling pathway.", "journal": "J. Biol. Chem.", "date": "2014", "authors": "Leeb Christian, Eresheim Christine, Nimpf Johannes", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "24381170", "url": "https://glygen.org/publication/PubMed/24381170" } ] }, { "title": "Selective glycopeptide profiling by acetone enrichment and LC/MS.", "journal": "Journal of proteomics", "date": "2014", "authors": "Takakura D, Harazono A, Hashii N, Kawasaki N", "evidence": [ { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "reference": [ { "type": "PubMed", "id": "24530628", "url": "https://glygen.org/publication/PubMed/24530628" } ] }, { "title": "SC5b-7, SC5b-8 and SC5b-9 complexes of complement: ultrastructure and localization of the S-protein (vitronectin) within the macromolecules.", "journal": "European journal of immunology", "date": "1989", "authors": "Preissner KP, Podack ER, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2465906", "url": "https://glygen.org/publication/PubMed/2465906" } ] }, { "title": "Complement S-protein (vitronectin) is associated with cytolytic membrane-bound C5b-9 complexes.", "journal": "Clinical and experimental immunology", "date": "1988", "authors": "Bhakdi S, Kaflein R, Halstensen TS, Hugo F, Preissner KT, Mollnes TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2466593", "url": "https://glygen.org/publication/PubMed/2466593" } ] }, { "title": "Functional properties of membrane cofactor protein of complement.", "journal": "The Biochemical journal", "date": "1989", "authors": "Seya T, Atkinson JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2481448", "url": "https://glygen.org/publication/PubMed/2481448" } ] }, { "title": "Ribonucleases 6 and 7 have antimicrobial function in the human and murine urinary tract.", "journal": "Kidney international", "date": "2015", "authors": "Becknell B, Eichler TE, Beceiro S, Li B, Easterling RS, Carpenter AR, James CL, McHugh KM, Hains DS, Partida-Sanchez S, Spencer JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "25075772", "url": "https://glygen.org/publication/PubMed/25075772" } ] }, { "title": "The chaperone activity of clusterin is dependent on glycosylation and redox environment.", "journal": "Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology", "date": "2014", "authors": "Rohne P, Prochnow H, Wolf S, Renner B, Koch-Brandt C", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "25402950", "url": "https://glygen.org/publication/PubMed/25402950" } ] }, { "title": "Neutrophil serine proteases in antibacterial defense.", "journal": "Current opinion in microbiology", "date": "2015", "authors": "Stapels DA, Geisbrecht BV, Rooijakkers SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "25461571", "url": "https://glygen.org/publication/PubMed/25461571" } ] }, { "title": "The secrets of dermcidin action.", "journal": "International journal of medical microbiology : IJMM", "date": "2015", "authors": "Burian M, Schittek B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "25596890", "url": "https://glygen.org/publication/PubMed/25596890" } ] }, { "title": "Clusterin glycopeptide variant characterization reveals significant site-specific glycan changes in the plasma of clear cell renal cell carcinoma.", "journal": "Journal of proteome research", "date": "2015", "authors": "Gbormittah FO, Bones J, Hincapie M, Tousi F, Hancock WS, Iliopoulos O", "evidence": [ { "database": "Automatic Literature Mining", "id": "25855029", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/25855029" } ], "reference": [ { "type": "PubMed", "id": "25855029", "url": "https://glygen.org/publication/PubMed/25855029" } ] }, { "title": "A serum protein SP40,40 modulates the formation of membrane attack complex of complement on erythrocytes.", "journal": "Mol. Immunol.", "date": "1989", "authors": "Choi N H, Mazda T, Tomita M", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "2601725", "url": "https://glygen.org/publication/PubMed/2601725" } ] }, { "title": "Recognition of microbial glycans by human intelectin-1.", "journal": "Nature structural & molecular biology", "date": "2015", "authors": "Wesener DA, Wangkanont K, McBride R, Song X, Kraft MB, Hodges HL, Zarling LC, Splain RA, Smith DF, Cummings RD, Paulson JC, Forest KT, Kiessling LL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "26148048", "url": "https://glygen.org/publication/PubMed/26148048" } ] }, { "title": "N-Glycoproteomics of Human Seminal Plasma Glycoproteins.", "journal": "Journal of proteome research", "date": "2016", "authors": "Saraswat M, Joenvaara S, Tomar AK, Singh S, Yadav S, Renkonen R", "evidence": [ { "database": "UniCarbKB", "id": "P10909", "url": "" } ], "reference": [ { "type": "PubMed", "id": "26791533", "url": "https://glygen.org/publication/PubMed/26791533" } ] }, { "title": "Insights into the Antimicrobial Mechanism of Action of Human RNase6: Structural Determinants for Bacterial Cell Agglutination and Membrane Permeation.", "journal": "International journal of molecular sciences", "date": "2016", "authors": "Pulido D, Arranz-Trullen J, Prats-Ejarque G, Velazquez D, Torrent M, Moussaoui M, Boix E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "27089320", "url": "https://glygen.org/publication/PubMed/27089320" } ] }, { "title": "Molecular cloning and characterization of the novel, human complement-associated protein, SP-40,40: a link between the complement and reproductive systems.", "journal": "The EMBO journal", "date": "1989", "authors": "Kirszbaum L, Sharpe JA, Murphy B, d'Apice AJ, Classon B, Hudson P, Walker ID", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909#ptm_processing" }, { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "2721499", "url": "https://glygen.org/publication/PubMed/2721499" } ] }, { "title": "Molecular structure and functional characterization of a human complement cytolysis inhibitor found in blood and seminal plasma: identity to sulfated glycoprotein 2, a constituent of rat testis fluid.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Jenne DE, Tschopp J", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "2780565", "url": "https://glygen.org/publication/PubMed/2780565" } ] }, { "title": "Regulation of the amplification C3 convertase of human complement by an inhibitory protein isolated from human erythrocyte membrane.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1979", "authors": "Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "293688", "url": "https://glygen.org/publication/PubMed/293688" } ] }, { "title": "Modulation of the classical pathway C3 convertase by plasma proteins C4 binding protein and C3b inactivator.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1979", "authors": "Gigli I, Fujita T, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "293746", "url": "https://glygen.org/publication/PubMed/293746" } ] }, { "title": "Large-scale intact glycopeptide identification by Mascot database search.", "journal": "Scientific reports", "date": "2018", "authors": "Bollineni RC, Koehler CJ, Gislefoss RE, Anonsen JH, Thiede B", "evidence": [ { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "reference": [ { "type": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "title": "Quantitative analysis of core fucosylation of serum proteins in liver diseases by LC-MS-MRM.", "journal": "Journal of proteomics", "date": "2018", "authors": "Ma J, Sanda M, Wei R, Zhang L, Goldman R", "evidence": [ { "database": "Automatic Literature Mining", "id": "29427759", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/29427759" } ], "reference": [ { "type": "PubMed", "id": "29427759", "url": "https://glygen.org/publication/PubMed/29427759" } ] }, { "title": "Human complement factor I: analysis of cDNA-derived primary structure and assignment of its gene to chromosome 4.", "journal": "The Journal of biological chemistry", "date": "1987", "authors": "Goldberger G, Bruns GA, Rits M, Edge MD, Kwiatkowski DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2956252", "url": "https://glygen.org/publication/PubMed/2956252" } ] }, { "title": "Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and alpha-1B-Glycoprotein.", "journal": "Analytical chemistry", "date": "2018", "authors": "Sun S, Hu Y, Jia L, Eshghi ST, Liu Y, Shah P, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P10909", "url": "" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "reference": [ { "type": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "title": "Identification of the C3b receptor-binding domain in third component of complement.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Becherer JD, Lambris JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "2971659", "url": "https://glygen.org/publication/PubMed/2971659" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P10909", "url": "" }, { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Human complement C3b inactivator: isolation, characterization, and demonstration of an absolute requirement for the serum protein beta1H for cleavage of C3b and C4b in solution.", "journal": "The Journal of experimental medicine", "date": "1977", "authors": "Pangburn MK, Schreiber RD, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "301546", "url": "https://glygen.org/publication/PubMed/301546" } ] }, { "title": "Distinct urinary glycoprotein signatures in prostate cancer patients.", "journal": "Oncotarget", "date": "2018", "authors": "Kawahara R, Ortega F, Rosa-Fernandes L, Guimaraes V, Quina D, Nahas W, Schwammle V, Srougi M, Leite KRM, Thaysen-Andersen M, Larsen MR, Palmisano G", "evidence": [ { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "reference": [ { "type": "PubMed", "id": "30237853", "url": "https://glygen.org/publication/PubMed/30237853" } ] }, { "title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).", "journal": "Molecular systems biology", "date": "2018", "authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P10909", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30459171", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "title": "Molecular organization and function of the complement system.", "journal": "Annual review of biochemistry", "date": "1988", "authors": "Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-166665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166665" } ], "reference": [ { "type": "PubMed", "id": "3052276", "url": "https://glygen.org/publication/PubMed/3052276" } ] }, { "title": "HDL particle associated proteins in plasma and cerebrospinal fluid: identification and partial sequencing.", "journal": "Appl. Theor. Electrophor.", "date": "1988", "authors": "Hochstrasser A C, James R W, Martin B M, Harrington M, Hochstrasser D, Pometta D, Merril C R", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "3154963", "url": "https://glygen.org/publication/PubMed/3154963" } ] }, { "title": "Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes.", "journal": "Journal of proteome research", "date": "2020", "authors": "Zhu J, Lin YH, Dingess KA, Mank M, Stahl B, Heck AJR", "evidence": [ { "database": "GlyConnect", "id": "759", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "reference": [ { "type": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "title": "Histatins, a novel family of histidine-rich proteins in human parotid secretion. Isolation, characterization, primary structure, and fungistatic effects on Candida albicans.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Oppenheim FG, Xu T, McMillian FM, Levitz SM, Diamond RD, Offner GD, Troxler RF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "3286634", "url": "https://glygen.org/publication/PubMed/3286634" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P10909", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P10909" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "Highly Efficient Enrichment of O-GlcNAc Glycopeptides Based on Chemical Oxidation and Reversible Hydrazide Chemistry.", "journal": "Analytical chemistry", "date": "2021", "authors": "Chen Y, Qin H, Yue X, Zhou J, Liu L, Nie Y, Ye M", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "P10909", "url": "https://oglcnac.org/atlas/detail/P10909" } ], "reference": [ { "type": "PubMed", "id": "34846842", "url": "https://glygen.org/publication/PubMed/34846842" } ] }, { "title": "An Optimized Isotopic Photocleavable Tagging Strategy for Site-Specific and Quantitative Profiling of Protein O-GlcNAcylation in Colorectal Cancer Metastasis.", "journal": "ACS chemical biology", "date": "2022", "authors": "Liu J, Hao Y, Wang C, Jin Y, Yang Y, Gu J, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P10909", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P10909" } ], "reference": [ { "type": "PubMed", "id": "35254053", "url": "https://glygen.org/publication/PubMed/35254053" } ] }, { "title": "Clusterin Is a Prognostic Biomarker of Lower-Grade Gliomas and Is Associated with Immune Cell Infiltration.", "journal": "International journal of molecular sciences", "date": "2023-08-29", "authors": "Ren Xiaoyue, Chang Chao, Qi Teng, Yang Pengyu, Wang Yuanbo, Zhou Xiaorui, Guan Feng, Li Xiang", "evidence": [ { "database": "RefSeq", "id": "NP_001822", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001822" } ], "reference": [ { "type": "PubMed", "id": "37686218", "url": "https://glygen.org/publication/PubMed/37686218" } ] }, { "title": "Regulation of psoriasis, colitis, and the intestinal microbiota by clusterin.", "journal": "Scientific reports", "date": "2023-09-16", "authors": "Jun Yu Kyung, Yoon Hee Tae, Kwon So Hyun, Jo Ui Hyeon, Kim Ji Eun, Han Yoo Min, Kim Min-Seon, Im Jong Pil, Lee Dong Ho, Kim Joo Sung, Koh Seong-Joon, Park Hyunsun", "evidence": [ { "database": "RefSeq", "id": "NP_001822", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001822" } ], "reference": [ { "type": "PubMed", "id": "37717073", "url": "https://glygen.org/publication/PubMed/37717073" } ] }, { "title": "Clusterin protects mature dendritic cells from reactive oxygen species mediated cell death.", "journal": "Oncoimmunology", "date": "2024", "authors": "L\u00f3pez Malizia Alvaro, Merlotti Antonela, Bonte Pierre-Emmanuel, Sager Melina, Arribas De Sandoval Yago, Goudot Christel, Erra D\u00edaz Fernando, Pereyra-Gerber Pehu\u00e9n, Ceballos Ana, Amigorena Sebastian, Geffner Jorge, Sabatte Juan", "evidence": [ { "database": "RefSeq", "id": "NP_001822", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001822" } ], "reference": [ { "type": "PubMed", "id": "38125724", "url": "https://glygen.org/publication/PubMed/38125724" } ] }, { "title": "C3 nephritic factor protects bound C3bBb from cleavage by factor I and human erythrocytes.", "journal": "Molecular immunology", "date": "1985", "authors": "Mold C, Medof ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "3848661", "url": "https://glygen.org/publication/PubMed/3848661" } ] }, { "title": "Anaphylatoxin inactivator of human plasma: its isolation and characterization as a carboxypeptidase.", "journal": "The Journal of clinical investigation", "date": "1970", "authors": "Bokisch VA, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "4098172", "url": "https://glygen.org/publication/PubMed/4098172" } ] }, { "title": "Molecular organization of C9 within the membrane attack complex of complement. Induction of circular C9 polymerization by the C5b-8 assembly.", "journal": "The Journal of experimental medicine", "date": "1982", "authors": "Podack ER, Tschoop J, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-166665", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166665" } ], "reference": [ { "type": "PubMed", "id": "6177822", "url": "https://glygen.org/publication/PubMed/6177822" } ] }, { "title": "Generation of three different fragments of bound C3 with purified factor I or serum. I. Requirements for factor H vs CR1 cofactor activity.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1982", "authors": "Ross GD, Lambris JD, Cain JA, Newman SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6214588", "url": "https://glygen.org/publication/PubMed/6214588" } ] }, { "title": "Kinetic and thermodynamic analysis of the control of C3b by the complement regulatory proteins factors H and I.", "journal": "Biochemistry", "date": "1983", "authors": "Pangburn MK, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6219696", "url": "https://glygen.org/publication/PubMed/6219696" } ] }, { "title": "Visualization of human C4b-binding protein and its complexes with vitamin K-dependent protein S and complement protein C4b.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1983", "authors": "Dahlback B, Smith CA, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6222381", "url": "https://glygen.org/publication/PubMed/6222381" } ] }, { "title": "Identification of a 145,000 Mr membrane protein as the C3d receptor (CR2) of human B lymphocytes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1984", "authors": "Weis JJ, Tedder TF, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6230668", "url": "https://glygen.org/publication/PubMed/6230668" } ] }, { "title": "Inhibition of complement activation on the surface of cells after incorporation of decay-accelerating factor (DAF) into their membranes.", "journal": "The Journal of experimental medicine", "date": "1984", "authors": "Medof ME, Kinoshita T, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6238120", "url": "https://glygen.org/publication/PubMed/6238120" } ] }, { "title": "Characterization of the interaction of human C4b-binding protein with physiological ligands.", "journal": "The Journal of biological chemistry", "date": "1984", "authors": "Ziccardi RJ, Dahlback B, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6334079", "url": "https://glygen.org/publication/PubMed/6334079" } ] }, { "title": "High molecular weight complex in human plasma between vitamin K-dependent protein S and complement component C4b-binding protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1981", "authors": "Dahlback B, Stenflo J", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6454142", "url": "https://glygen.org/publication/PubMed/6454142" } ] }, { "title": "Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa.", "journal": "Biochimica et biophysica acta", "date": "1981", "authors": "Gogstad GO, Hagen I, Korsmo R, Solum NO", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "6457647", "url": "https://glygen.org/publication/PubMed/6457647" } ] }, { "title": "Physiologic inactivation of fluid phase C3b: isolation and structural analysis of C3c, C3d,g (alpha 2D), and C3g.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1984", "authors": "Davis AE 3rd, Harrison RA, Lachmann PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6607952", "url": "https://glygen.org/publication/PubMed/6607952" } ] }, { "title": "Human C4-binding protein. I. Isolation and characterization.", "journal": "The Journal of experimental medicine", "date": "1978", "authors": "Scharfstein J, Ferreira A, Gigli I, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "670886", "url": "https://glygen.org/publication/PubMed/670886" } ] }, { "title": "The human complement system: assembly of the classical pathway C3 convertase.", "journal": "The Biochemical journal", "date": "1980", "authors": "Kerr MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "6906228", "url": "https://glygen.org/publication/PubMed/6906228" } ] }, { "title": "Human C4-binding protein. II. Role in proteolysis of C4b by C3b-inactivator.", "journal": "The Journal of experimental medicine", "date": "1978", "authors": "Fujita T, Gigli I, Nussenzweig V", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "702059", "url": "https://glygen.org/publication/PubMed/702059" } ] }, { "title": "Cleavage of C4b by C3b inactivator: production of a nicked form of C4b, C4b', as an intermediate cleavage product of C4b by C3b inactivator.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1980", "authors": "Nagasawa S, Ichihara C, Stroud RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "7391570", "url": "https://glygen.org/publication/PubMed/7391570" } ] }, { "title": "Complement inhibition by human vitronectin involves non-heparin binding domains.", "journal": "Clinical and experimental immunology", "date": "1995", "authors": "Sheehan M, Morris CA, Pussell BA, Charlesworth JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "7542572", "url": "https://glygen.org/publication/PubMed/7542572" } ] }, { "title": "Interaction of C1-inhibitor with the C1r and C1s subcomponents in human C1.", "journal": "Biochimica et biophysica acta", "date": "1979", "authors": "Arlaud GJ, Reboul A, Sim RB, Colomb MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "760802", "url": "https://glygen.org/publication/PubMed/760802" } ] }, { "title": "Interaction of 125I-labelled complement subcomponents C-1r and C-1s with protease inhibitors in plasma.", "journal": "FEBS letters", "date": "1979", "authors": "Sim RB, Reboul A, Arlaud GJ, Villiers CL, Colomb MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "761607", "url": "https://glygen.org/publication/PubMed/761607" } ] }, { "title": "Functional dissection of the CD21/CD19/TAPA-1/Leu-13 complex of B lymphocytes.", "journal": "The Journal of experimental medicine", "date": "1993", "authors": "Matsumoto AK, Martin DR, Carter RH, Klickstein LB, Ahearn JM, Fearon DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "7690834", "url": "https://glygen.org/publication/PubMed/7690834" } ] }, { "title": "Interactions of soluble CD59 with the terminal complement complexes. CD59 and C9 compete for a nascent epitope on C8.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1993", "authors": "Lehto T, Meri S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "7691959", "url": "https://glygen.org/publication/PubMed/7691959" } ] }, { "title": "Molecular characterization of human TRPM-2/clusterin, a gene associated with sperm maturation, apoptosis and neurodegeneration.", "journal": "Eur. J. Biochem.", "date": "1994", "authors": "Wong P, Taillefer D, Lakins J, Pineault J, Chader G, Tenniswood M", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "8181474", "url": "https://glygen.org/publication/PubMed/8181474" } ] }, { "title": "Apolipoprotein J is associated with paraoxonase in human plasma.", "journal": "Biochemistry", "date": "1994", "authors": "Kelso GJ, Stuart WD, Richter RJ, Furlong CE, Jordan-Starck TC, Harmony JA", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "8292612", "url": "https://glygen.org/publication/PubMed/8292612" } ] }, { "title": "The cerebrospinal-fluid soluble form of Alzheimer's amyloid beta is complexed to SP-40,40 (apolipoprotein J), an inhibitor of the complement membrane-attack complex.", "journal": "Biochem. J.", "date": "1993", "authors": "Ghiso J, Matsubara E, Koudinov A, Choi-Miura N H, Tomita M, Wisniewski T, Frangione B", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "8328966", "url": "https://glygen.org/publication/PubMed/8328966" } ] }, { "title": "Clusterin, the human apolipoprotein and complement inhibitor, binds to complement C7, C8 beta, and the b domain of C9.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1993", "authors": "Tschopp J, Chonn A, Hertig S, French LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "8345200", "url": "https://glygen.org/publication/PubMed/8345200" } ] }, { "title": "Platelet alpha-granules.", "journal": "Blood reviews", "date": "1993", "authors": "Harrison P, Cramer EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-114608", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608" } ], "reference": [ { "type": "PubMed", "id": "8467233", "url": "https://glygen.org/publication/PubMed/8467233" } ] }, { "title": "Covalent binding properties of the human complement protein C4 and hydrolysis rate of the internal thioester upon activation.", "journal": "Protein science : a publication of the Protein Society", "date": "1993", "authors": "Sepp A, Dodds AW, Anderson MJ, Campbell RD, Willis AC, Law SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "8495193", "url": "https://glygen.org/publication/PubMed/8495193" } ] }, { "title": "Interaction of transforming growth factor beta receptors with apolipoprotein J/clusterin.", "journal": "Biochemistry", "date": "1996", "authors": "Reddy K B, Karode M C, Harmony A K, Howe P H", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "8555189", "url": "https://glygen.org/publication/PubMed/8555189" } ] }, { "title": "Localization of classical and alternative pathway regulatory activity within the decay-accelerating factor.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1996", "authors": "Brodbeck WG, Liu D, Sperry J, Mold C, Medof ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "8786315", "url": "https://glygen.org/publication/PubMed/8786315" } ] }, { "title": "Binding of human and rat CD59 to the terminal complement complexes.", "journal": "Immunology", "date": "1997", "authors": "Lehto T, Morgan BP, Meri S", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "9038722", "url": "https://glygen.org/publication/PubMed/9038722" } ] }, { "title": "Identification and characterization of glycosylation sites in human serum clusterin.", "journal": "Protein science : a publication of the Protein Society", "date": "1997", "authors": "Kapron JT, Hilliard GM, Lakins JN, Tenniswood MP, West KA, Carr SA, Crabb JW", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909#ptm_processing" }, { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "reference": [ { "type": "PubMed", "id": "9336835", "url": "https://glygen.org/publication/PubMed/9336835" } ] }, { "title": "Role of the bactericidal/permeability-increasing protein in host defence.", "journal": "Current opinion in immunology", "date": "1998", "authors": "Elsbach P, Weiss J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "9523110", "url": "https://glygen.org/publication/PubMed/9523110" } ] }, { "title": "The bactericidal/permeability-increasing protein (BPI) in antibacterial host defense.", "journal": "Journal of leukocyte biology", "date": "1998", "authors": "Elsbach P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "9665269", "url": "https://glygen.org/publication/PubMed/9665269" } ] }, { "title": "An antimicrobial activity of cytolytic T cells mediated by granulysin.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Stenger S, Hanson DA, Teitelbaum R, Dewan P, Niazi KR, Froelich CJ, Ganz T, Thoma-Uszynski S, Melian A, Bogdan C, Porcelli SA, Bloom BR, Krensky AM, Modlin RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803157", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157" } ], "reference": [ { "type": "PubMed", "id": "9756476", "url": "https://glygen.org/publication/PubMed/9756476" } ] }, { "title": "Alternative pathway of complement: recruitment of precursor properdin by the labile C3/C5 convertase and the potentiation of the pathway.", "journal": "The Journal of experimental medicine", "date": "1976", "authors": "Medicus RG, Gotze O, Muller-Eberhard HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-977606", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606" } ], "reference": [ { "type": "PubMed", "id": "978134", "url": "https://glygen.org/publication/PubMed/978134" } ] } ], "pathway": [ { "id": "hsa:1191", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1191", "resource": "KEGG Pathway" }, { "id": "R-HSA-114608", "name": "Platelet degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-114608", "resource": "Reactome", "description": "Platelet degranulation" }, { "id": "R-HSA-166665", "name": "Terminal pathway of complement", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-166665", "resource": "Reactome", "description": "Terminal pathway of complement" }, { "id": "R-HSA-6803157", "name": "Antimicrobial peptides", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803157", "resource": "Reactome", "description": "Antimicrobial peptides" }, { "id": "R-HSA-977606", "name": "Regulation of Complement cascade", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977606", "resource": "Reactome", "description": "Regulation of Complement cascade" } ], "orthologs": [ { "uniprot_canonical_ac": "P05371-1", "protein_name": "Clusterin", "gene_name": "Clu", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKILLLCVALLLTWDNGMVLGEQEFSDNELQELSTQGSRYVNKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEGALDDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFTRASGIIDTLFQDRFFTHEPQDIHHFSPMGFPHKRPHFLYPKSRLVRSLMPLSHYGPLSFHNMFQPFFDMIHQAQQAMDVQLHSPALQFPDVDFLKEGEDDPTVCKEIRHNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTQQYNELLHSLQSKMLNTSSLLEQLNDQFTWVSQLANLTQGDDQYLRVSTVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRME", "length": 447 }, "evidence": [ { "id": "45920213", "url": "http://www.informatics.jax.org/homology/45920213", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q06890-1", "protein_name": "Clusterin", "gene_name": "Clu", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKILLLCVALLLIWDNGMVLGEQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAE", "length": 448 }, "evidence": [ { "id": "45920213", "url": "http://www.informatics.jax.org/homology/45920213", "database": "MGI" }, { "id": "P10909", "url": "https://omabrowser.org/oma/group/P10909/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q29549-1", "protein_name": "Clusterin", "gene_name": "CLU", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MKTLLLLVGLLLTWENGPWVLGDKAISDKELQEMSTEGSKYVNKEIKNALKEVKQIKTLIEQSNEERKSLLSSLEEAKKKKEDALNDTRDTETKLKGSQGLCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGHQLEEFLNQSSPFYFWINGDRIDSLMENDRQQSHVMDIMEDSFNRASNIMDELFQDRFFNREPFDTQFFSPFGSSHRGSLFFNPKSRFARNIMPFPLFTDLNYHDMFQPFFDMIHQAQQAMDAHLHRIPYHFPEAGVPENSNDRAVCKEIRHNSTGCLRMKDQCEKCREILSVDCSASNSSQMQLRQELYTSLQMAEKFSKLYDQLLQSYQQKMLNTSSLLKQLNEQFSWVSQLANLTQNDDRYYLQVTTVNSHGSDPSVPSGLTKVVVKLFDSYPITLIIPQEVSDPKFMETVAEEALQQYRQRSREE", "length": 446 }, "evidence": [ { "id": "P10909", "url": "https://omabrowser.org/oma/group/P10909/", "database": "OMA" } ], "common_name": "Pig" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 24, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "mitochondrial membrane", "id": "GO:0031966", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031966", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "chromaffin granule", "id": "GO:0042583", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042583", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "mitochondrial inner membrane", "id": "GO:0005743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "platelet alpha granule lumen", "id": "GO:0031093", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031093", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "synapse", "id": "GO:0045202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045202", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "blood microparticle", "id": "GO:0072562", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072562", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "spherical high-density lipoprotein particle", "id": "GO:0034366", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034366", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "neurofibrillary tangle", "id": "GO:0097418", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097418", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "apical dendrite", "id": "GO:0097440", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097440", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "collagen-containing extracellular matrix", "id": "GO:0062023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062023", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "perinuclear endoplasmic reticulum lumen", "id": "GO:0099020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099020", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 43, "go_terms": [ { "name": "immune complex clearance", "id": "GO:0002434", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002434", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "microglial cell activation", "id": "GO:0001774", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001774", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "lipid metabolic process", "id": "GO:0006629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006629", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "regulation of cell population proliferation", "id": "GO:0042127", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042127", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "positive regulation of apoptotic process", "id": "GO:0043065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043065", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "positive regulation of nitric oxide biosynthetic process", "id": "GO:0045429", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045429", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "positive regulation of NF-kappaB transcription factor activity", "id": "GO:0051092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051092", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "positive regulation of amyloid-beta formation", "id": "GO:1902004", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902004", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage", "id": "GO:1902230", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902230", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "positive regulation of amyloid fibril formation", "id": "GO:1905908", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905908", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "negative regulation of amyloid-beta formation", "id": "GO:1902430", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902430", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "cell morphogenesis", "id": "GO:0000902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000902", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "negative regulation of neuron apoptotic process", "id": "GO:0043524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043524", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "response to virus", "id": "GO:0009615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009615", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "positive regulation of protein-containing complex assembly", "id": "GO:0031334", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031334", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "reverse cholesterol transport", "id": "GO:0043691", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043691", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "protein stabilization", "id": "GO:0050821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050821", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "positive regulation of tumor necrosis factor production", "id": "GO:0032760", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032760", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "release of cytochrome c from mitochondria", "id": "GO:0001836", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001836", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "negative regulation of protein-containing complex assembly", "id": "GO:0031333", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031333", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "regulation of apoptotic process", "id": "GO:0042981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042981", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "positive regulation of receptor-mediated endocytosis", "id": "GO:0048260", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048260", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "intrinsic apoptotic signaling pathway", "id": "GO:0097193", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097193", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "positive regulation of intrinsic apoptotic signaling pathway", "id": "GO:2001244", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001244", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "positive regulation of proteasomal ubiquitin-dependent protein catabolic process", "id": "GO:0032436", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032436", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "negative regulation of release of cytochrome c from mitochondria", "id": "GO:0090201", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090201", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "protein import", "id": "GO:0017038", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017038", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "regulation of amyloid-beta clearance", "id": "GO:1900221", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900221", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "positive regulation of neurofibrillary tangle assembly", "id": "GO:1902998", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902998", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "chaperone-mediated protein complex assembly", "id": "GO:0051131", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051131", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "complement activation, classical pathway", "id": "GO:0006958", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006958", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "chaperone-mediated protein folding", "id": "GO:0061077", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061077", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "complement activation", "id": "GO:0006956", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006956", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "positive regulation of ubiquitin-dependent protein catabolic process", "id": "GO:2000060", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000060", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "central nervous system myelin maintenance", "id": "GO:0032286", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032286", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "response to misfolded protein", "id": "GO:0051788", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051788", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "microglial cell proliferation", "id": "GO:0061518", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061518", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "protein targeting to lysosome involved in chaperone-mediated autophagy", "id": "GO:0061740", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061740", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "regulation of neuronal signal transduction", "id": "GO:1902847", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902847", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "negative regulation of response to endoplasmic reticulum stress", "id": "GO:1903573", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903573", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "negative regulation of amyloid fibril formation", "id": "GO:1905907", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905907", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 10, "go_terms": [ { "name": "signaling receptor binding", "id": "GO:0005102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005102", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "low-density lipoprotein particle receptor binding", "id": "GO:0050750", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050750", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "unfolded protein binding", "id": "GO:0051082", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051082", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "protein-folding chaperone binding", "id": "GO:0051087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051087", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "amyloid-beta binding", "id": "GO:0001540", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001540", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "ubiquitin protein ligase binding", "id": "GO:0031625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031625", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "protein-containing complex binding", "id": "GO:0044877", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044877", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "tau protein binding", "id": "GO:0048156", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048156", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "misfolded protein binding", "id": "GO:0051787", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051787", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" }, { "name": "protein carrier chaperone", "id": "GO:0140597", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140597", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "clusterin N-glycosylated 1 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-103 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P10909-1, Asn-103, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054795", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054795" } ] }, { "name": "clusterin N-glycosylated 2 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-103 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G12341GU. Example: UniProtKB:P10909-1, Asn-103, MOD:00160~GNO:G12341GU. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054796", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054796" } ] }, { "name": "clusterin N-glycosylated 3 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-145 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G60923RB. Example: UniProtKB:P10909-1, Asn-145, MOD:00160~GNO:G60923RB. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054797", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054797" } ] }, { "name": "clusterin N-glycosylated 4 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-291 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P10909-1, Asn-291, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054798", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054798" } ] }, { "name": "clusterin N-glycosylated 5 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-354 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G28096RS. Example: UniProtKB:P10909-1, Asn-354, MOD:00160~GNO:G28096RS. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054799", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054799" } ] }, { "name": "clusterin N-glycosylated 6 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-354 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G35235RT. Example: UniProtKB:P10909-1, Asn-354, MOD:00160~GNO:G35235RT. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054800", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054800" } ] }, { "name": "clusterin N-glycosylated 7 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-354 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P10909-1, Asn-354, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054801", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054801" } ] }, { "name": "clusterin N-glycosylated 8 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-354 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G86752LQ. Example: UniProtKB:P10909-1, Asn-354, MOD:00160~GNO:G86752LQ. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054802", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054802" } ] }, { "name": "clusterin N-glycosylated 9 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054803", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054803" } ] }, { "name": "clusterin N-glycosylated 10 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G03596YS. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G03596YS. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054804", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054804" } ] }, { "name": "clusterin N-glycosylated 11 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G04784US. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G04784US. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054805", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054805" } ] }, { "name": "clusterin N-glycosylated 12 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G06247RL. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G06247RL. [PRO:DNx, PMID:26791533, PMID:29671580]", "evidence": [ { "id": "PR:000054806", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054806" } ] }, { "name": "clusterin N-glycosylated 13 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G08293MJ. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G08293MJ. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054807", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054807" } ] }, { "name": "clusterin N-glycosylated 14 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan structure is represented by GlyTouCan:G22140GZ. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G22140GZ. [PRO:DNx, PMID:19838169]", "evidence": [ { "id": "PR:000054808", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054808" } ] }, { "name": "clusterin N-glycosylated 15 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G22589VJ. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G22589VJ. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054809", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054809" } ] }, { "name": "clusterin N-glycosylated 16 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G26271XI. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G26271XI. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054810", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054810" } ] }, { "name": "clusterin N-glycosylated 17 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G27947YN. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G27947YN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054811", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054811" } ] }, { "name": "clusterin N-glycosylated 18 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G38398KX. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G38398KX. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054812", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054812" } ] }, { "name": "clusterin N-glycosylated 19 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G39689FZ. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G39689FZ. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054813", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054813" } ] }, { "name": "clusterin N-glycosylated 20 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G40926MX. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G40926MX. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054814", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054814" } ] }, { "name": "clusterin N-glycosylated 21 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G41126SR. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G41126SR. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054815", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054815" } ] }, { "name": "clusterin N-glycosylated 22 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan structure is represented by GlyTouCan:G42358LZ. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G42358LZ. [PRO:DNx, PMID:24279413]", "evidence": [ { "id": "PR:000054816", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054816" } ] }, { "name": "clusterin N-glycosylated 23 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G44211QA. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G44211QA. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054817", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054817" } ] }, { "name": "clusterin N-glycosylated 24 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G46823ME. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G46823ME. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054818", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054818" } ] }, { "name": "clusterin N-glycosylated 25 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G47737VJ. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G47737VJ. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054819", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054819" } ] }, { "name": "clusterin N-glycosylated 26 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G57220OY. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G57220OY. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054820", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054820" } ] }, { "name": "clusterin N-glycosylated 27 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054821", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054821" } ] }, { "name": "clusterin N-glycosylated 28 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G60923RB. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G60923RB. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054822", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054822" } ] }, { "name": "clusterin N-glycosylated 29 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G66933CM. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G66933CM. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054823", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054823" } ] }, { "name": "clusterin N-glycosylated 30 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G73918EY. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G73918EY. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054824", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054824" } ] }, { "name": "clusterin N-glycosylated 31 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G78811TO. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G78811TO. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054825", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054825" } ] }, { "name": "clusterin N-glycosylated 32 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G79635DB. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G79635DB. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054826", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054826" } ] }, { "name": "clusterin N-glycosylated 33 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G81128KB. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G81128KB. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054827", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054827" } ] }, { "name": "clusterin N-glycosylated 34 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G83555HU. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G83555HU. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054828", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054828" } ] }, { "name": "clusterin N-glycosylated 35 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G85144OK. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G85144OK. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000054829", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054829" } ] }, { "name": "clusterin N-glycosylated 36 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G87051GH. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G87051GH. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054830", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054830" } ] }, { "name": "clusterin N-glycosylated 37 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G87875QF. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G87875QF. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054831", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054831" } ] }, { "name": "clusterin N-glycosylated 38 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:26791533, PMID:29671580]", "evidence": [ { "id": "PR:000054832", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054832" } ] }, { "name": "clusterin N-glycosylated 39 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G91158SA. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G91158SA. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054833", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054833" } ] }, { "name": "clusterin N-glycosylated 40 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G92597CK. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G92597CK. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054834", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054834" } ] }, { "name": "clusterin N-glycosylated 41 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-374 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G94917XT. Example: UniProtKB:P10909-1, Asn-374, MOD:00160~GNO:G94917XT. [PRO:DNx, PMID:26791533, PMID:29671580]", "evidence": [ { "id": "PR:000054835", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054835" } ] }, { "name": "clusterin N-glycosylated 42 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-86 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G06247RL. Example: UniProtKB:P10909-1, Asn-86, MOD:00160~GNO:G06247RL. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054836", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054836" } ] }, { "name": "clusterin N-glycosylated 43 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-86 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G26271XI. Example: UniProtKB:P10909-1, Asn-86, MOD:00160~GNO:G26271XI. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054837", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054837" } ] }, { "name": "clusterin N-glycosylated 44 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-86 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G39689FZ. Example: UniProtKB:P10909-1, Asn-86, MOD:00160~GNO:G39689FZ. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054838", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054838" } ] }, { "name": "clusterin N-glycosylated 45 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-86 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G43769HG. Example: UniProtKB:P10909-1, Asn-86, MOD:00160~GNO:G43769HG. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000054839", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054839" } ] }, { "name": "clusterin N-glycosylated 46 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-86 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G78811TO. Example: UniProtKB:P10909-1, Asn-86, MOD:00160~GNO:G78811TO. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054840", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054840" } ] }, { "name": "clusterin N-glycosylated 47 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-86 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G91158SA. Example: UniProtKB:P10909-1, Asn-86, MOD:00160~GNO:G91158SA. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054841", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054841" } ] }, { "name": "clusterin N-glycosylated 48 (human)", "definition": "A clusterin (human) that has been N-glycosylated at the residue equivalent to Asn-86 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G94917XT. Example: UniProtKB:P10909-1, Asn-86, MOD:00160~GNO:G94917XT. [PRO:DNx, PMID:26791533]", "evidence": [ { "id": "PR:000054842", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054842" } ] }, { "name": "clusterin O-glycosylated 1 (human)", "definition": "A clusterin (human) that has been O-glycosylated at the residue equivalent to Ser-396 of the amino acid sequence represented by UniProtKB:P10909-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P10909-1, Ser-396, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000054843", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054843" } ] } ], "site_annotation": [ { "start_pos": 103, "end_pos": 105, "annotation": "n_glycosylation_sequon" }, { "start_pos": 145, "end_pos": 147, "annotation": "n_glycosylation_sequon" }, { "start_pos": 291, "end_pos": 293, "annotation": "n_glycosylation_sequon" }, { "start_pos": 354, "end_pos": 356, "annotation": "n_glycosylation_sequon" }, { "start_pos": 374, "end_pos": 376, "annotation": "n_glycosylation_sequon" }, { "start_pos": 86, "end_pos": 88, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Extensively glycosylated with sulfated N-linked carbohydrates (PubMed:17260971, PubMed:2387851). About 30% of the protein mass is comprised of complex N-linked carbohydrate (PubMed:2387851). Endoplasmic reticulum (ER) stress induces changes in glycosylation status and increases level of hypoglycosylated forms (PubMed:22689054). Core carbohydrates are essential for chaperone activity (PubMed:25402950). Non-secreted forms are hypoglycosylated or unglycosylated (PubMed:24073260).", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" }, { "database": "PubMed", "id": "17260971", "url": "https://glygen.org/publication/PubMed/17260971" }, { "database": "PubMed", "id": "25402950", "url": "https://glygen.org/publication/PubMed/25402950" }, { "database": "PubMed", "id": "22689054", "url": "https://glygen.org/publication/PubMed/22689054" }, { "database": "PubMed", "id": "24073260", "url": "https://glygen.org/publication/PubMed/24073260" }, { "database": "PubMed", "id": "2387851", "url": "https://glygen.org/publication/PubMed/2387851" } ] }, { "annotation": "Polyubiquitinated, leading to proteasomal degradation (PubMed:17451556, PubMed:19137541). Under cellular stress, the intracellular level of cleaved form is reduced due to proteasomal degradation (PubMed:17451556).", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" }, { "database": "PubMed", "id": "17451556", "url": "https://glygen.org/publication/PubMed/17451556" }, { "database": "PubMed", "id": "19137541", "url": "https://glygen.org/publication/PubMed/19137541" } ] }, { "annotation": "Proteolytically cleaved on its way through the secretory system, probably within the Golgi lumen (PubMed:2387851). Proteolytic cleavage is not necessary for its chaperone activity (PubMed:25402950). All non-secreted forms are not proteolytically cleaved (PubMed:24073260). Chaperone activity of uncleaved forms is dependent on a non-reducing environment (PubMed:25402950).", "evidence": [ { "database": "UniProtKB", "id": "P10909", "url": "https://www.uniprot.org/uniprot/P10909" }, { "database": "PubMed", "id": "25402950", "url": "https://glygen.org/publication/PubMed/25402950" }, { "database": "PubMed", "id": "24073260", "url": "https://glygen.org/publication/PubMed/24073260" }, { "database": "PubMed", "id": "2387851", "url": "https://glygen.org/publication/PubMed/2387851" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 86, 103, 145, 155, 239, 291, 354, 374 ], "o_linked_sites": [ 199, 210, 376, 386, 387, 396 ], "snv_sites": [ 86, 91, 105, 145, 210, 293, 328, 356, 376, 396 ], "glycation_sites": [], "phosphorylation_sites": [ 133, 393, 394, 396 ], "sequon_annotation_sites": [ { "start_pos": 103, "end_pos": 105 }, { "start_pos": 145, "end_pos": 147 }, { "start_pos": 291, "end_pos": 293 }, { "start_pos": 354, "end_pos": 356 }, { "start_pos": 374, "end_pos": 376 }, { "start_pos": 86, "end_pos": 88 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 365 }, { "field": "total_sites", "count": 12 }, { "field": "n_linked_glycans", "count": 158 }, { "field": "n_linked_glycan_sites", "count": 14 }, { "field": "o_linked_glycans", "count": 3 }, { "field": "o_linked_glycan_sites", "count": 4 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 8 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 357 }, { "field": "total_sites", "count": 10 }, { "field": "n_linked_glycans", "count": 158 }, { "field": "n_linked_glycan_sites", "count": 6 }, { "field": "o_linked_glycans", "count": 3 }, { "field": "o_linked_glycan_sites", "count": 4 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 13 }, { "field": "total_sites", "count": 10 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 13 }, { "field": "total_sites", "count": 10 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 186 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }