{ "uniprot_canonical_ac": "P10747-1", "uniprot_ac": "P10747", "uniprot_id": "CD28_HUMAN", "mass": { "chemical_mass": 25066.0, "monoisotopic_mass": 25066.0 }, "refseq": { "ac": "NP_001230006", "name": "T-cell-specific surface glycoprotein CD28 isoform 2 precursor", "summary": "The protein encoded by this gene is essential for T-cell proliferation and survival, cytokine production, and T-helper type-2 development. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2011].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230006" }, "gene_names": [ { "name": "CD28", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P10747", "id": "P10747" }, { "name": "CD28", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230006", "id": "NP_001230006" }, { "name": "Tp44", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230006", "id": "NP_001230006" } ], "protein_names": [ { "name": "T-cell-specific surface glycoprotein CD28", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P10747" }, { "name": "T-cell-specific surface glycoprotein CD28 isoform 2 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230006", "id": "NP_001230006" }, { "name": "TP44", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10747" } ], "function": [ { "annotation": "C-Kit signaling potentiates CAR T cell efficacy in solid tumors by CD28- and IL-2-independent co-stimulation.", "evidence": [ { "database": "RefSeq", "id": "NP_001230006", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230006" }, { "database": "PubMed", "id": "37336986", "url": "https://glygen.org/publication/PubMed/37336986" } ] }, { "annotation": "Genome-Wide Meta-Analysis Identifies Multiple Novel Rare Variants to Predict Common Human Infectious Diseases Risk. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001230006", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230006" }, { "database": "PubMed", "id": "37108169", "url": "https://glygen.org/publication/PubMed/37108169" } ] }, { "annotation": "Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. Enhances the production of IL4 and IL10 in T-cells in conjunction with TCR/CD3 ligation and CD40L costimulation (PubMed:8617933). Isoform 3 enhances CD40L-mediated activation of NF-kappa-B and kinases MAPK8 and PAK2 in T-cells (PubMed:15067037).", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747#function" }, { "database": "PubMed", "id": "8617933", "url": "https://glygen.org/publication/PubMed/8617933" }, { "database": "PubMed", "id": "15067037", "url": "https://glygen.org/publication/PubMed/15067037" } ] }, { "annotation": "Kidney allograft rejection is associated with an imbalance of B cells, regulatory T cells and differentiated CD28-CD8+ T cells: analysis of a cohort of 1095 graft biopsies. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001230006", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230006" }, { "database": "PubMed", "id": "37168864", "url": "https://glygen.org/publication/PubMed/37168864" } ] }, { "annotation": "Recent advancements in the B7/CD28 immune checkpoint families: new biology and clinical therapeutic strategies. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_001230006", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230006" }, { "database": "PubMed", "id": "37069229", "url": "https://glygen.org/publication/PubMed/37069229" } ] }, { "annotation": "The protein encoded by this gene is essential for T-cell proliferation and survival, cytokine production, and T-helper type-2 development. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2011].", "evidence": [ { "database": "RefSeq", "id": "NP_001230006", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230006" } ] }, { "annotation": "[Clinical Analysis of Pediatric Acute Leukemia Complicated with Septic Shock].", "evidence": [ { "database": "RefSeq", "id": "NP_001230006", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230006" }, { "database": "PubMed", "id": "36476893", "url": "https://glygen.org/publication/PubMed/36476893" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "P10747", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10747" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 107, "end_pos": 107, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NQT->NQK).", "chr_id": "2", "chr_pos": "203726900", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "T107", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P10747", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10747" } ], "glycoeffect": [], "start_pos": 198, "end_pos": 198, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "H", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "2", "chr_pos": "203734842", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R198", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "P10747", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10747" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 92, "end_pos": 92, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NES->SES).", "chr_id": "2", "chr_pos": "203726855", "ref_nt": "A", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "N92", "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "49.05", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000178562", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178562" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "53.49", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000178562", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178562" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "56.4", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000178562", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178562" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000178562", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178562" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "61.14", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000178562", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178562" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "71.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000178562", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178562" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000178562", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178562" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "47.38", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000178562", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178562" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "49.47", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000178562", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178562" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000178562", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178562" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "49.5", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000178562", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178562" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "49.44", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000178562", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178562" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "60.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000178562", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178562" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P10747", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10747" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P10747", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10747" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P10747", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10747" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P10747", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10747" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P10747", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10747" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P10747", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10747" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P10747", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10747" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P10747", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10747" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P10747", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10747" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P10747", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10747" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P10747", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10747" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P10747", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10747" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "common_name": "Human" } ], "gene": [ { "name": "CD28", "url": "https://www.uniprot.org/uniprot/P10747", "locus": { "chromosome": "2", "start_pos": 203738912, "end_pos": 203706475, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000178562", "url": "https://www.ensembl.org/id/ENSG00000178562" } ] } } ], "crossref": [ { "id": "ENSG00000178562", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178562", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P10747", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10747", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd20925", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20925", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL5191", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL5191", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "CD28", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CD28", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "940", "url": "https://www.ncbi.nlm.nih.gov/gene/940", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1653", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=1653", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P10747", "url": "https://www.ebi.ac.uk/intact/interactors/id:P10747*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR008093", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008093", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040216", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040216", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:940", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:940", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "186760", "url": "http://www.omim.org/entry/186760", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P10747", "url": "https://www.nextprot.org/entry/NX_P10747", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "YSHQLQF", "url": "https://omabrowser.org/oma/group/YSHQLQF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4108912at2759", "url": "http://www.orthodb.org/?query=4108912at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11494", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11494", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11494:SF7", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11494:SF7", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1YJD", "url": "https://www.rcsb.org/structure/1YJD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3WA4", "url": "https://www.rcsb.org/structure/3WA4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5AUL", "url": "https://www.rcsb.org/structure/5AUL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5GJH", "url": "https://www.rcsb.org/structure/5GJH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5GJI", "url": "https://www.rcsb.org/structure/5GJI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6O8D", "url": "https://www.rcsb.org/structure/6O8D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PPN", "url": "https://www.rcsb.org/structure/7PPN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7VU5", "url": "https://www.rcsb.org/structure/7VU5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF15910", "url": "http://pfam.xfam.org/family/PF15910", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P10747", "url": "https://pharos.nih.gov/targets/P10747", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P10747", "url": "http://purl.obolibrary.org/obo/PR_P10747", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-164939", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-164939", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-389356", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389356", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-389357", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389357", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-389359", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389359", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6811558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811558", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001230006", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230006", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10747-1", "url": "https://www.uniprot.org/uniprot/P10747-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10747-2", "url": "https://www.uniprot.org/uniprot/P10747-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10747-3", "url": "https://www.uniprot.org/uniprot/P10747-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10747-4", "url": "https://www.uniprot.org/uniprot/P10747-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10747-5", "url": "https://www.uniprot.org/uniprot/P10747-5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10747-6", "url": "https://www.uniprot.org/uniprot/P10747-6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10747-7", "url": "https://www.uniprot.org/uniprot/P10747-7", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS", "length": 220, "header": "sp|P10747-1|CD28_HUMAN Isoform 1 of T-cell-specific surface glycoprotein CD28 OS=Homo sapiens OX=9606 GN=CD28 PE=1 SV=1 CANONICAL=P10747-1" }, "isoforms": [ { "isoform_ac": "P10747-1", "url": "", "sequence": { "sequence": "MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS", "length": 220, "header": "sp|P10747-1|CD28_HUMAN Isoform 1 of T-cell-specific surface glycoprotein CD28 OS=Homo sapiens OX=9606 GN=CD28 PE=1 SV=1 CANONICAL=P10747-1" }, "locus": { "chromosome": "2", "start_pos": 203734909, "end_pos": 203706697, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000324106.9", "url": "https://www.ensembl.org/id/ENST00000324106.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000324890.7", "url": "https://www.ensembl.org/id/ENSP00000324890.7" } ] } }, { "isoform_ac": "P10747-2", "url": "", "sequence": { "sequence": "MLRLLLALNLFPSIQVTGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS", "length": 101, "header": "sp|P10747-2|CD28_HUMAN Isoform 2 of T-cell-specific surface glycoprotein CD28 OS=Homo sapiens OX=9606 GN=CD28 PE=1 SV=1 CANONICAL=P10747-1" }, "locus": { "chromosome": "2", "start_pos": 203734909, "end_pos": 203706697, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000374481.7", "url": "https://www.ensembl.org/id/ENST00000374481.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000363605.4", "url": "https://www.ensembl.org/id/ENSP00000363605.4" } ] } }, { "isoform_ac": "P10747-3", "url": "", "sequence": { "sequence": "MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSYNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS", "length": 136, "header": "sp|P10747-3|CD28_HUMAN Isoform 3 of T-cell-specific surface glycoprotein CD28 OS=Homo sapiens OX=9606 GN=CD28 PE=1 SV=1 CANONICAL=P10747-1" }, "locus": {} }, { "isoform_ac": "P10747-4", "url": "", "sequence": { "sequence": "MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSWKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS", "length": 123, "header": "sp|P10747-4|CD28_HUMAN Isoform 4 of T-cell-specific surface glycoprotein CD28 OS=Homo sapiens OX=9606 GN=CD28 PE=1 SV=1 CANONICAL=P10747-1" }, "locus": {} }, { "isoform_ac": "P10747-5", "url": "", "sequence": { "sequence": "MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSYNEKSNGTIIHVKGEE", "length": 55, "header": "sp|P10747-5|CD28_HUMAN Isoform 5 of T-cell-specific surface glycoprotein CD28 OS=Homo sapiens OX=9606 GN=CD28 PE=1 SV=1 CANONICAL=P10747-1" }, "locus": {} }, { "isoform_ac": "P10747-6", "url": "", "sequence": { "sequence": "MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSYNEKSNGTIIHVKGKHLCPSPLFPGPSKPYAPPRDFAAYRS", "length": 80, "header": "sp|P10747-6|CD28_HUMAN Isoform 6 of T-cell-specific surface glycoprotein CD28 OS=Homo sapiens OX=9606 GN=CD28 PE=1 SV=1 CANONICAL=P10747-1" }, "locus": {} }, { "isoform_ac": "P10747-7", "url": "", "sequence": { "sequence": "MPCGLSALIMCPKGMVAVVVAVDDGDSQALAGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS", "length": 234, "header": "sp|P10747-7|CD28_HUMAN Isoform 7 of T-cell-specific surface glycoprotein CD28 OS=Homo sapiens OX=9606 GN=CD28 PE=1 SV=1 CANONICAL=P10747-1" }, "locus": { "chromosome": "2", "start_pos": 203734909, "end_pos": 203706524, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000458610.6", "url": "https://www.ensembl.org/id/ENST00000458610.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000393648.2", "url": "https://www.ensembl.org/id/ENSP00000393648.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 105, "start_aa": "Asn", "end_pos": 105, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn105", "evidence": [ { "id": "P10747", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10747#ptm_processing" }, { "id": "15696168", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15696168" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 129, "start_aa": "Asn", "end_pos": 129, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn129", "evidence": [ { "id": "P10747", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10747#ptm_processing" }, { "id": "19349973", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19349973" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 37, "start_aa": "Asn", "end_pos": 37, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn37", "evidence": [ { "id": "P10747", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10747#ptm_processing" }, { "id": "15696168", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15696168" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 71, "start_aa": "Asn", "end_pos": 71, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn71", "evidence": [ { "id": "P10747", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10747#ptm_processing" }, { "id": "19349973", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19349973" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 92, "start_aa": "Asn", "end_pos": 92, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn92", "evidence": [ { "id": "P10747", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10747#ptm_processing" } ] } ], "phosphorylation": [ { "start_pos": 189, "end_pos": 189, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "P10747", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747" }, { "database": "PubMed", "id": "19901323", "url": "https://glygen.org/publication/PubMed/19901323" } ], "site_lbl": "Ser189" }, { "start_pos": 191, "end_pos": 191, "kinase_uniprot_canonical_ac": "P06239-1", "kinase_gene_name": "LCK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10747", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747" }, { "database": "PubMed", "id": "7568038", "url": "https://glygen.org/publication/PubMed/7568038" }, { "database": "phospho.ELM", "id": "P10747", "url": "http://phospho.elm.eu.org/byAccession/P10747.html" }, { "database": "PubMed", "id": "8992971", "url": "https://glygen.org/publication/PubMed/8992971" }, { "database": "PubMed", "id": "22936936", "url": "https://glygen.org/publication/PubMed/22936936" } ], "site_lbl": "Tyr191" }, { "start_pos": 191, "end_pos": 191, "kinase_uniprot_canonical_ac": "P06241-1", "kinase_gene_name": "FYN", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10747", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747" }, { "database": "PubMed", "id": "7568038", "url": "https://glygen.org/publication/PubMed/7568038" } ], "site_lbl": "Tyr191" }, { "start_pos": 191, "end_pos": 191, "kinase_uniprot_canonical_ac": "Q08881-1", "kinase_gene_name": "ITK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10747", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747" }, { "database": "PubMed", "id": "19901323", "url": "https://glygen.org/publication/PubMed/19901323" }, { "database": "PubMed", "id": "8992971", "url": "https://glygen.org/publication/PubMed/8992971" }, { "database": "phospho.ELM", "id": "P10747", "url": "http://phospho.elm.eu.org/byAccession/P10747.html" }, { "database": "PubMed", "id": "22936936", "url": "https://glygen.org/publication/PubMed/22936936" } ], "site_lbl": "Tyr191" }, { "start_pos": 191, "end_pos": 191, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "IntAct", "id": "P10747", "url": "https://www.ebi.ac.uk/intact/interactors/id:P10747*" }, { "database": "iPTMnet", "id": "P10747", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747" }, { "database": "PubMed", "id": "10820259", "url": "https://glygen.org/publication/PubMed/10820259" }, { "database": "PubMed", "id": "7568038", "url": "https://glygen.org/publication/PubMed/7568038" }, { "database": "PubMed", "id": "7584133", "url": "https://glygen.org/publication/PubMed/7584133" }, { "database": "PubMed", "id": "7807015", "url": "https://glygen.org/publication/PubMed/7807015" }, { "database": "PubMed", "id": "8146197", "url": "https://glygen.org/publication/PubMed/8146197" }, { "database": "PubMed", "id": "8183372", "url": "https://glygen.org/publication/PubMed/8183372" }, { "database": "PubMed", "id": "9417079", "url": "https://glygen.org/publication/PubMed/9417079" }, { "database": "PubMed", "id": "8621607", "url": "https://glygen.org/publication/PubMed/8621607" }, { "database": "phospho.ELM", "id": "P10747", "url": "http://phospho.elm.eu.org/byAccession/P10747.html" }, { "database": "PubMed", "id": "16094384", "url": "https://glygen.org/publication/PubMed/16094384" }, { "database": "PRO", "id": "P10747", "url": "http://purl.obolibrary.org/obo/P10747" }, { "database": "PubMed", "id": "8992971", "url": "https://glygen.org/publication/PubMed/8992971" } ], "site_lbl": "Tyr191" }, { "start_pos": 206, "end_pos": 206, "kinase_uniprot_canonical_ac": "Q08881-1", "kinase_gene_name": "ITK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10747", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747" }, { "database": "PubMed", "id": "8992971", "url": "https://glygen.org/publication/PubMed/8992971" } ], "site_lbl": "Tyr206" }, { "start_pos": 206, "end_pos": 206, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P10747", "url": "http://phospho.elm.eu.org/byAccession/P10747.html" }, { "database": "iPTMnet", "id": "P10747", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747" }, { "database": "PubMed", "id": "8946678", "url": "https://glygen.org/publication/PubMed/8946678" }, { "database": "PubMed", "id": "8992971", "url": "https://glygen.org/publication/PubMed/8992971" }, { "database": "PubMed", "id": "30197180", "url": "https://glygen.org/publication/PubMed/30197180" } ], "site_lbl": "Tyr206" }, { "start_pos": 209, "end_pos": 209, "kinase_uniprot_canonical_ac": "Q08881-1", "kinase_gene_name": "ITK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10747", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747" }, { "database": "PubMed", "id": "15144186", "url": "https://glygen.org/publication/PubMed/15144186" }, { "database": "PubMed", "id": "19901323", "url": "https://glygen.org/publication/PubMed/19901323" }, { "database": "PubMed", "id": "8992971", "url": "https://glygen.org/publication/PubMed/8992971" }, { "database": "phospho.ELM", "id": "P10747", "url": "http://phospho.elm.eu.org/byAccession/P10747.html" }, { "database": "PubMed", "id": "22936936", "url": "https://glygen.org/publication/PubMed/22936936" } ], "site_lbl": "Tyr209" }, { "start_pos": 209, "end_pos": 209, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" }, { "database": "PubMed", "id": "15144186", "url": "https://glygen.org/publication/PubMed/15144186" }, { "database": "phospho.ELM", "id": "P10747", "url": "http://phospho.elm.eu.org/byAccession/P10747.html" }, { "database": "iPTMnet", "id": "P10747", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747" }, { "database": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" }, { "database": "PubMed", "id": "16094384", "url": "https://glygen.org/publication/PubMed/16094384" }, { "database": "PubMed", "id": "8946678", "url": "https://glygen.org/publication/PubMed/8946678" }, { "database": "PubMed", "id": "30197180", "url": "https://glygen.org/publication/PubMed/30197180" } ], "site_lbl": "Tyr209" }, { "start_pos": 218, "end_pos": 218, "kinase_uniprot_canonical_ac": "Q08881-1", "kinase_gene_name": "ITK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10747", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747" }, { "database": "PubMed", "id": "15144186", "url": "https://glygen.org/publication/PubMed/15144186" }, { "database": "PubMed", "id": "8992971", "url": "https://glygen.org/publication/PubMed/8992971" }, { "database": "phospho.ELM", "id": "P10747", "url": "http://phospho.elm.eu.org/byAccession/P10747.html" } ], "site_lbl": "Tyr218" }, { "start_pos": 218, "end_pos": 218, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P10747", "url": "http://phospho.elm.eu.org/byAccession/P10747.html" }, { "database": "iPTMnet", "id": "P10747", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747" }, { "database": "PubMed", "id": "8946678", "url": "https://glygen.org/publication/PubMed/8946678" } ], "site_lbl": "Tyr218" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported", "glycoprotein_predicted" ], "publication": [ { "title": "Activation of serum- and glucocorticoid-regulated protein kinase by agonists that activate phosphatidylinositide 3-kinase is mediated by 3-phosphoinositide-dependent protein kinase-1 (PDK1) and PDK2.", "journal": "The Biochemical journal", "date": "1999", "authors": "Kobayashi T, Cohen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "10191262", "url": "https://glygen.org/publication/PubMed/10191262" } ] }, { "title": "GRID: a novel Grb-2-related adapter protein that interacts with the activated T cell costimulatory receptor CD28.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2000", "authors": "Ellis JH, Ashman C, Burden MN, Kilpatrick KE, Morse MA, Hamblin PA", "evidence": [ { "database": "iPTMnet", "id": "P10747", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747" } ], "reference": [ { "type": "PubMed", "id": "10820259", "url": "https://glygen.org/publication/PubMed/10820259" } ] }, { "title": "Tyrosine-phosphorylated Vav1 as a point of integration for T-cell receptor- and CD28-mediated activation of JNK, p38, and interleukin-2 transcription.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Hehner SP, Hofmann TG, Dienz O, Droge W, Schmitz ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-389359", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389359" } ], "reference": [ { "type": "PubMed", "id": "10849438", "url": "https://glygen.org/publication/PubMed/10849438" } ] }, { "title": "Mechanism for down-regulation of CD28 by Nef.", "journal": "The EMBO journal", "date": "2001", "authors": "Swigut T, Shohdy N, Skowronski J", "evidence": [ { "database": "Reactome", "id": "R-HSA-164939", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-164939" } ], "reference": [ { "type": "PubMed", "id": "11285224", "url": "https://glygen.org/publication/PubMed/11285224" } ] }, { "title": "Assembly and annotation of human chromosome 2q33 sequence containing the CD28, CTLA4, and ICOS gene cluster: analysis by computational, comparative, and microarray approaches.", "journal": "Genomics", "date": "2001", "authors": "Ling V, Wu P W, Finnerty H F, Agostino M J, Graham J R, Chen S, Jussiff J M, Fisk G J, Miller C P, Collins M", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "reference": [ { "type": "PubMed", "id": "11735222", "url": "https://glygen.org/publication/PubMed/11735222" } ] }, { "title": "Rac1 and RhoG promote cell survival by the activation of PI3K and Akt, independently of their ability to stimulate JNK and NF-kappaB.", "journal": "Oncogene", "date": "2002", "authors": "Murga C, Zohar M, Teramoto H, Gutkind JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "11803464", "url": "https://glygen.org/publication/PubMed/11803464" } ] }, { "title": "A novel costimulatory signaling in human T lymphocytes by a splice variant of CD28.", "journal": "Blood", "date": "2002", "authors": "Hanawa Haruo, Ma Yong, Mikolajczak Sebastian A, Charles Matthew L, Yoshida Tetsuya, Yoshida Ryoko, Strathdee Craig A, Litchfield David W, Ochi Atsuo", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "reference": [ { "type": "PubMed", "id": "11877290", "url": "https://glygen.org/publication/PubMed/11877290" } ] }, { "title": "A novel CD28 mRNA variant and simultaneous presence of various CD28 mRNA isoforms in human T lymphocytes.", "journal": "Hum. Immunol.", "date": "2002", "authors": "Deshpande Manisha, Venuprasad K, Parab Pradeep B, Saha Bhaskar, Mitra Debashis", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "reference": [ { "type": "PubMed", "id": "11916166", "url": "https://glygen.org/publication/PubMed/11916166" } ] }, { "title": "Akt-dependent phosphorylation specifically regulates Cot induction of NF-kappa B-dependent transcription.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Kane LP, Mollenauer MN, Xu Z, Turck CW, Weiss A", "evidence": [ { "database": "Reactome", "id": "R-HSA-389357", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389357" } ], "reference": [ { "type": "PubMed", "id": "12138205", "url": "https://glygen.org/publication/PubMed/12138205" } ] }, { "title": "Multiple phosphoinositide 3-kinase-dependent steps in activation of protein kinase B.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Scheid MP, Marignani PA, Woodgett JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "12167717", "url": "https://glygen.org/publication/PubMed/12167717" } ] }, { "title": "The role of PI3K in immune cells.", "journal": "Nature immunology", "date": "2003", "authors": "Koyasu S", "evidence": [ { "database": "Reactome", "id": "R-HSA-389357", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389357" } ], "reference": [ { "type": "PubMed", "id": "12660731", "url": "https://glygen.org/publication/PubMed/12660731" } ] }, { "title": "The PI-3 kinase/Akt pathway and T cell activation: pleiotropic pathways downstream of PIP3.", "journal": "Immunological reviews", "date": "2003", "authors": "Kane LP, Weiss A", "evidence": [ { "database": "Reactome", "id": "R-HSA-389357", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389357" } ], "reference": [ { "type": "PubMed", "id": "12670391", "url": "https://glygen.org/publication/PubMed/12670391" } ] }, { "title": "Vav1: a key signal transducer downstream of the TCR.", "journal": "Immunological reviews", "date": "2003", "authors": "Tybulewicz VL, Ardouin L, Prisco A, Reynolds LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-389359", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389359" } ], "reference": [ { "type": "PubMed", "id": "12670394", "url": "https://glygen.org/publication/PubMed/12670394" } ] }, { "title": "Threonine 308 phosphorylated form of Akt translocates to the nucleus of PC12 cells under nerve growth factor stimulation and associates with the nuclear matrix protein nucleolin.", "journal": "Journal of cellular physiology", "date": "2003", "authors": "Borgatti P, Martelli AM, Tabellini G, Bellacosa A, Capitani S, Neri LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "12767043", "url": "https://glygen.org/publication/PubMed/12767043" } ] }, { "title": "Regulation of protein serine-threonine phosphatase type-2A by tyrosine phosphorylation.", "journal": "Science (New York, N.Y.)", "date": "1992", "authors": "Chen J, Martin BL, Brautigan DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811558" } ], "reference": [ { "type": "PubMed", "id": "1325671", "url": "https://glygen.org/publication/PubMed/1325671" } ] }, { "title": "The modulation of CD40 ligand signaling by transmembrane CD28 splice variant in human T cells.", "journal": "The Journal of experimental medicine", "date": "2004", "authors": "Mikolajczak SA, Ma BY, Yoshida T, Yoshida R, Kelvin DJ, Ochi A", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "reference": [ { "type": "PubMed", "id": "15067037", "url": "https://glygen.org/publication/PubMed/15067037" } ] }, { "title": "Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.", "journal": "Analytical chemistry", "date": "2004", "authors": "Brill LM, Salomon AR, Ficarro SB, Mukherji M, Stettler-Gill M, Peters EC", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" }, { "database": "iPTMnet", "id": "P10747-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747-1" } ], "reference": [ { "type": "PubMed", "id": "15144186", "url": "https://glygen.org/publication/PubMed/15144186" } ] }, { "title": "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.", "journal": "Nature biotechnology", "date": "2005", "authors": "Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ", "evidence": [ { "database": "iPTMnet", "id": "P10747", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747" } ], "reference": [ { "type": "PubMed", "id": "15592455", "url": "https://glygen.org/publication/PubMed/15592455" } ] }, { "title": "Crystal structure of a soluble CD28-Fab complex.", "journal": "Nature immunology", "date": "2005", "authors": "Evans EJ, Esnouf RM, Manso-Sancho R, Gilbert RJ, James JR, Yu C, Fennelly JA, Vowles C, Hanke T, Walse B, Hunig T, Sorensen P, Stuart DI, Davis SJ", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747#ptm_processing" }, { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "reference": [ { "type": "PubMed", "id": "15696168", "url": "https://glygen.org/publication/PubMed/15696168" } ] }, { "title": "Phosphorylation and regulation of Akt/PKB by the rictor-mTOR complex.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Sarbassov DD, Guertin DA, Ali SM, Sabatini DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "15718470", "url": "https://glygen.org/publication/PubMed/15718470" } ] }, { "title": "PI 3-kinase p110beta: a new target for antithrombotic therapy.", "journal": "Nature medicine", "date": "2005", "authors": "Jackson SP, Schoenwaelder SM, Goncalves I, Nesbitt WS, Yap CL, Wright CE, Kenche V, Anderson KE, Dopheide SM, Yuan Y, Sturgeon SA, Prabaharan H, Thompson PE, Smith GD, Shepherd PR, Daniele N, Kulkarni S, Abbott B, Saylik D, Jones C, Lu L, Giuliano S, Hughan SC, Angus JA, Robertson AD, Salem HH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "15834429", "url": "https://glygen.org/publication/PubMed/15834429" } ] }, { "title": "Vav-family proteins in T-cell signalling.", "journal": "Current opinion in immunology", "date": "2005", "authors": "Tybulewicz VL", "evidence": [ { "database": "Reactome", "id": "R-HSA-389359", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389359" } ], "reference": [ { "type": "PubMed", "id": "15886116", "url": "https://glygen.org/publication/PubMed/15886116" } ] }, { "title": "Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.", "journal": "Nature methods", "date": "2005", "authors": "Tao WA, Wollscheid B, O'Brien R, Eng JK, Li XJ, Bodenmiller B, Watts JD, Hood L, Aebersold R", "evidence": [ { "database": "iPTMnet", "id": "P10747", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747" } ], "reference": [ { "type": "PubMed", "id": "16094384", "url": "https://glygen.org/publication/PubMed/16094384" } ] }, { "title": "The oncogenic properties of mutant p110alpha and p110beta phosphatidylinositol 3-kinases in human mammary epithelial cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Zhao JJ, Liu Z, Wang L, Shin E, Loda MF, Roberts TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "16339315", "url": "https://glygen.org/publication/PubMed/16339315" } ] }, { "title": "B56-containing PP2A dephosphorylate ERK and their activity is controlled by the early gene IEX-1 and ERK.", "journal": "The EMBO journal", "date": "2006", "authors": "Letourneux C, Rocher G, Porteu F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811558" } ], "reference": [ { "type": "PubMed", "id": "16456541", "url": "https://glygen.org/publication/PubMed/16456541" } ] }, { "title": "A pharmacological map of the PI3-K family defines a role for p110alpha in insulin signaling.", "journal": "Cell", "date": "2006", "authors": "Knight ZA, Gonzalez B, Feldman ME, Zunder ER, Goldenberg DD, Williams O, Loewith R, Stokoe D, Balla A, Toth B, Balla T, Weiss WA, Williams RL, Shokat KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "16647110", "url": "https://glygen.org/publication/PubMed/16647110" } ] }, { "title": "Grb2 and Gads exhibit different interactions with CD28 and play distinct roles in CD28-mediated costimulation.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006", "authors": "Watanabe R, Harada Y, Takeda K, Takahashi J, Ohnuki K, Ogawa S, Ohgai D, Kaibara N, Koiwai O, Tanabe K, Toma H, Sugamura K, Abe R", "evidence": [ { "database": "Reactome", "id": "R-HSA-389356", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389356" } ], "reference": [ { "type": "PubMed", "id": "16818765", "url": "https://glygen.org/publication/PubMed/16818765" } ] }, { "title": "Inhibition of B56-containing protein phosphatase 2As by the early response gene IEX-1 leads to control of Akt activity.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Rocher G, Letourneux C, Lenormand P, Porteu F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811558" } ], "reference": [ { "type": "PubMed", "id": "17200115", "url": "https://glygen.org/publication/PubMed/17200115" } ] }, { "title": "Mechanism of two classes of cancer mutations in the phosphoinositide 3-kinase catalytic subunit.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Miled N, Yan Y, Hon WC, Perisic O, Zvelebil M, Inbar Y, Schneidman-Duhovny D, Wolfson HJ, Backer JM, Williams RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "17626883", "url": "https://glygen.org/publication/PubMed/17626883" } ] }, { "title": "The structure of a human p110alpha/p85alpha complex elucidates the effects of oncogenic PI3Kalpha mutations.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Huang CH, Mandelker D, Schmidt-Kittler O, Samuels Y, Velculescu VE, Kinzler KW, Vogelstein B, Gabelli SB, Amzel LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "18079394", "url": "https://glygen.org/publication/PubMed/18079394" } ] }, { "title": "CD28 and Grb-2, relative to Gads or Grap, preferentially co-operate with Vav1 in the activation of NFAT/AP-1 transcription.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Schneider H, Rudd CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-389359", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389359" } ], "reference": [ { "type": "PubMed", "id": "18295596", "url": "https://glygen.org/publication/PubMed/18295596" } ] }, { "title": "Mutations in the catalytic subunit of class IA PI3K confer leukemogenic potential to hematopoietic cells.", "journal": "Oncogene", "date": "2008", "authors": "Horn S, Bergholz U, Jucker M, McCubrey JA, Trumper L, Stocking C, Basecke J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "18317450", "url": "https://glygen.org/publication/PubMed/18317450" } ] }, { "title": "NIK and Cot cooperate to trigger NF-kappaB p65 phosphorylation.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Wittwer T, Schmitz ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-389357", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389357" } ], "reference": [ { "type": "PubMed", "id": "18439422", "url": "https://glygen.org/publication/PubMed/18439422" } ] }, { "title": "Essential roles of PI(3)K-p110beta in cell growth, metabolism and tumorigenesis.", "journal": "Nature", "date": "2008", "authors": "Jia S, Liu Z, Zhang S, Liu P, Zhang L, Lee SH, Zhang J, Signoretti S, Loda M, Roberts TM, Zhao JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "18594509", "url": "https://glygen.org/publication/PubMed/18594509" } ] }, { "title": "Identification and characterization of NVP-BEZ235, a new orally available dual phosphatidylinositol 3-kinase/mammalian target of rapamycin inhibitor with potent in vivo antitumor activity.", "journal": "Molecular cancer therapeutics", "date": "2008", "authors": "Maira SM, Stauffer F, Brueggen J, Furet P, Schnell C, Fritsch C, Brachmann S, Chene P, De Pover A, Schoemaker K, Fabbro D, Gabriel D, Simonen M, Murphy L, Finan P, Sellers W, Garcia-Echeverria C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "18606717", "url": "https://glygen.org/publication/PubMed/18606717" } ] }, { "title": "The identification of 2-(1H-indazol-4-yl)-6-(4-methanesulfonyl-piperazin-1-ylmethyl)-4-morpholin-4-yl-t hieno[3,2-d]pyrimidine (GDC-0941) as a potent, selective, orally bioavailable inhibitor of class I PI3 kinase for the treatment of cancer .", "journal": "Journal of medicinal chemistry", "date": "2008", "authors": "Folkes AJ, Ahmadi K, Alderton WK, Alix S, Baker SJ, Box G, Chuckowree IS, Clarke PA, Depledge P, Eccles SA, Friedman LS, Hayes A, Hancox TC, Kugendradas A, Lensun L, Moore P, Olivero AG, Pang J, Patel S, Pergl-Wilson GH, Raynaud FI, Robson A, Saghir N, Salphati L, Sohal S, Ultsch MH, Valenti M, Wallweber HJ, Wan NC, Wiesmann C, Workman P, Zhyvoloup A, Zvelebil MJ, Shuttleworth SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "18754654", "url": "https://glygen.org/publication/PubMed/18754654" } ] }, { "title": "PTEN-deficient cancers depend on PIK3CB.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Wee S, Wiederschain D, Maira SM, Loo A, Miller C, deBeaumont R, Stegmeier F, Yao YM, Lengauer C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "18755892", "url": "https://glygen.org/publication/PubMed/18755892" } ] }, { "title": "NVP-BEZ235, a dual PI3K/mTOR inhibitor, prevents PI3K signaling and inhibits the growth of cancer cells with activating PI3K mutations.", "journal": "Cancer research", "date": "2008", "authors": "Serra V, Markman B, Scaltriti M, Eichhorn PJ, Valero V, Guzman M, Botero ML, Llonch E, Atzori F, Di Cosimo S, Maira M, Garcia-Echeverria C, Parra JL, Arribas J, Baselga J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "18829560", "url": "https://glygen.org/publication/PubMed/18829560" } ] }, { "title": "mTOR complex 2 (mTORC2) controls hydrophobic motif phosphorylation and activation of serum- and glucocorticoid-induced protein kinase 1 (SGK1).", "journal": "The Biochemical journal", "date": "2008", "authors": "Garcia-Martinez JM, Alessi DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "18925875", "url": "https://glygen.org/publication/PubMed/18925875" } ] }, { "title": "PI 3-kinase and cancer: changing accents.", "journal": "Current opinion in genetics & development", "date": "2009", "authors": "Vogt PK, Gymnopoulos M, Hart JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "19185485", "url": "https://glygen.org/publication/PubMed/19185485" } ] }, { "title": "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.", "journal": "Nature biotechnology", "date": "2009", "authors": "Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747#ptm_processing" }, { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "reference": [ { "type": "PubMed", "id": "19349973", "url": "https://glygen.org/publication/PubMed/19349973" } ] }, { "title": "Ligand-independent HER2/HER3/PI3K complex is disrupted by trastuzumab and is effectively inhibited by the PI3K inhibitor GDC-0941.", "journal": "Cancer cell", "date": "2009", "authors": "Junttila TT, Akita RW, Parsons K, Fields C, Lewis Phillips GD, Friedman LS, Sampath D, Sliwkowski MX", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "19411071", "url": "https://glygen.org/publication/PubMed/19411071" } ] }, { "title": "PtdIns5P protects Akt from dephosphorylation through PP2A inhibition.", "journal": "Biochemical and biophysical research communications", "date": "2009", "authors": "Ramel D, Lagarrigue F, Dupuis-Coronas S, Chicanne G, Leslie N, Gaits-Iacovoni F, Payrastre B, Tronchere H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811558", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811558" } ], "reference": [ { "type": "PubMed", "id": "19576174", "url": "https://glygen.org/publication/PubMed/19576174" } ] }, { "title": "Targeting the phosphoinositide 3-kinase pathway in cancer.", "journal": "Nature reviews. Drug discovery", "date": "2009", "authors": "Liu P, Cheng H, Roberts TM, Zhao JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "19644473", "url": "https://glygen.org/publication/PubMed/19644473" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" }, { "database": "iPTMnet", "id": "P10747", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "A frequent kinase domain mutation that changes the interaction between PI3Kalpha and the membrane.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Mandelker D, Gabelli SB, Schmidt-Kittler O, Zhu J, Cheong I, Huang CH, Kinzler KW, Vogelstein B, Amzel LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "19805105", "url": "https://glygen.org/publication/PubMed/19805105" } ] }, { "title": "Multiple myeloma phosphotyrosine proteomic profile associated with FGFR3 expression, ligand activation, and drug inhibition.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "St-Germain JR, Taylor P, Tong J, Jin LL, Nikolic A, Stewart II, Ewing RM, Dharsee M, Li Z, Trudel S, Moran MF", "evidence": [ { "database": "iPTMnet", "id": "P10747-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747-1" } ], "reference": [ { "type": "PubMed", "id": "19901323", "url": "https://glygen.org/publication/PubMed/19901323" } ] }, { "title": "Somatic mutations in p85alpha promote tumorigenesis through class IA PI3K activation.", "journal": "Cancer cell", "date": "2009", "authors": "Jaiswal BS, Janakiraman V, Kljavin NM, Chaudhuri S, Stern HM, Wang W, Kan Z, Dbouk HA, Peters BA, Waring P, Dela Vega T, Kenski DM, Bowman KK, Lorenzo M, Li H, Wu J, Modrusan Z, Stinson J, Eby M, Yue P, Kaminker JS, de Sauvage FJ, Backer JM, Seshagiri S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "19962665", "url": "https://glygen.org/publication/PubMed/19962665" } ] }, { "title": "Phosphoinositide 3-kinase pathway activation in phosphate and tensin homolog (PTEN)-deficient prostate cancer cells is independent of receptor tyrosine kinases and mediated by the p110beta and p110delta catalytic subunits.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Jiang X, Chen S, Asara JM, Balk SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "20231295", "url": "https://glygen.org/publication/PubMed/20231295" } ] }, { "title": "mTOR complex-2 activates ENaC by phosphorylating SGK1.", "journal": "Journal of the American Society of Nephrology : JASN", "date": "2010", "authors": "Lu M, Wang J, Jones KT, Ives HE, Feldman ME, Yao LJ, Shokat KM, Ashrafi K, Pearce D", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "20338997", "url": "https://glygen.org/publication/PubMed/20338997" } ] }, { "title": "Phosphatidylinositol 3-kinase-delta inhibitor CAL-101 shows promising preclinical activity in chronic lymphocytic leukemia by antagonizing intrinsic and extrinsic cellular survival signals.", "journal": "Blood", "date": "2010", "authors": "Herman SE, Gordon AL, Wagner AJ, Heerema NA, Zhao W, Flynn JM, Jones J, Andritsos L, Puri KD, Lannutti BJ, Giese NA, Zhang X, Wei L, Byrd JC, Johnson AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "20522708", "url": "https://glygen.org/publication/PubMed/20522708" } ] }, { "title": "Cancer-derived mutations in the regulatory subunit p85alpha of phosphoinositide 3-kinase function through the catalytic subunit p110alpha.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Sun M, Hillmann P, Hofmann BT, Hart JR, Vogt PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "20713702", "url": "https://glygen.org/publication/PubMed/20713702" } ] }, { "title": "PTEN restoration and PIK3CB knockdown synergistically suppress glioblastoma growth in vitro and in xenografts.", "journal": "Journal of neuro-oncology", "date": "2011", "authors": "Chen H, Mei L, Zhou L, Shen X, Guo C, Zheng Y, Zhu H, Zhu Y, Huang L", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "21188471", "url": "https://glygen.org/publication/PubMed/21188471" } ] }, { "title": "Inhibition of PI3K/mTOR pathways in glioblastoma and implications for combination therapy with temozolomide.", "journal": "Neuro-oncology", "date": "2011", "authors": "Prasad G, Sottero T, Yang X, Mueller S, James CD, Weiss WA, Polley MY, Ozawa T, Berger MS, Aftab DT, Prados MD, Haas-Kogan DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "21317208", "url": "https://glygen.org/publication/PubMed/21317208" } ] }, { "title": "Feedback upregulation of HER3 (ErbB3) expression and activity attenuates antitumor effect of PI3K inhibitors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Chakrabarty A, Sanchez V, Kuba MG, Rinehart C, Arteaga CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "21368164", "url": "https://glygen.org/publication/PubMed/21368164" } ] }, { "title": "PIK3R1 (p85alpha) is somatically mutated at high frequency in primary endometrial cancer.", "journal": "Cancer research", "date": "2011", "authors": "Urick ME, Rudd ML, Godwin AK, Sgroi D, Merino M, Bell DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "21478295", "url": "https://glygen.org/publication/PubMed/21478295" } ] }, { "title": "The genomic organization of the CD28 gene. Implications for the regulation of CD28 mRNA expression and heterogeneity.", "journal": "J. Immunol.", "date": "1990", "authors": "Lee K P, Taylor C, Petryniak B, Turka L A, June C H, Thompson C B", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "reference": [ { "type": "PubMed", "id": "2162892", "url": "https://glygen.org/publication/PubMed/2162892" } ] }, { "title": "A drug targeting only p110alpha can block phosphoinositide 3-kinase signalling and tumour growth in certain cell types.", "journal": "The Biochemical journal", "date": "2011", "authors": "Jamieson S, Flanagan JU, Kolekar S, Buchanan C, Kendall JD, Lee WJ, Rewcastle GW, Denny WA, Singh R, Dickson J, Baguley BC, Shepherd PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "21668414", "url": "https://glygen.org/publication/PubMed/21668414" } ] }, { "title": "Dynamics of the phosphoinositide 3-kinase p110delta interaction with p85alpha and membranes reveals aspects of regulation distinct from p110alpha.", "journal": "Structure (London, England : 1993)", "date": "2011", "authors": "Burke JE, Vadas O, Berndt A, Finegan T, Perisic O, Williams RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "21827948", "url": "https://glygen.org/publication/PubMed/21827948" } ] }, { "title": "Novel phosphoinositide 3-kinase/mTOR dual inhibitor, NVP-BGT226, displays potent growth-inhibitory activity against human head and neck cancer cells in vitro and in vivo.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2011", "authors": "Chang KY, Tsai SY, Wu CM, Yen CJ, Chuang BF, Chang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "21976531", "url": "https://glygen.org/publication/PubMed/21976531" } ] }, { "title": "High frequency of PIK3R1 and PIK3R2 mutations in endometrial cancer elucidates a novel mechanism for regulation of PTEN protein stability.", "journal": "Cancer discovery", "date": "2011", "authors": "Cheung LW, Hennessy BT, Li J, Yu S, Myers AP, Djordjevic B, Lu Y, Stemke-Hale K, Dyer MD, Zhang F, Ju Z, Cantley LC, Scherer SE, Liang H, Lu KH, Broaddus RR, Mills GB", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "21984976", "url": "https://glygen.org/publication/PubMed/21984976" } ] }, { "title": "Regulation of lipid binding underlies the activation mechanism of class IA PI3-kinases.", "journal": "Oncogene", "date": "2012", "authors": "Hon WC, Berndt A, Williams RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "22120714", "url": "https://glygen.org/publication/PubMed/22120714" } ] }, { "title": "Identification and characterization of NVP-BKM120, an orally available pan-class I PI3-kinase inhibitor.", "journal": "Molecular cancer therapeutics", "date": "2012", "authors": "Maira SM, Pecchi S, Huang A, Burger M, Knapp M, Sterker D, Schnell C, Guthy D, Nagel T, Wiesmann M, Brachmann S, Fritsch C, Dorsch M, Chene P, Shoemaker K, De Pover A, Menezes D, Martiny-Baron G, Fabbro D, Wilson CJ, Schlegel R, Hofmann F, Garcia-Echeverria C, Sellers WR, Voliva CF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "22188813", "url": "https://glygen.org/publication/PubMed/22188813" } ] }, { "title": "Functional characterization of an isoform-selective inhibitor of PI3K-p110beta as a potential anticancer agent.", "journal": "Cancer discovery", "date": "2012", "authors": "Ni J, Liu Q, Xie S, Carlson C, Von T, Vogel K, Riddle S, Benes C, Eck M, Roberts T, Gray N, Zhao J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "22588880", "url": "https://glygen.org/publication/PubMed/22588880" } ] }, { "title": "The p110alpha and p110beta isoforms of PI3K play divergent roles in mammary gland development and tumorigenesis.", "journal": "Genes & development", "date": "2012", "authors": "Utermark T, Rao T, Cheng H, Wang Q, Lee SH, Wang ZC, Iglehart JD, Roberts TM, Muller WJ, Zhao JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "22802530", "url": "https://glygen.org/publication/PubMed/22802530" } ] }, { "title": "PKC-theta-mediated signal delivery from the TCR/CD28 surface receptors.", "journal": "Frontiers in immunology", "date": "2012", "authors": "Isakov N, Altman A", "evidence": [ { "database": "iPTMnet", "id": "P10747", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747" } ], "reference": [ { "type": "PubMed", "id": "22936936", "url": "https://glygen.org/publication/PubMed/22936936" } ] }, { "title": "High resolution crystal structure of the Grb2 SH2 domain with a phosphopeptide derived from CD28.", "journal": "PLoS ONE", "date": "2013", "authors": "Higo Kunitake, Ikura Teikichi, Oda Masayuki, Morii Hisayuki, Takahashi Jun, Abe Ryo, Ito Nobutoshi", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "reference": [ { "type": "PubMed", "id": "24098653", "url": "https://glygen.org/publication/PubMed/24098653" } ] }, { "title": "Molecular cloning of a CD28 cDNA by a high-efficiency COS cell expression system.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1987", "authors": "Aruffo A, Seed B", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "reference": [ { "type": "PubMed", "id": "2825196", "url": "https://glygen.org/publication/PubMed/2825196" } ] }, { "title": "Computational Model of Chimeric Antigen Receptors Explains Site-Specific Phosphorylation Kinetics.", "journal": "Biophysical journal", "date": "2018", "authors": "Rohrs JA, Zheng D, Graham NA, Wang P, Finley SD", "evidence": [ { "database": "iPTMnet", "id": "P10747", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747" } ], "reference": [ { "type": "PubMed", "id": "30197180", "url": "https://glygen.org/publication/PubMed/30197180" } ] }, { "title": "[Clinical Analysis of Pediatric Acute Leukemia Complicated with Septic Shock].", "journal": "Zhongguo shi yan xue ye xue za zhi", "date": "2022-12", "authors": "Liu Ting-Hua, Lei Jia-Ying, Mai You-Gang, Fang Jian-Pei", "evidence": [ { "database": "RefSeq", "id": "NP_001230006", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230006" } ], "reference": [ { "type": "PubMed", "id": "36476893", "url": "https://glygen.org/publication/PubMed/36476893" } ] }, { "title": "Recent advancements in the B7/CD28 immune checkpoint families: new biology and clinical therapeutic strategies.", "journal": "Cellular & molecular immunology", "date": "2023-07", "authors": "Pulanco Marc C, Madsen Anne T, Tanwar Ankit, Corrigan Devin T, Zang Xingxing", "evidence": [ { "database": "RefSeq", "id": "NP_001230006", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230006" } ], "reference": [ { "type": "PubMed", "id": "37069229", "url": "https://glygen.org/publication/PubMed/37069229" } ] }, { "title": "Genome-Wide Meta-Analysis Identifies Multiple Novel Rare Variants to Predict Common Human Infectious Diseases Risk.", "journal": "International journal of molecular sciences", "date": "2023-04-10", "authors": "Gelemanovi\u0107 Andrea, \u0106atipovi\u0107 Ardali\u0107 Tatjana, Pribisali\u0107 Ajka, Hayward Caroline, Kol\u010di\u0107 Ivana, Pola\u0161ek Ozren", "evidence": [ { "database": "RefSeq", "id": "NP_001230006", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230006" } ], "reference": [ { "type": "PubMed", "id": "37108169", "url": "https://glygen.org/publication/PubMed/37108169" } ] }, { "title": "Kidney allograft rejection is associated with an imbalance of B cells, regulatory T cells and differentiated CD28-CD8+ T cells: analysis of a cohort of 1095 graft biopsies.", "journal": "Frontiers in immunology", "date": "2023", "authors": "Mai Hoa Le, Degauque Nicolas, Lorent Marine, Rimbert Marie, Renaudin Karine, Danger Richard, Kerleau Clarisse, Tilly Gaelle, Vivet Ana\u00efs, Le Bot Sabine, Delbos Florent, Walencik Alexandre, Giral Magali, Brouard Sophie", "evidence": [ { "database": "RefSeq", "id": "NP_001230006", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230006" } ], "reference": [ { "type": "PubMed", "id": "37168864", "url": "https://glygen.org/publication/PubMed/37168864" } ] }, { "title": "c-Kit signaling potentiates CAR T cell efficacy in solid tumors by CD28- and IL-2-independent co-stimulation.", "journal": "Nature cancer", "date": "2023-07", "authors": "Xiong Yuquan, Taleb Meriem, Misawa Kyohei, Hou Zhaohua, Banerjee Srijita, Amador-Molina Alfredo, Jones David R, Chintala Navin K, Adusumilli Prasad S", "evidence": [ { "database": "RefSeq", "id": "NP_001230006", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230006" } ], "reference": [ { "type": "PubMed", "id": "37336986", "url": "https://glygen.org/publication/PubMed/37336986" } ] }, { "title": "p56Lck and p59Fyn regulate CD28 binding to phosphatidylinositol 3-kinase, growth factor receptor-bound protein GRB-2, and T cell-specific protein-tyrosine kinase ITK: implications for T-cell costimulation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Raab M, Cai YC, Bunnell SC, Heyeck SD, Berg LJ, Rudd CE", "evidence": [ { "database": "iPTMnet", "id": "P10747", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747" } ], "reference": [ { "type": "PubMed", "id": "7568038", "url": "https://glygen.org/publication/PubMed/7568038" } ] }, { "title": "Selective CD28pYMNM mutations implicate phosphatidylinositol 3-kinase in CD86-CD28-mediated costimulation.", "journal": "Immunity", "date": "1995-10", "authors": "Cai Y C, Cefai D, Schneider H, Raab M, Nabavi N, Rudd C E", "evidence": [ { "database": "iPTMnet", "id": "P10747", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747" } ], "reference": [ { "type": "PubMed", "id": "7584133", "url": "https://glygen.org/publication/PubMed/7584133" } ] }, { "title": "Protein kinase B (c-Akt) in phosphatidylinositol-3-OH kinase signal transduction.", "journal": "Nature", "date": "1995", "authors": "Burgering BM, Coffer PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "7637810", "url": "https://glygen.org/publication/PubMed/7637810" } ] }, { "title": "T cell antigen CD28 binds to the GRB-2/SOS complex, regulators of p21ras.", "journal": "European journal of immunology", "date": "1995", "authors": "Schneider H, Cai YC, Prasad KV, Shoelson SE, Rudd CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-389359", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389359" } ], "reference": [ { "type": "PubMed", "id": "7737275", "url": "https://glygen.org/publication/PubMed/7737275" } ] }, { "title": "Phosphoinositide 3-kinase inhibition spares actin assembly in activating platelets but reverses platelet aggregation.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Kovacsovics TJ, Bachelot C, Toker A, Vlahos CJ, Duckworth B, Cantley LC, Hartwig JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "7744773", "url": "https://glygen.org/publication/PubMed/7744773" } ] }, { "title": "CTLA-4 binding to the lipid kinase phosphatidylinositol 3-kinase in T cells.", "journal": "The Journal of experimental medicine", "date": "1995-01-01", "authors": "Schneider H, Prasad K V, Shoelson S E, Rudd C E", "evidence": [ { "database": "iPTMnet", "id": "P10747", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747" } ], "reference": [ { "type": "PubMed", "id": "7807015", "url": "https://glygen.org/publication/PubMed/7807015" } ] }, { "title": "T-cell antigen CD28 interacts with the lipid kinase phosphatidylinositol 3-kinase by a cytoplasmic Tyr(P)-Met-Xaa-Met motif.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994-03-29", "authors": "Prasad K V, Cai Y C, Raab M, Duckworth B, Cantley L, Shoelson S E, Rudd C E", "evidence": [ { "database": "iPTMnet", "id": "P10747", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747" } ], "reference": [ { "type": "PubMed", "id": "8146197", "url": "https://glygen.org/publication/PubMed/8146197" } ] }, { "title": "Binding of phosphatidylinositol-3-OH kinase to CD28 is required for T-cell signalling.", "journal": "Nature", "date": "1994-05-26", "authors": "Pag\u00e8s F, Ragueneau M, Rottapel R, Truneh A, Nunes J, Imbert J, Olive D", "evidence": [ { "database": "iPTMnet", "id": "P10747", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747" } ], "reference": [ { "type": "PubMed", "id": "8183372", "url": "https://glygen.org/publication/PubMed/8183372" } ] }, { "title": "Interactions of CD80 and CD86 with CD28 and CTLA4.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1996", "authors": "Ellis JH, Burden MN, Vinogradov DV, Linge C, Crowe JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-389356", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389356" } ], "reference": [ { "type": "PubMed", "id": "8609386", "url": "https://glygen.org/publication/PubMed/8609386" } ] }, { "title": "Cross-linking of the CD40 ligand on human CD4+ T lymphocytes generates a costimulatory signal that up-regulates IL-4 synthesis.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1996-05-01", "authors": "Blotta M H, Marshall J D, DeKruyff R H, Umetsu D T", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "reference": [ { "type": "PubMed", "id": "8617933", "url": "https://glygen.org/publication/PubMed/8617933" } ] }, { "title": "Two distinct intracytoplasmic regions of the T-cell adhesion molecule CD28 participate in phosphatidylinositol 3-kinase association.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Pages F, Ragueneau M, Klasen S, Battifora M, Couez D, Sweet R, Truneh A, Ward SG, Olive D", "evidence": [ { "database": "Reactome", "id": "R-HSA-389357", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389357" }, { "database": "iPTMnet", "id": "P10747", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747" } ], "reference": [ { "type": "PubMed", "id": "8621607", "url": "https://glygen.org/publication/PubMed/8621607" } ] }, { "title": "Rac GTPase interacts specifically with phosphatidylinositol 3-kinase.", "journal": "The Biochemical journal", "date": "1996", "authors": "Bokoch GM, Vlahos CJ, Wang Y, Knaus UG, Traynor-Kaplan AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "8645157", "url": "https://glygen.org/publication/PubMed/8645157" } ] }, { "title": "Differential recognition by CD28 of its cognate counter receptors CD80 (B7.1) and B70 (B7.2): analysis by site directed mutagenesis.", "journal": "Molecular immunology", "date": "1996", "authors": "Truneh A, Reddy M, Ryan P, Lyn SD, Eichman C, Couez D, Hurle MR, Sekaly RP, Olive D, Sweet R", "evidence": [ { "database": "Reactome", "id": "R-HSA-389356", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389356" } ], "reference": [ { "type": "PubMed", "id": "8649453", "url": "https://glygen.org/publication/PubMed/8649453" } ] }, { "title": "Wortmannin inactivates phosphoinositide 3-kinase by covalent modification of Lys-802, a residue involved in the phosphate transfer reaction.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Wymann MP, Bulgarelli-Leva G, Zvelebil MJ, Pirola L, Vanhaesebroeck B, Waterfield MD, Panayotou G", "evidence": [ { "database": "Reactome", "id": "R-HSA-2219530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530" } ], "reference": [ { "type": "PubMed", "id": "8657148", "url": "https://glygen.org/publication/PubMed/8657148" } ] }, { "title": "Phosphorylation of each of the distal three tyrosines of the CD28 cytoplasmic tail is required for CD28-induced T cell IL-2 secretion.", "journal": "Tissue antigens", "date": "1996", "authors": "Teng JM, King PD, Sadra A, Liu X, Han A, Selvakumar A, August A, Dupont B", "evidence": [ { "database": "Reactome", "id": "R-HSA-389356", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389356" }, { "database": "iPTMnet", "id": "P10747", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747" } ], "reference": [ { "type": "PubMed", "id": "8946678", "url": "https://glygen.org/publication/PubMed/8946678" } ] }, { "title": "Phosphotyrosine-dependent activation of Rac-1 GDP/GTP exchange by the vav proto-oncogene product.", "journal": "Nature", "date": "1997", "authors": "Crespo P, Schuebel KE, Ostrom AA, Gutkind JS, Bustelo XR", "evidence": [ { "database": "Reactome", "id": "R-HSA-389359", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389359" } ], "reference": [ { "type": "PubMed", "id": "8990121", "url": "https://glygen.org/publication/PubMed/8990121" } ] }, { "title": "Analysis of CD28 cytoplasmic tail tyrosine residues as regulators and substrates for the protein tyrosine kinases, EMT and LCK.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1997", "authors": "King PD, Sadra A, Teng JM, Xiao-Rong L, Han A, Selvakumar A, August A, Dupont B", "evidence": [ { "database": "iPTMnet", "id": "P10747-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747-1" } ], "reference": [ { "type": "PubMed", "id": "8992971", "url": "https://glygen.org/publication/PubMed/8992971" } ] }, { "title": "Lck regulates Vav activation of members of the Rho family of GTPases.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Han J, Das B, Wei W, Van Aelst L, Mosteller RD, Khosravi-Far R, Westwick JK, Der CJ, Broek D", "evidence": [ { "database": "Reactome", "id": "R-HSA-389359", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389359" } ], "reference": [ { "type": "PubMed", "id": "9032261", "url": "https://glygen.org/publication/PubMed/9032261" } ] }, { "title": "Growth factor receptor-bound protein 2 SH2/SH3 domain binding to CD28 and its role in co-signaling.", "journal": "The Journal of biological chemistry", "date": "1998-01-02", "authors": "Kim H H, Tharayil M, Rudd C E", "evidence": [ { "database": "iPTMnet", "id": "P10747", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10747" } ], "reference": [ { "type": "PubMed", "id": "9417079", "url": "https://glygen.org/publication/PubMed/9417079" } ] }, { "title": "Role of substrates and products of PI 3-kinase in regulating activation of Rac-related guanosine triphosphatases by Vav.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Han J, Luby-Phelps K, Das B, Shu X, Xia Y, Mosteller RD, Krishna UM, Falck JR, White MA, Broek D", "evidence": [ { "database": "Reactome", "id": "R-HSA-389359", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389359" } ], "reference": [ { "type": "PubMed", "id": "9438848", "url": "https://glygen.org/publication/PubMed/9438848" } ] }, { "title": "Grb2 forms an inducible protein complex with CD28 through a Src homology 3 domain-proline interaction.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Okkenhaug K, Rottapel R", "evidence": [ { "database": "Reactome", "id": "R-HSA-389359", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389359" } ], "reference": [ { "type": "PubMed", "id": "9694876", "url": "https://glygen.org/publication/PubMed/9694876" } ] }, { "title": "Phosphoinositide-3-OH kinase-dependent regulation of glycogen synthase kinase 3 and protein kinase B/AKT by the integrin-linked kinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Delcommenne M, Tan C, Gray V, Rue L, Woodgett J, Dedhar S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "9736715", "url": "https://glygen.org/publication/PubMed/9736715" } ] }, { "title": "Fyn and ZAP-70 are required for Vav phosphorylation in T cells stimulated by antigen-presenting cells.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Michel F, Grimaud L, Tuosto L, Acuto O", "evidence": [ { "database": "Reactome", "id": "R-HSA-389359", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389359" } ], "reference": [ { "type": "PubMed", "id": "9822663", "url": "https://glygen.org/publication/PubMed/9822663" } ] }, { "title": "Role of phosphatidylinositol 3,4,5-trisphosphate in regulating the activity and localization of 3-phosphoinositide-dependent protein kinase-1.", "journal": "The Biochemical journal", "date": "1999", "authors": "Currie RA, Walker KS, Gray A, Deak M, Casamayor A, Downes CP, Cohen P, Alessi DR, Lucocq J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1257604", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604" } ], "reference": [ { "type": "PubMed", "id": "9895304", "url": "https://glygen.org/publication/PubMed/9895304" } ] }, { "title": "Identification of tyrosine phosphorylation sites in the CD28 cytoplasmic domain and their role in the costimulation of Jurkat T cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Sadra A, Cinek T, Arellano JL, Shi J, Truitt KE, Imboden JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-389356", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389356" } ], "reference": [ { "type": "PubMed", "id": "9973466", "url": "https://glygen.org/publication/PubMed/9973466" } ] } ], "pathway": [ { "id": "hsa:940", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:940", "resource": "KEGG Pathway" }, { "id": "R-HSA-1257604", "name": "PIP3 activates AKT signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604", "resource": "Reactome", "description": "PIP3 activates AKT signaling" }, { "id": "R-HSA-164939", "name": "Nef mediated downregulation of CD28 cell surface expression", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-164939", "resource": "Reactome", "description": "Nef mediated downregulation of CD28 cell surface expression" }, { "id": "R-HSA-2219530", "name": "Constitutive Signaling by Aberrant PI3K in Cancer", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530", "resource": "Reactome", "description": "Constitutive Signaling by Aberrant PI3K in Cancer" }, { "id": "R-HSA-389356", "name": "CD28 co-stimulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389356", "resource": "Reactome", "description": "CD28 co-stimulation" }, { "id": "R-HSA-389357", "name": "CD28 dependent PI3K/Akt signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389357", "resource": "Reactome", "description": "CD28 dependent PI3K/Akt signaling" }, { "id": "R-HSA-389359", "name": "CD28 dependent Vav1 pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389359", "resource": "Reactome", "description": "CD28 dependent Vav1 pathway" }, { "id": "R-HSA-6811558", "name": "PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811558", "resource": "Reactome", "description": "PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling" } ], "orthologs": [ { "uniprot_canonical_ac": "P31041-1", "protein_name": "T-cell-specific surface glycoprotein CD28", "gene_name": "Cd28", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTLRLLFLALNFFSVQVTENKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPKLFWALVVVAGVLFCYGLLVTVALCVIWTNSRRNRLLQSDYMNMTPRRPGLTRKPYQPYAPARDFAAYRP", "length": 218 }, "evidence": [ { "id": "45927460", "url": "http://www.informatics.jax.org/homology/45927460", "database": "MGI" }, { "id": "P10747", "url": "https://omabrowser.org/oma/group/P10747/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P31042-1", "protein_name": "T-cell-specific surface glycoprotein CD28", "gene_name": "Cd28", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MTLRLLFLALSFFSVQVTENKILVKQSPLLVVDNNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRPNVGFNCDGNFDNETVTFRLWNLDVNHTDIYFCKIEVMYPPPYLDNEKSNGTIIHIKEKHLCHAQTSPKLFWPLVVVAGVLLCYGLLVTVTLCIIWTNSRRNRLLQSDYMNMTPRRLGPTRKHYQPYAPARDFAAYRP", "length": 218 }, "evidence": [ { "id": "45927460", "url": "http://www.informatics.jax.org/homology/45927460", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "protease binding", "id": "GO:0002020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002020", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "coreceptor activity", "id": "GO:0015026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015026", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "protein kinase binding", "id": "GO:0019901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019901", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "immunological synapse", "id": "GO:0001772", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001772", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "protein complex involved in cell adhesion", "id": "GO:0098636", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098636", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 28, "go_terms": [ { "name": "cell surface receptor signaling pathway", "id": "GO:0007166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007166", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "negative regulation of gene expression", "id": "GO:0010629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010629", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction", "id": "GO:0051897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051897", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "T cell costimulation", "id": "GO:0031295", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031295", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "T cell activation", "id": "GO:0042110", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042110", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "T cell receptor signaling pathway", "id": "GO:0050852", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050852", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "apoptotic signaling pathway", "id": "GO:0097190", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097190", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "positive regulation of cytokine production", "id": "GO:0001819", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001819", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "transcription by RNA polymerase II", "id": "GO:0006366", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006366", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "positive regulation of translation", "id": "GO:0045727", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045727", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "positive regulation of T cell proliferation", "id": "GO:0042102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042102", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "humoral immune response", "id": "GO:0006959", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006959", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "phosphatidylinositol 3-kinase/protein kinase B signal transduction", "id": "GO:0043491", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043491", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "negative thymic T cell selection", "id": "GO:0045060", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045060", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "positive regulation of interleukin-2 production", "id": "GO:0032743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032743", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "positive regulation of isotype switching to IgG isotypes", "id": "GO:0048304", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048304", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "positive regulation of interleukin-10 production", "id": "GO:0032733", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032733", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "positive regulation of mitotic nuclear division", "id": "GO:0045840", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045840", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "positive regulation of viral genome replication", "id": "GO:0045070", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045070", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "positive regulation of interleukin-4 production", "id": "GO:0032753", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032753", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "positive regulation of inflammatory response to antigenic stimulus", "id": "GO:0002863", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002863", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "regulatory T cell differentiation", "id": "GO:0045066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045066", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "regulation of regulatory T cell differentiation", "id": "GO:0045589", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045589", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "positive regulation of CD4-positive, alpha-beta T cell proliferation", "id": "GO:2000563", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000563", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" }, { "name": "CD4-positive, alpha-beta T cell proliferation", "id": "GO:0035739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035739", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 105, "end_pos": 107, "annotation": "n_glycosylation_sequon" }, { "start_pos": 129, "end_pos": 131, "annotation": "n_glycosylation_sequon" }, { "start_pos": 193, "end_pos": 195, "annotation": "n_glycosylation_sequon" }, { "start_pos": 37, "end_pos": 39, "annotation": "n_glycosylation_sequon" }, { "start_pos": 71, "end_pos": 73, "annotation": "n_glycosylation_sequon" }, { "start_pos": 92, "end_pos": 94, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "CD40LG induces tyrosine phosphorylation of isoform 3.", "evidence": [ { "database": "UniProtKB", "id": "P10747", "url": "https://www.uniprot.org/uniprot/P10747" }, { "database": "PubMed", "id": "15067037", "url": "https://glygen.org/publication/PubMed/15067037" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 37, 71, 92, 105, 129 ], "o_linked_sites": [], "snv_sites": [ 92, 107, 198 ], "glycation_sites": [], "phosphorylation_sites": [ 189, 191, 206, 209, 218 ], "sequon_annotation_sites": [ { "start_pos": 105, "end_pos": 107 }, { "start_pos": 129, "end_pos": 131 }, { "start_pos": 193, "end_pos": 195 }, { "start_pos": 37, "end_pos": 39 }, { "start_pos": 71, "end_pos": 73 }, { "start_pos": 92, "end_pos": 94 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 5 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 11 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 99 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }