{
    "uniprot_canonical_ac": "P10721-1",
    "uniprot_ac": "P10721",
    "uniprot_id": "KIT_HUMAN",
    "mass": {
        "chemical_mass": 109865.0,
        "monoisotopic_mass": 109865.0
    },
    "refseq": {
        "ac": "NP_000213",
        "name": "mast/stem cell growth factor receptor Kit isoform 1 precursor",
        "summary": "This gene encodes a receptor tyrosine kinase. This gene was initially identified as a homolog of the feline sarcoma viral oncogene v-kit and is often referred to as proto-oncogene c-Kit. The canonical form of this glycosylated transmembrane protein has an N-terminal extracellular region with five immunoglobulin-like domains, a transmembrane region, and an intracellular tyrosine kinase domain at the C-terminus. Upon activation by its cytokine ligand, stem cell factor (SCF), this protein phosphorylates multiple intracellular proteins that play a role in in the proliferation, differentiation, migration and apoptosis of many cell types and thereby plays an important role in hematopoiesis, stem cell maintenance, gametogenesis, melanogenesis, and in mast cell development, migration and function. This protein can be a membrane-bound or soluble protein. Mutations in this gene are associated with gastrointestinal stromal tumors, mast cell disease, acute myelogenous leukemia, and piebaldism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2020].",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000213"
    },
    "gene_names": [
        {
            "name": "KIT",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/P10721",
            "id": "P10721"
        },
        {
            "name": "C-Kit; CD117; MASTC; PBT; SCFR",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000213",
            "id": "NP_000213"
        },
        {
            "name": "KIT",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000213",
            "id": "NP_000213"
        },
        {
            "name": "SCFR",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/P10721",
            "id": "P10721"
        }
    ],
    "protein_names": [
        {
            "name": "Mast/stem cell growth factor receptor Kit",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "P10721"
        },
        {
            "name": "2.7.10.1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P10721"
        },
        {
            "name": "PBT",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P10721"
        },
        {
            "name": "Piebald trait protein",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P10721"
        },
        {
            "name": "Proto-oncogene c-Kit",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P10721"
        },
        {
            "name": "SCFR",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P10721"
        },
        {
            "name": "Tyrosine-protein kinase Kit",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P10721"
        },
        {
            "name": "mast/stem cell growth factor receptor Kit isoform 1 precursor",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000213",
            "id": "NP_000213"
        },
        {
            "name": "p145 c-kit",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P10721"
        },
        {
            "name": "proto-oncogene tyrosine-protein kinase Kit; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene-like protein; proto-oncogene c-Kit; p145 c-kit; piebald trait protein; mast/stem cell growth factor receptor Kit; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog; c-Kit protooncogene",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000213",
            "id": "NP_000213"
        },
        {
            "name": "v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "P10721"
        }
    ],
    "function": [
        {
            "annotation": "CREB Is Indispensable to KIT Function in Human Skin Mast Cells-A Positive Feedback Loop between CREB and KIT Orchestrates Skin Mast Cell Fate. Publication Status: Online-Only",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_000213",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000213"
                },
                {
                    "database": "PubMed",
                    "id": "38201246",
                    "url": "https://glygen.org/publication/PubMed/38201246"
                }
            ]
        },
        {
            "annotation": "Golgi retention and oncogenic KIT signaling via PLCgamma2-PKD2-PI4KIIIbeta activation in gastrointestinal stromal tumor cells.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_000213",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000213"
                },
                {
                    "database": "PubMed",
                    "id": "37616163",
                    "url": "https://glygen.org/publication/PubMed/37616163"
                }
            ]
        },
        {
            "annotation": "KIT Mutations and Other Genetic Defects in Mastocytosis: Implications for Disease Pathology and Targeted Therapies. Review article",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_000213",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000213"
                },
                {
                    "database": "PubMed",
                    "id": "37758404",
                    "url": "https://glygen.org/publication/PubMed/37758404"
                }
            ]
        },
        {
            "annotation": "Novel somatic Missense Mutations in Exon 11 of the KIT Gene are Detected in Melanoma. Publication Status: Online-Only",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_000213",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000213"
                },
                {
                    "database": "PubMed",
                    "id": "37774052",
                    "url": "https://glygen.org/publication/PubMed/37774052"
                }
            ]
        },
        {
            "annotation": "PDGFRA, KIT, and KDR Gene Amplification in Glioblastoma: Heterogeneity and Clinical Significance.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_000213",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000213"
                },
                {
                    "database": "PubMed",
                    "id": "37610648",
                    "url": "https://glygen.org/publication/PubMed/37610648"
                }
            ]
        },
        {
            "annotation": "This gene encodes a receptor tyrosine kinase. This gene was initially identified as a homolog of the feline sarcoma viral oncogene v-kit and is often referred to as proto-oncogene c-Kit. The canonical form of this glycosylated transmembrane protein has an N-terminal extracellular region with five immunoglobulin-like domains, a transmembrane region, and an intracellular tyrosine kinase domain at the C-terminus. Upon activation by its cytokine ligand, stem cell factor (SCF), this protein phosphorylates multiple intracellular proteins that play a role in in the proliferation, differentiation, migration and apoptosis of many cell types and thereby plays an important role in hematopoiesis, stem cell maintenance, gametogenesis, melanogenesis, and in mast cell development, migration and function. This protein can be a membrane-bound or soluble protein. Mutations in this gene are associated with gastrointestinal stromal tumors, mast cell disease, acute myelogenous leukemia, and piebaldism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2020].",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_000213",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000213"
                }
            ]
        },
        {
            "annotation": "Tyrosine-protein kinase that acts as a cell-surface receptor for the cytokine KITLG/SCF and plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. In response to KITLG/SCF binding, KIT can activate several signaling pathways. Phosphorylates PIK3R1, PLCG1, SH2B2/APS and CBL. Activates the AKT1 signaling pathway by phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase. Activated KIT also transmits signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Promotes activation of STAT family members STAT1, STAT3, STAT5A and STAT5B. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KIT signaling is modulated by protein phosphatases, and by rapid internalization and degradation of the receptor. Activated KIT promotes phosphorylation of the protein phosphatases PTPN6/SHP-1 and PTPRU, and of the transcription factors STAT1, STAT3, STAT5A and STAT5B. Promotes phosphorylation of PIK3R1, CBL, CRK (isoform Crk-II), LYN, MAPK1/ERK2 and/or MAPK3/ERK1, PLCG1, SRC and SHC1.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721#function"
                },
                {
                    "database": "PubMed",
                    "id": "17904548",
                    "url": "https://glygen.org/publication/PubMed/17904548"
                },
                {
                    "database": "PubMed",
                    "id": "21640708",
                    "url": "https://glygen.org/publication/PubMed/21640708"
                },
                {
                    "database": "PubMed",
                    "id": "10397721",
                    "url": "https://glygen.org/publication/PubMed/10397721"
                },
                {
                    "database": "PubMed",
                    "id": "12444928",
                    "url": "https://glygen.org/publication/PubMed/12444928"
                },
                {
                    "database": "PubMed",
                    "id": "19265199",
                    "url": "https://glygen.org/publication/PubMed/19265199"
                },
                {
                    "database": "PubMed",
                    "id": "12878163",
                    "url": "https://glygen.org/publication/PubMed/12878163"
                },
                {
                    "database": "PubMed",
                    "id": "7520444",
                    "url": "https://glygen.org/publication/PubMed/7520444"
                },
                {
                    "database": "PubMed",
                    "id": "9528781",
                    "url": "https://glygen.org/publication/PubMed/9528781"
                },
                {
                    "database": "PubMed",
                    "id": "21135090",
                    "url": "https://glygen.org/publication/PubMed/21135090"
                },
                {
                    "database": "PubMed",
                    "id": "12511554",
                    "url": "https://glygen.org/publication/PubMed/12511554"
                }
            ]
        }
    ],
    "disease": [
        {
            "disease_id": "DOID:3263",
            "recommended_name": {
                "id": "DOID:3263",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:3263",
                "name": "piebaldism",
                "description": "An integumentary system disease characterized by congenital absence of melanocytes in areas of the skin and hair that has_material_basis_in heterozygous mutation in the KIT gene on chromosome 4q12."
            },
            "synonyms": [
                {
                    "id": "DOID:3263",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:3263",
                    "name": "PIEBALD TRAIT",
                    "description": ""
                },
                {
                    "id": "DOID:3263",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:3263",
                    "name": "Partial albinism",
                    "description": ""
                },
                {
                    "id": "MONDO:0008244",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0008244",
                    "name": "piebaldism",
                    "description": "Piebaldism is a rare congenital pigmentation skin disorder characterized by the presence of hypopigmented and depigmented skin areas (leukoderma) on various parts of the body, preferentially on the forehead, chest, abdomen, upper arms, and lower extremities, that are associated with a white forelock (poliosis), and in some cases with hypopigmented and depigmented eyebrows and eyelashes."
                },
                {
                    "id": "MONDO:0008244",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0008244",
                    "name": "partial albinism",
                    "description": ""
                },
                {
                    "id": "MONDO:0008244",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0008244",
                    "name": "piebald trait",
                    "description": ""
                },
                {
                    "id": "MONDO:0008244",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0008244",
                    "name": "piebaldism",
                    "description": ""
                },
                {
                    "id": "MONDO:0008244",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0008244",
                    "name": "PBT",
                    "description": ""
                },
                {
                    "id": "MIM:172800",
                    "resource": "MIM",
                    "url": "https://www.omim.org/entry/172800",
                    "name": "Piebald trait",
                    "description": "Piebald trait"
                }
            ],
            "evidence": [
                {
                    "id": "172800",
                    "database": "MIM",
                    "url": "https://www.omim.org/entry/172800"
                }
            ]
        },
        {
            "disease_id": "DOID:350",
            "recommended_name": {
                "id": "DOID:350",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:350",
                "name": "mastocytosis",
                "description": ""
            },
            "synonyms": [
                {
                    "id": "DOID:350",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:350",
                    "name": "mast cell hyperplasia",
                    "description": ""
                },
                {
                    "id": "MONDO:0019023",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0019023",
                    "name": "cutaneous mastocytosis",
                    "description": "Cutaneous mastocytosis is a term referring to a group of diseases characterized by abnormal accumulation and proliferation of skin mastocytes. In some cases (most commonly in adults), cutaneous mastocytosis may occur in association with mast cell infiltration of various extracutaneous organs, in which case the disorder is referred to as systemic mastocytosis."
                },
                {
                    "id": "MONDO:0019023",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0019023",
                    "name": "CM",
                    "description": ""
                },
                {
                    "id": "MONDO:0019023",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0019023",
                    "name": "cutaneous (skin) mastocytosis",
                    "description": ""
                },
                {
                    "id": "MONDO:0019023",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0019023",
                    "name": "cutaneous mastocytosis",
                    "description": ""
                },
                {
                    "id": "MONDO:0019023",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0019023",
                    "name": "cutaneous mastocytosis (disease)",
                    "description": ""
                },
                {
                    "id": "MONDO:0019023",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0019023",
                    "name": "mastocytosis, cutaneous",
                    "description": ""
                },
                {
                    "id": "MONDO:0019023",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0019023",
                    "name": "mastocytosis, systemic, somatic",
                    "description": ""
                },
                {
                    "id": "MONDO:0019023",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0019023",
                    "name": "CMCD",
                    "description": ""
                },
                {
                    "id": "MIM:154800",
                    "resource": "MIM",
                    "url": "https://www.omim.org/entry/154800",
                    "name": "Mastocytosis, cutaneous",
                    "description": "Mastocytosis, cutaneous"
                }
            ],
            "evidence": [
                {
                    "id": "154800",
                    "database": "MIM",
                    "url": "https://www.omim.org/entry/154800"
                }
            ]
        },
        {
            "disease_id": "DOID:5557",
            "recommended_name": {
                "id": "DOID:5557",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:5557",
                "name": "testicular germ cell cancer",
                "description": "A testicular cancer that has_material_basis_in germ cells."
            },
            "synonyms": [
                {
                    "id": "DOID:5557",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:5557",
                    "name": "germ cell tumor of testis",
                    "description": ""
                },
                {
                    "id": "MONDO:0010274",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010274",
                    "name": "testicular germ cell tumor 1",
                    "description": ""
                },
                {
                    "id": "MONDO:0010274",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010274",
                    "name": "testicular germ cell tumor",
                    "description": ""
                },
                {
                    "id": "MONDO:0010274",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010274",
                    "name": "testicular germ cell tumour",
                    "description": ""
                },
                {
                    "id": "MONDO:0010274",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010274",
                    "name": "TGCT1",
                    "description": ""
                },
                {
                    "id": "MONDO:0010274",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010274",
                    "name": "testicular germ cell tumor 1",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "testicular germ cell tumor",
                    "description": "A germ cell tumor arising from the testis. Representative examples include teratoma, seminoma, embryonal carcinoma, and yolk sac tumor."
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "TGCT",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "germ cell neoplasm of testis",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "germ cell neoplasm of the testis",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "germ cell tumor of testis",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "germ cell tumor of the testis",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "germ cell tumors, somatic",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "germ cell tumour of testis",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "germ cell tumour of the testis",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "male germ cell tumor, somatic",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "spermatocytic seminoma, somatic",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "testicular germ cell neoplasm",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "testicular germ cell neoplasms",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "testicular germ cell tumor",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "testicular tumor, somatic",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "testis germ cell tumor",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "testis germ cell tumour",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "Male germ cell tumor",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "Male germ cell tumour",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "embryonal cell carcinoma",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "endodermal sinus tumor",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "endodermal sinus tumour",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "nonseminomatous germ cell tumors",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "nonseminomatous germ cell tumours",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "seminoma",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "spermatocytic seminoma",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "teratoma, testicular",
                    "description": ""
                },
                {
                    "id": "MONDO:0010108",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010108",
                    "name": "testicular germ cell cancer",
                    "description": ""
                },
                {
                    "id": "MIM:273300",
                    "resource": "MIM",
                    "url": "https://www.omim.org/entry/273300",
                    "name": "Testicular germ cell tumor",
                    "description": "Testicular germ cell tumor"
                }
            ],
            "evidence": [
                {
                    "id": "273300",
                    "database": "MIM",
                    "url": "https://www.omim.org/entry/273300"
                }
            ]
        },
        {
            "disease_id": "DOID:9119",
            "recommended_name": {
                "id": "DOID:9119",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:9119",
                "name": "acute myeloid leukemia",
                "description": "A myeloid leukemia that is characterized by the rapid growth of abnormal white blood cells that accumulate in the bone marrow and interfere with the production of normal blood cells."
            },
            "synonyms": [
                {
                    "id": "DOID:9119",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:9119",
                    "name": "AML - acute Myeloid Leukemia",
                    "description": ""
                },
                {
                    "id": "DOID:9119",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:9119",
                    "name": "Leukemia, Myelocytic, acute",
                    "description": ""
                },
                {
                    "id": "DOID:9119",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:9119",
                    "name": "acute myeloblastic leukaemia",
                    "description": ""
                },
                {
                    "id": "DOID:9119",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:9119",
                    "name": "acute myeloblastic leukemia",
                    "description": ""
                },
                {
                    "id": "DOID:9119",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:9119",
                    "name": "acute myelogenous leukaemia",
                    "description": ""
                },
                {
                    "id": "DOID:9119",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:9119",
                    "name": "acute myelogenous leukemia",
                    "description": ""
                },
                {
                    "id": "DOID:9119",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:9119",
                    "name": "acute myeloid leukaemia",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "acute myeloid leukemia",
                    "description": "Acute myeloid leukemia (AML) is a group of neoplasms arising from precursor cells committed to the myeloid cell-line differentiation. All of them are characterized by clonal expansion of myeloid blasts. AML manifests by fever, pallor, anemia, hemorrhages and recurrent infections."
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "AML",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "AML - acute myeloid leukaemia",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "AML - acute myeloid leukemia",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "ANLL",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "acute Nonlymphocytic leukaemia",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "acute Nonlymphocytic leukemia",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "acute granulocytic leukaemia",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "acute granulocytic leukemia",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "acute myeloblastic leukaemia",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "acute myeloblastic leukemia",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "acute myelocytic leukaemia",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "acute myelocytic leukemia",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "acute myelogenous leukaemia",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "acute myelogenous leukemia",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "acute myelogenous leukemias",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "acute myeloid leukaemia (AML)",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "acute myeloid leukemia",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "acute myeloid leukemia (AML)",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "acute myeloid leukemia, somatic",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "acute nonlymphocytic leukaemia",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "acute nonlymphocytic leukemia",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "hematopoeitic - acute Myleogenous leukaemia (AML)",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "hematopoeitic - acute Myleogenous leukemia (AML)",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "leukemia, acute myeloid, autosomal dominant, somatic mutation",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "leukemia, acute myeloid, reduced survival in, somatic",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "leukemia, acute myeloid, somatic",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "leukemia, acute myeloid, susceptibility to, autosomal dominant, somatic mutation",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "leukemia, myelocytic, acute",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "myeloid leukemia, acute",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "myeloid leukemia, acute, M4/M4Eo subtype, somatic",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "acute non lymphoblastic leukaemia",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "acute non lymphoblastic leukemia",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "leukemia, acute myelogenous",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "leukemia, acute myeloid",
                    "description": ""
                },
                {
                    "id": "MONDO:0018874",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0018874",
                    "name": "leukemia, acute myeloid, susceptibility to",
                    "description": ""
                },
                {
                    "id": "MIM:601626",
                    "resource": "MIM",
                    "url": "https://www.omim.org/entry/601626",
                    "name": "Leukemia, acute myelogenous",
                    "description": "Leukemia, acute myelogenous"
                }
            ],
            "evidence": [
                {
                    "id": "601626",
                    "database": "MIM",
                    "url": "https://www.omim.org/entry/601626"
                }
            ]
        },
        {
            "disease_id": "DOID:9253",
            "recommended_name": {
                "id": "DOID:9253",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:9253",
                "name": "gastrointestinal stromal tumor",
                "description": ""
            },
            "synonyms": [
                {
                    "id": "DOID:9253",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:9253",
                    "name": "GANT",
                    "description": ""
                },
                {
                    "id": "DOID:9253",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:9253",
                    "name": "GIST",
                    "description": ""
                },
                {
                    "id": "DOID:9253",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:9253",
                    "name": "Stromal tumor of gastrointestinal tract",
                    "description": ""
                },
                {
                    "id": "DOID:9253",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:9253",
                    "name": "Stromal tumour of gastrointestinal tract",
                    "description": ""
                },
                {
                    "id": "DOID:9253",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:9253",
                    "name": "gastrointestinal stromal tumour",
                    "description": ""
                },
                {
                    "id": "MONDO:0011719",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                    "name": "gastrointestinal stromal tumor",
                    "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                },
                {
                    "id": "MONDO:0011719",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                    "name": "gant",
                    "description": ""
                },
                {
                    "id": "MONDO:0011719",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                    "name": "gastrointestinal stromal neoplasm",
                    "description": ""
                },
                {
                    "id": "MONDO:0011719",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                    "name": "gastrointestinal stromal sarcoma",
                    "description": ""
                },
                {
                    "id": "MONDO:0011719",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                    "name": "gastrointestinal stromal tumor",
                    "description": ""
                },
                {
                    "id": "MONDO:0011719",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                    "name": "gastrointestinal stromal tumor (gist)",
                    "description": ""
                },
                {
                    "id": "MONDO:0011719",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                    "name": "gastrointestinal stromal tumor, familial, isolated cases",
                    "description": ""
                },
                {
                    "id": "MONDO:0011719",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                    "name": "gastrointestinal stromal tumor, isolated cases",
                    "description": ""
                },
                {
                    "id": "MONDO:0011719",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                    "name": "gastrointestinal stromal tumour (gist)",
                    "description": ""
                },
                {
                    "id": "MONDO:0011719",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                    "name": "gist",
                    "description": ""
                },
                {
                    "id": "MONDO:0011719",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                    "name": "stromal tumor of gastrointestinal tract",
                    "description": ""
                },
                {
                    "id": "MONDO:0011719",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                    "name": "stromal tumour of gastrointestinal tract",
                    "description": ""
                },
                {
                    "id": "MONDO:0011719",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                    "name": "gastrointestinal stromal tumors",
                    "description": ""
                },
                {
                    "id": "MONDO:0011719",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                    "name": "gastrointestinal stromal tumours",
                    "description": ""
                },
                {
                    "id": "MIM:606764",
                    "resource": "MIM",
                    "url": "https://www.omim.org/entry/606764",
                    "name": "Gastrointestinal stromal tumor",
                    "description": "Gastrointestinal stromal tumor"
                }
            ],
            "evidence": [
                {
                    "id": "606764",
                    "database": "MIM",
                    "url": "https://www.omim.org/entry/606764"
                }
            ]
        }
    ],
    "snv": [
        {
            "evidence": [
                {
                    "id": "P10721",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10721"
                }
            ],
            "glycoeffect": [],
            "start_pos": 822,
            "end_pos": 822,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "N",
            "sequence_mut": "K",
            "comment": "Somatic mutation passed 3 out of 6 filters: num. of cancers (5); DB annot. (1); Lit. mined (9).",
            "chr_id": "4",
            "chr_pos": "54733174",
            "ref_nt": "T",
            "alt_nt": "A",
            "minor_allelic_frequency": "",
            "site_lbl": "N822",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                },
                {
                    "disease_id": "DOID:1324",
                    "recommended_name": {
                        "id": "DOID:1324",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1324",
                        "name": "lung cancer",
                        "description": "A respiratory system cancer that is located_in the lung."
                    },
                    "synonyms": [
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "LNCR1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "LNCR3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "adenocarcinoma of lung, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "LNCR4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "LNCR5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": "A malignant neoplasm involving the lung."
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "cancer of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "Nonsmall cell lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "alveolar cell carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MIM:211980",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/211980",
                            "name": "Lung cancer",
                            "description": "Lung cancer"
                        }
                    ]
                },
                {
                    "disease_id": "DOID:4159",
                    "recommended_name": {
                        "id": "DOID:4159",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:4159",
                        "name": "skin cancer",
                        "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:4159",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:4159",
                            "name": "CA - skin cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:4159",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:4159",
                            "name": "malignant neoplasm of skin",
                            "description": ""
                        },
                        {
                            "id": "DOID:4159",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:4159",
                            "name": "melanoma and Non-melanoma skin cancer",
                            "description": ""
                        }
                    ]
                },
                {
                    "disease_id": "DOID:2531",
                    "recommended_name": {
                        "id": "DOID:2531",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:2531",
                        "name": "hematologic cancer",
                        "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "Hematologic malignancy",
                            "description": ""
                        },
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "Hematologic neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "Hematological tumors",
                            "description": ""
                        },
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "blood cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "hematopoietic and lymphoid system tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "hematopoietic cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "hematopoietic neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "hematopoietic tumors",
                            "description": ""
                        },
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "malignant hematopoietic neoplasm",
                            "description": ""
                        }
                    ]
                },
                {
                    "disease_id": "DOID:2994",
                    "recommended_name": {
                        "id": "DOID:2994",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:2994",
                        "name": "germ cell cancer",
                        "description": "A cell type cancer that has_material_basis_in abnormally proliferating cells derives_from germ cells."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:2994",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2994",
                            "name": "malignant tumor of the germ cell",
                            "description": ""
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "P10721",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10721"
                }
            ],
            "glycoeffect": [],
            "start_pos": 559,
            "end_pos": 559,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "V",
            "sequence_mut": "D",
            "comment": "Somatic mutation passed 2 out of 6 filters: DB annot. (1); Lit. mined (1).",
            "chr_id": "4",
            "chr_pos": "54727444",
            "ref_nt": "T",
            "alt_nt": "A",
            "minor_allelic_frequency": "",
            "site_lbl": "V559",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "P10721",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10721"
                }
            ],
            "glycoeffect": [],
            "start_pos": 560,
            "end_pos": 560,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "V",
            "sequence_mut": "D",
            "comment": "Somatic mutation passed 2 out of 6 filters: DB annot. (1); Lit. mined (2).",
            "chr_id": "4",
            "chr_pos": "54727447",
            "ref_nt": "T",
            "alt_nt": "A",
            "minor_allelic_frequency": "",
            "site_lbl": "V560",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "P10721",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10721"
                }
            ],
            "glycoeffect": [
                "o-glyco-site-loss"
            ],
            "start_pos": 642,
            "end_pos": 642,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "K",
            "sequence_mut": "E",
            "comment": "Somatic mutation passed 2 out of 6 filters: DB annot. (1); Lit. mined (4). In dbSNP: rs121913512.",
            "chr_id": "4",
            "chr_pos": "54728055",
            "ref_nt": "A",
            "alt_nt": "G",
            "minor_allelic_frequency": "",
            "site_lbl": "K642",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "P10721",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10721"
                }
            ],
            "glycoeffect": [],
            "start_pos": 654,
            "end_pos": 654,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "V",
            "sequence_mut": "A",
            "comment": "Somatic mutation passed 2 out of 6 filters: DB annot. (1); Lit. mined (4).",
            "chr_id": "4",
            "chr_pos": "54728092",
            "ref_nt": "T",
            "alt_nt": "C",
            "minor_allelic_frequency": "",
            "site_lbl": "V654",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "P10721",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10721"
                }
            ],
            "glycoeffect": [
                "o-glyco-site-loss"
            ],
            "start_pos": 670,
            "end_pos": 670,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "T",
            "sequence_mut": "I",
            "comment": "Somatic mutation passed 2 out of 6 filters: DB annot. (1); Lit. mined (1).",
            "chr_id": "4",
            "chr_pos": "54729353",
            "ref_nt": "C",
            "alt_nt": "T",
            "minor_allelic_frequency": "",
            "site_lbl": "T670",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "P10721",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10721"
                }
            ],
            "glycoeffect": [],
            "start_pos": 816,
            "end_pos": 816,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "D",
            "sequence_mut": "H",
            "comment": "Somatic mutation passed 2 out of 6 filters: DB annot. (1); Lit. mined (7).",
            "chr_id": "4",
            "chr_pos": "54733154",
            "ref_nt": "G",
            "alt_nt": "C",
            "minor_allelic_frequency": "",
            "site_lbl": "D816",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "P10721",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10721"
                }
            ],
            "glycoeffect": [
                "o-glyco-site-loss"
            ],
            "start_pos": 823,
            "end_pos": 823,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "Y",
            "sequence_mut": "D",
            "comment": "Somatic mutation passed 2 out of 6 filters: DB annot. (1); Lit. mined (1).",
            "chr_id": "4",
            "chr_pos": "54733175",
            "ref_nt": "T",
            "alt_nt": "G",
            "minor_allelic_frequency": "",
            "site_lbl": "Y823",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs780922356",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780922356"
                },
                {
                    "id": "rs780922356",
                    "database": "ENSEMBL",
                    "url": "https://www.ensembl.org/id/rs780922356"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 107,
            "end_pos": 107,
            "sequence_org": "I",
            "sequence_mut": "S",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSI->NSS).",
            "chr_id": "4",
            "chr_pos": "54695764",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "I107",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs764213036",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764213036"
                },
                {
                    "id": "rs764213036",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764213036"
                },
                {
                    "id": "rs764213036",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs764213036"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 130,
            "end_pos": 130,
            "sequence_org": "N",
            "sequence_mut": "D",
            "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->DDT).",
            "chr_id": "4",
            "chr_pos": "54698334",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N130",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "ebi",
                "somatic",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs878853770",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs878853770"
                },
                {
                    "id": "rs878853770",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs878853770#frequency_tab"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 130,
            "end_pos": 130,
            "sequence_org": "N",
            "sequence_mut": "S",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->SDT).",
            "chr_id": "4",
            "chr_pos": "54703866",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N130",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "ebi",
                "germline",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1560395607",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1560395607"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 130,
            "end_pos": 130,
            "sequence_org": "N",
            "sequence_mut": "null",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->nullDT).",
            "chr_id": "4",
            "chr_pos": "54698335",
            "ref_nt": "l",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N130",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "ebi",
                "germline",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs756128407",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756128407"
                },
                {
                    "id": "rs756128407",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756128407"
                },
                {
                    "id": "rs756128407",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs756128407"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 132,
            "end_pos": 132,
            "sequence_org": "T",
            "sequence_mut": "A",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->NDA).",
            "chr_id": "4",
            "chr_pos": "54698340",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "T132",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "P10721",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10721"
                },
                {
                    "id": "rs766253584",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766253584"
                },
                {
                    "id": "rs766253584",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766253584"
                },
                {
                    "id": "rs766253584",
                    "database": "NCI-TCGA",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766253584"
                },
                {
                    "id": "rs766253584",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs766253584#frequency_tab"
                },
                {
                    "id": "rs766253584",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs766253584"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 132,
            "end_pos": 132,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "T",
            "sequence_mut": "M",
            "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NDT->NDM).",
            "chr_id": "4",
            "chr_pos": "54698341",
            "ref_nt": "C",
            "alt_nt": "T",
            "minor_allelic_frequency": "",
            "site_lbl": "T132",
            "disease": [
                {
                    "disease_id": "DOID:1319",
                    "recommended_name": {
                        "id": "DOID:1319",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1319",
                        "name": "brain cancer",
                        "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "BT - Brain tumour",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "adult brain tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "adult malignant brain neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "brain neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "brain neoplasm, adult",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "malignant brain tumour",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "malignant primary brain neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "malignant primary brain tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "malignant tumor of Brain",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "malignant tumor of adult brain",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "neoplasm of brain",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "primary brain neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "primary brain tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "primary malignant neoplasm of brain",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "tumor of the Brain",
                            "description": ""
                        }
                    ]
                },
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease",
                "ebi"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1410602158",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1410602158"
                },
                {
                    "id": "rs1410602158",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs1410602158"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 145,
            "end_pos": 145,
            "sequence_org": "N",
            "sequence_mut": "D",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->DYS).",
            "chr_id": "4",
            "chr_pos": "54698379",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N145",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1003144287",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1003144287"
                },
                {
                    "id": "rs1003144287",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs1003144287#frequency_tab"
                },
                {
                    "id": "rs1003144287",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs1003144287"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 145,
            "end_pos": 145,
            "sequence_org": "N",
            "sequence_mut": "S",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->SYS).",
            "chr_id": "4",
            "chr_pos": "54698380",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N145",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "ebi",
                "germline",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "P10721",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10721"
                }
            ],
            "glycoeffect": [],
            "start_pos": 257,
            "end_pos": 257,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "E",
            "sequence_mut": "D",
            "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).",
            "chr_id": "4",
            "chr_pos": "54703738",
            "ref_nt": "G",
            "alt_nt": "T",
            "minor_allelic_frequency": "",
            "site_lbl": "E257",
            "disease": [
                {
                    "disease_id": "DOID:1612",
                    "recommended_name": {
                        "id": "DOID:1612",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1612",
                        "name": "breast cancer",
                        "description": "A thoracic cancer that originates in the mammary gland."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "breast tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "malignant neoplasm of breast",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "malignant tumor of the breast",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "mammary cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "mammary tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "primary breast cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "hereditary breast carcinoma",
                            "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, lobular, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, protection against, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "familial breast cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "familial breast carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "familial cancer of breast",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "familial cancer of the breast",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "hereditary breast cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "hereditary breast carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, familial",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, familial Male",
                            "description": ""
                        },
                        {
                            "id": "MIM:114480",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/114480",
                            "name": "Breast cancer",
                            "description": "Breast cancer"
                        }
                    ]
                },
                {
                    "disease_id": "DOID:363",
                    "recommended_name": {
                        "id": "DOID:363",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:363",
                        "name": "uterine cancer",
                        "description": "A female reproductive organ cancer that is located_in the uterus."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "CA - cancer of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "Tumour of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "malignant neoplasm of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "malignant uterine tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "neoplasm of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "uterine tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "uterus neoplasm",
                            "description": ""
                        }
                    ]
                },
                {
                    "disease_id": "DOID:9256",
                    "recommended_name": {
                        "id": "DOID:9256",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9256",
                        "name": "colorectal cancer",
                        "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
                    },
                    "synonyms": [
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer",
                            "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of colorectum",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, advanced, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer with chromosomal instability, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectum cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectum neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of colorectum",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "CRC",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "large intestine cancer",
                            "description": ""
                        },
                        {
                            "id": "MIM:114500",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/114500",
                            "name": "Colorectal cancer",
                            "description": "Colorectal cancer"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs761984908",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761984908"
                },
                {
                    "id": "rs761984908",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761984908"
                },
                {
                    "id": "rs761984908",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs761984908"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain",
                "o-glyco-site-loss"
            ],
            "start_pos": 276,
            "end_pos": 276,
            "sequence_org": "T",
            "sequence_mut": "N",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TIS->NIS).",
            "chr_id": "4",
            "chr_pos": "54723689",
            "ref_nt": "A",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "T276",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "ebi",
                "germline",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1577992151",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1577992151"
                },
                {
                    "id": "rs1577992151",
                    "database": "ENSEMBL",
                    "url": "https://www.ensembl.org/id/rs1577992151"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 293,
            "end_pos": 293,
            "sequence_org": "N",
            "sequence_mut": "H",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->HNT).",
            "chr_id": "4",
            "chr_pos": "54725897",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N293",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "ebi",
                "germline",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "P10721",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10721"
                },
                {
                    "id": "rs1271071514",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1271071514"
                },
                {
                    "id": "rs1271071514",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs1271071514"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 293,
            "end_pos": 293,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "N",
            "sequence_mut": "K",
            "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NNT->KNT).",
            "chr_id": "4",
            "chr_pos": "54703846",
            "ref_nt": "T",
            "alt_nt": "G",
            "minor_allelic_frequency": "",
            "site_lbl": "N293",
            "disease": [
                {
                    "disease_id": "DOID:5041",
                    "recommended_name": {
                        "id": "DOID:5041",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:5041",
                        "name": "esophageal cancer",
                        "description": "A gastrointestinal system cancer that is located_in the esophagus."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "Ca lower third oesophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "Ca middle third oesophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "esophagus cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant neoplasm of distal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant neoplasm of lower third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant neoplasm of middle third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant neoplasm of proximal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant neoplasm of upper third esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant tumor of Distal Third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant tumor of Proximal Third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant tumor of abdominal esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant tumor of the middle Third of the esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal cancer",
                            "description": "A primary or metastatic malignant neoplasm involving the esophagus."
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "cancer of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "cancer of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal carcinoma, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal squamous cell carcinoma, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophagus cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant esophageal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant esophageal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant esophageal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant esophagus neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant esophagus tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of the esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of the oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant oesophagus neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant oesophagus tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of the esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of the oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "oesophagus cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Ca lower third esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Ca lower third oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Ca middle third esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Ca middle third oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of distal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of distal third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of lower third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of lower third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of middle third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of middle third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of proximal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of proximal third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of upper third esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of upper third oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of abdominal esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of distal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of proximal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of the middle third of the esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of abdominal oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of distal third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of proximal third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of the middle third of the oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Aerodigestive tract cancer, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Escc, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal squamous cell carcinoma, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "gastric cardia adenocarcinoma, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MIM:133239",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/133239",
                            "name": "Esophageal cancer",
                            "description": "Esophageal cancer"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease",
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs137909416",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs137909416"
                },
                {
                    "id": "rs137909416",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs137909416"
                },
                {
                    "id": "rs137909416",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs137909416#frequency_tab"
                },
                {
                    "id": "rs137909416",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs137909416"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 293,
            "end_pos": 293,
            "sequence_org": "N",
            "sequence_mut": "S",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->SNT).",
            "chr_id": "4",
            "chr_pos": "54703845",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N293",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                },
                {
                    "disease_id": "DOID:3263",
                    "recommended_name": {
                        "id": "DOID:3263",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:3263",
                        "name": "piebaldism",
                        "description": "An integumentary system disease characterized by congenital absence of melanocytes in areas of the skin and hair that has_material_basis_in heterozygous mutation in the KIT gene on chromosome 4q12."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:3263",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3263",
                            "name": "PIEBALD TRAIT",
                            "description": ""
                        },
                        {
                            "id": "DOID:3263",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3263",
                            "name": "Partial albinism",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008244",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008244",
                            "name": "piebaldism",
                            "description": "Piebaldism is a rare congenital pigmentation skin disorder characterized by the presence of hypopigmented and depigmented skin areas (leukoderma) on various parts of the body, preferentially on the forehead, chest, abdomen, upper arms, and lower extremities, that are associated with a white forelock (poliosis), and in some cases with hypopigmented and depigmented eyebrows and eyelashes."
                        },
                        {
                            "id": "MONDO:0008244",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008244",
                            "name": "partial albinism",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008244",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008244",
                            "name": "piebald trait",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008244",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008244",
                            "name": "piebaldism",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008244",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008244",
                            "name": "PBT",
                            "description": ""
                        },
                        {
                            "id": "MIM:172800",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/172800",
                            "name": "Piebald trait",
                            "description": "Piebald trait"
                        }
                    ]
                }
            ],
            "keywords": [
                "ebi",
                "germline",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1577963277",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1577963277"
                },
                {
                    "id": "rs1577963277",
                    "database": "ENSEMBL",
                    "url": "https://www.ensembl.org/id/rs1577963277"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 295,
            "end_pos": 295,
            "sequence_org": "T",
            "sequence_mut": "A",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->NNA).",
            "chr_id": "4",
            "chr_pos": "54703850",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "T295",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "P10721",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10721"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 295,
            "end_pos": 295,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "T",
            "sequence_mut": "I",
            "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NNT->NNI).",
            "chr_id": "4",
            "chr_pos": "54703851",
            "ref_nt": "C",
            "alt_nt": "T",
            "minor_allelic_frequency": "",
            "site_lbl": "T295",
            "disease": [
                {
                    "disease_id": "DOID:1324",
                    "recommended_name": {
                        "id": "DOID:1324",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1324",
                        "name": "lung cancer",
                        "description": "A respiratory system cancer that is located_in the lung."
                    },
                    "synonyms": [
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "LNCR1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "LNCR3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "adenocarcinoma of lung, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "LNCR4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "LNCR5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": "A malignant neoplasm involving the lung."
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "cancer of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "Nonsmall cell lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "alveolar cell carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MIM:211980",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/211980",
                            "name": "Lung cancer",
                            "description": "Lung cancer"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs878853770",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs878853770"
                },
                {
                    "id": "rs878853770",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs878853770#frequency_tab"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 300,
            "end_pos": 300,
            "sequence_org": "N",
            "sequence_mut": "S",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVT->SVT).",
            "chr_id": "4",
            "chr_pos": "54703866",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N300",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "ebi",
                "germline",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "P10721",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10721"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 316,
            "end_pos": 316,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "F",
            "sequence_mut": "S",
            "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NIF->NIS).",
            "chr_id": "4",
            "chr_pos": "54707119",
            "ref_nt": "T",
            "alt_nt": "C",
            "minor_allelic_frequency": "",
            "site_lbl": "F316",
            "disease": [
                {
                    "disease_id": "DOID:363",
                    "recommended_name": {
                        "id": "DOID:363",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:363",
                        "name": "uterine cancer",
                        "description": "A female reproductive organ cancer that is located_in the uterus."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "CA - cancer of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "Tumour of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "malignant neoplasm of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "malignant uterine tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "neoplasm of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "uterine tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "uterus neoplasm",
                            "description": ""
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs147540142",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147540142"
                },
                {
                    "id": "rs147540142",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs147540142"
                },
                {
                    "id": "rs147540142",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs147540142#frequency_tab"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 322,
            "end_pos": 322,
            "sequence_org": "T",
            "sequence_mut": "A",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->NTA).",
            "chr_id": "4",
            "chr_pos": "54707136",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "T322",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "ebi",
                "germline",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "P10721",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10721"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 322,
            "end_pos": 322,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "T",
            "sequence_mut": "I",
            "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTT->NTI).",
            "chr_id": "4",
            "chr_pos": "54707137",
            "ref_nt": "C",
            "alt_nt": "T",
            "minor_allelic_frequency": "",
            "site_lbl": "T322",
            "disease": [
                {
                    "disease_id": "DOID:1319",
                    "recommended_name": {
                        "id": "DOID:1319",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1319",
                        "name": "brain cancer",
                        "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "BT - Brain tumour",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "adult brain tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "adult malignant brain neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "brain neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "brain neoplasm, adult",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "malignant brain tumour",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "malignant primary brain neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "malignant primary brain tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "malignant tumor of Brain",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "malignant tumor of adult brain",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "neoplasm of brain",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "primary brain neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "primary brain tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "primary malignant neoplasm of brain",
                            "description": ""
                        },
                        {
                            "id": "DOID:1319",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1319",
                            "name": "tumor of the Brain",
                            "description": ""
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs372759291",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372759291"
                },
                {
                    "id": "rs372759291",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs372759291"
                },
                {
                    "id": "rs372759291",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs372759291#frequency_tab"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 352,
            "end_pos": 352,
            "sequence_org": "N",
            "sequence_mut": "K",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->KRT).",
            "chr_id": "4",
            "chr_pos": "54707228",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N352",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "ebi",
                "germline",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1560402002",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1560402002"
                },
                {
                    "id": "rs1560402002",
                    "database": "ENSEMBL",
                    "url": "https://www.ensembl.org/id/rs1560402002"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 352,
            "end_pos": 352,
            "sequence_org": "N",
            "sequence_mut": "S",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->SRT).",
            "chr_id": "4",
            "chr_pos": "54707227",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N352",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "ebi",
                "germline",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1469004426",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1469004426"
                },
                {
                    "id": "rs1469004426",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs1469004426"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 354,
            "end_pos": 354,
            "sequence_org": "T",
            "sequence_mut": "I",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->NRI).",
            "chr_id": "4",
            "chr_pos": "54707233",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "T354",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1372684329",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1372684329"
                },
                {
                    "id": "rs1372684329",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs1372684329"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 367,
            "end_pos": 367,
            "sequence_org": "N",
            "sequence_mut": "D",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->DES).",
            "chr_id": "4",
            "chr_pos": "54707271",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N367",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1060502552",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1060502552"
                },
                {
                    "id": "rs1060502552",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs1060502552#frequency_tab"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 367,
            "end_pos": 367,
            "sequence_org": "N",
            "sequence_mut": "S",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->SES).",
            "chr_id": "4",
            "chr_pos": "54707272",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N367",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1060502552",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1060502552"
                },
                {
                    "id": "rs1060502552",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs1060502552#frequency_tab"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 367,
            "end_pos": 367,
            "sequence_org": "N",
            "sequence_mut": "T",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->TES).",
            "chr_id": "4",
            "chr_pos": "54707272",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N367",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "ebi",
                "germline",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs746884875",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746884875"
                },
                {
                    "id": "rs746884875",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746884875"
                },
                {
                    "id": "rs746884875",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs746884875#frequency_tab"
                },
                {
                    "id": "rs746884875",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs746884875"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 369,
            "end_pos": 369,
            "sequence_org": "S",
            "sequence_mut": "N",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NES->NEN).",
            "chr_id": "4",
            "chr_pos": "54707278",
            "ref_nt": "A",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "S369",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "ebi",
                "germline",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1720996900",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1720996900"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain",
                "o-glyco-site-loss"
            ],
            "start_pos": 373,
            "end_pos": 373,
            "sequence_org": "Y",
            "sequence_mut": "N",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (YVS->NVS).",
            "chr_id": "4",
            "chr_pos": "54709425",
            "ref_nt": "A",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "Y373",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "ebi",
                "germline",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs778615486",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778615486"
                },
                {
                    "id": "rs778615486",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778615486"
                },
                {
                    "id": "rs778615486",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs778615486"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 402,
            "end_pos": 402,
            "sequence_org": "A",
            "sequence_mut": "T",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NAA->NAT).",
            "chr_id": "4",
            "chr_pos": "54709509",
            "ref_nt": "A",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "A402",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "ebi",
                "germline",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs878853760",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs878853760"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 425,
            "end_pos": 425,
            "sequence_org": "M",
            "sequence_mut": "T",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NGM->NGT).",
            "chr_id": "4",
            "chr_pos": "54723626",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "M425",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "ebi",
                "germline",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1577992151",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1577992151"
                },
                {
                    "id": "rs1577992151",
                    "database": "ENSEMBL",
                    "url": "https://www.ensembl.org/id/rs1577992151"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 463,
            "end_pos": 463,
            "sequence_org": "N",
            "sequence_mut": "H",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->HSS).",
            "chr_id": "4",
            "chr_pos": "54725897",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N463",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "ebi",
                "germline",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs763728676",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763728676"
                },
                {
                    "id": "rs763728676",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763728676"
                },
                {
                    "id": "rs763728676",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs763728676"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 465,
            "end_pos": 465,
            "sequence_org": "S",
            "sequence_mut": "F",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->NSF).",
            "chr_id": "4",
            "chr_pos": "54725904",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "S465",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "P10721",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10721"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 486,
            "end_pos": 486,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "N",
            "sequence_mut": "I",
            "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NGT->IGT).",
            "chr_id": "4",
            "chr_pos": "54725967",
            "ref_nt": "A",
            "alt_nt": "T",
            "minor_allelic_frequency": "",
            "site_lbl": "N486",
            "disease": [
                {
                    "disease_id": "DOID:11934",
                    "recommended_name": {
                        "id": "DOID:11934",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:11934",
                        "name": "head and neck cancer",
                        "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:11934",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11934",
                            "name": "head and neck neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:11934",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11934",
                            "name": "head and neck tumours",
                            "description": ""
                        },
                        {
                            "id": "DOID:11934",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11934",
                            "name": "head/neck neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:11934",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11934",
                            "name": "tumor of head and neck",
                            "description": ""
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs779134230",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779134230"
                },
                {
                    "id": "rs779134230",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779134230"
                },
                {
                    "id": "rs779134230",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs779134230"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss"
            ],
            "start_pos": 486,
            "end_pos": 486,
            "sequence_org": "N",
            "sequence_mut": "S",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).",
            "chr_id": "4",
            "chr_pos": "54725967",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N486",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs748451770",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748451770"
                },
                {
                    "id": "rs748451770",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748451770"
                },
                {
                    "id": "rs748451770",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs748451770"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 488,
            "end_pos": 488,
            "sequence_org": "T",
            "sequence_mut": "A",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->NGA).",
            "chr_id": "4",
            "chr_pos": "54725972",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "T488",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs56225530",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs56225530"
                },
                {
                    "id": "rs56225530",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs56225530"
                },
                {
                    "id": "rs56225530",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs56225530#frequency_tab"
                },
                {
                    "id": "rs56225530",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs56225530"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 488,
            "end_pos": 488,
            "sequence_org": "T",
            "sequence_mut": "M",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->NGM).",
            "chr_id": "4",
            "chr_pos": "54725973",
            "ref_nt": "T",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "T488",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "ebi",
                "germline",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs748451770",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748451770"
                },
                {
                    "id": "rs748451770",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748451770"
                },
                {
                    "id": "rs748451770",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs748451770"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-loss",
                "o-glyco-site-loss"
            ],
            "start_pos": 488,
            "end_pos": 488,
            "sequence_org": "T",
            "sequence_mut": "P",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->NGP).",
            "chr_id": "4",
            "chr_pos": "54725972",
            "ref_nt": "C",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "T488",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "ebi",
                "germline",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "P10721",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10721"
                }
            ],
            "glycoeffect": [],
            "start_pos": 49,
            "end_pos": 49,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "R",
            "sequence_mut": "H",
            "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).",
            "chr_id": "4",
            "chr_pos": "54695590",
            "ref_nt": "G",
            "alt_nt": "A",
            "minor_allelic_frequency": "",
            "site_lbl": "R49",
            "disease": [
                {
                    "disease_id": "DOID:2531",
                    "recommended_name": {
                        "id": "DOID:2531",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:2531",
                        "name": "hematologic cancer",
                        "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "Hematologic malignancy",
                            "description": ""
                        },
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "Hematologic neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "Hematological tumors",
                            "description": ""
                        },
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "blood cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "hematopoietic and lymphoid system tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "hematopoietic cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "hematopoietic neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "hematopoietic tumors",
                            "description": ""
                        },
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "malignant hematopoietic neoplasm",
                            "description": ""
                        }
                    ]
                },
                {
                    "disease_id": "DOID:2394",
                    "recommended_name": {
                        "id": "DOID:2394",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:2394",
                        "name": "ovarian cancer",
                        "description": "A female reproductive organ cancer that is located_in the ovary."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:2394",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2394",
                            "name": "malignant Ovarian tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:2394",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2394",
                            "name": "malignant tumour of ovary",
                            "description": ""
                        },
                        {
                            "id": "DOID:2394",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2394",
                            "name": "ovarian neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:2394",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2394",
                            "name": "ovary neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:2394",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2394",
                            "name": "primary ovarian cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:2394",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2394",
                            "name": "tumor of the Ovary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011931",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011931",
                            "name": "ovarian cancer, susceptibility to, 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011931",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011931",
                            "name": "OVCAS1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011931",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011931",
                            "name": "ovarian cancer, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011931",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011931",
                            "name": "ovarian cancer, susceptibility to, 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "ovarian cancer",
                            "description": "A primary or metastatic malignant neoplasm involving the ovary. Most primary malignant ovarian neoplasms are either carcinomas (serous, mucinous, or endometrioid adenocarcinomas) or malignant germ cell tumors. Metastatic malignant neoplasms to the ovary include carcinomas, lymphomas, and melanomas."
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "ovarian neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "ovary neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "tumor of the ovary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "tumour of the ovary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "cancer of ovary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "cancer of the ovary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "malignant neoplasm of ovary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "malignant neoplasm of the ovary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "malignant ovarian neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "malignant ovarian tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "malignant ovarian tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "malignant ovary neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "malignant tumor of ovary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "malignant tumor of the ovary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "malignant tumour of ovary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "malignant tumour of the ovary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "ovarian cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "ovarian cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "ovarian malignant tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "ovarian malignant tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "ovary cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "ovarian cancer, epithelial",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008170",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008170",
                            "name": "primary ovarian cancer",
                            "description": ""
                        },
                        {
                            "id": "MIM:167000",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/167000",
                            "name": "Ovarian cancer",
                            "description": "Ovarian cancer"
                        }
                    ]
                },
                {
                    "disease_id": "DOID:9256",
                    "recommended_name": {
                        "id": "DOID:9256",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9256",
                        "name": "colorectal cancer",
                        "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
                    },
                    "synonyms": [
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer",
                            "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of colorectum",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, advanced, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer with chromosomal instability, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectum cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectum neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of colorectum",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "CRC",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "large intestine cancer",
                            "description": ""
                        },
                        {
                            "id": "MIM:114500",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/114500",
                            "name": "Colorectal cancer",
                            "description": "Colorectal cancer"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "P10721",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10721"
                }
            ],
            "glycoeffect": [],
            "start_pos": 560,
            "end_pos": 560,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "V",
            "sequence_mut": "G",
            "comment": "Somatic mutation passed 1 out of 6 filters: DB annot. (1).",
            "chr_id": "4",
            "chr_pos": "54727447",
            "ref_nt": "T",
            "alt_nt": "G",
            "minor_allelic_frequency": "",
            "site_lbl": "V560",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1722309800",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1722309800"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 566,
            "end_pos": 566,
            "sequence_org": "N",
            "sequence_mut": "S",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NGN->NGS).",
            "chr_id": "4",
            "chr_pos": "54727465",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N566",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "ebi",
                "germline",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "P10721",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10721"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 568,
            "end_pos": 568,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "Y",
            "sequence_mut": "S",
            "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NNY->NNS).",
            "chr_id": "4",
            "chr_pos": "54727471",
            "ref_nt": "A",
            "alt_nt": "C",
            "minor_allelic_frequency": "",
            "site_lbl": "Y568",
            "disease": [
                {
                    "disease_id": "DOID:9256",
                    "recommended_name": {
                        "id": "DOID:9256",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9256",
                        "name": "colorectal cancer",
                        "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
                    },
                    "synonyms": [
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer",
                            "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of colorectum",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, advanced, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer with chromosomal instability, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectum cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectum neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of colorectum",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "CRC",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "large intestine cancer",
                            "description": ""
                        },
                        {
                            "id": "MIM:114500",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/114500",
                            "name": "Colorectal cancer",
                            "description": "Colorectal cancer"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "P10721",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10721"
                }
            ],
            "glycoeffect": [],
            "start_pos": 576,
            "end_pos": 576,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "L",
            "sequence_mut": "P",
            "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3). In dbSNP: rs121913513.",
            "chr_id": "4",
            "chr_pos": "54727495",
            "ref_nt": "T",
            "alt_nt": "C",
            "minor_allelic_frequency": "",
            "site_lbl": "L576",
            "disease": [
                {
                    "disease_id": "DOID:4159",
                    "recommended_name": {
                        "id": "DOID:4159",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:4159",
                        "name": "skin cancer",
                        "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:4159",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:4159",
                            "name": "CA - skin cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:4159",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:4159",
                            "name": "malignant neoplasm of skin",
                            "description": ""
                        },
                        {
                            "id": "DOID:4159",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:4159",
                            "name": "melanoma and Non-melanoma skin cancer",
                            "description": ""
                        }
                    ]
                },
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                },
                {
                    "disease_id": "DOID:1324",
                    "recommended_name": {
                        "id": "DOID:1324",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1324",
                        "name": "lung cancer",
                        "description": "A respiratory system cancer that is located_in the lung."
                    },
                    "synonyms": [
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "LNCR1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "LNCR3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "adenocarcinoma of lung, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "LNCR4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "LNCR5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": "A malignant neoplasm involving the lung."
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "cancer of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "Nonsmall cell lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "alveolar cell carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MIM:211980",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/211980",
                            "name": "Lung cancer",
                            "description": "Lung cancer"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs56094246",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs56094246"
                },
                {
                    "id": "rs56094246",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs56094246#frequency_tab"
                },
                {
                    "id": "rs56094246",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs56094246"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain",
                "o-glyco-site-loss"
            ],
            "start_pos": 715,
            "end_pos": 715,
            "sequence_org": "S",
            "sequence_mut": "N",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SDS->NDS).",
            "chr_id": "4",
            "chr_pos": "54731330",
            "ref_nt": "A",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "S715",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "ebi",
                "germline",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "P10721",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10721"
                },
                {
                    "id": "rs769701248",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769701248"
                },
                {
                    "id": "rs769701248",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769701248"
                },
                {
                    "id": "rs769701248",
                    "database": "NCI-TCGA",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769701248"
                },
                {
                    "id": "rs769701248",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs769701248#frequency_tab"
                },
                {
                    "id": "rs769701248",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs769701248"
                },
                {
                    "id": "15685537",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/15685537"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 716,
            "end_pos": 716,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "D",
            "sequence_mut": "N",
            "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DST->NST).",
            "chr_id": "4",
            "chr_pos": "54731332",
            "ref_nt": "G",
            "alt_nt": "A",
            "minor_allelic_frequency": "",
            "site_lbl": "D716",
            "disease": [
                {
                    "disease_id": "DOID:363",
                    "recommended_name": {
                        "id": "DOID:363",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:363",
                        "name": "uterine cancer",
                        "description": "A female reproductive organ cancer that is located_in the uterus."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "CA - cancer of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "Tumour of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "malignant neoplasm of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "malignant uterine tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "neoplasm of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "uterine tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "uterus neoplasm",
                            "description": ""
                        }
                    ]
                },
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease",
                "ebi"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1578001412",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1578001412"
                },
                {
                    "id": "rs1578001412",
                    "database": "ENSEMBL",
                    "url": "https://www.ensembl.org/id/rs1578001412"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain",
                "o-glyco-site-loss"
            ],
            "start_pos": 771,
            "end_pos": 771,
            "sequence_org": "S",
            "sequence_mut": "N",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SFS->NFS).",
            "chr_id": "4",
            "chr_pos": "54731949",
            "ref_nt": "A",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "S771",
            "keywords": [
                "ebi",
                "germline"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs371353189",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371353189"
                },
                {
                    "id": "rs371353189",
                    "database": "ExAC",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs371353189"
                },
                {
                    "id": "rs371353189",
                    "database": "TOPMed",
                    "url": "https://www.ncbi.nlm.nih.gov/snp/rs371353189#frequency_tab"
                },
                {
                    "id": "rs371353189",
                    "database": "gnomAD",
                    "url": "http://gnomad.broadinstitute.org/awesome?query=rs371353189"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 77,
            "end_pos": 77,
            "sequence_org": "N",
            "sequence_mut": "S",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NEN->NES).",
            "chr_id": "4",
            "chr_pos": "54695674",
            "ref_nt": "G",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "N77",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "ebi",
                "germline",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "P10721",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10721"
                }
            ],
            "glycoeffect": [],
            "start_pos": 816,
            "end_pos": 816,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "D",
            "sequence_mut": "V",
            "comment": "Somatic mutation passed 1 out of 6 filters: Lit. mined (32).",
            "chr_id": "4",
            "chr_pos": "54733155",
            "ref_nt": "A",
            "alt_nt": "T",
            "minor_allelic_frequency": "",
            "site_lbl": "D816",
            "disease": [
                {
                    "disease_id": "DOID:2531",
                    "recommended_name": {
                        "id": "DOID:2531",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:2531",
                        "name": "hematologic cancer",
                        "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "Hematologic malignancy",
                            "description": ""
                        },
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "Hematologic neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "Hematological tumors",
                            "description": ""
                        },
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "blood cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "hematopoietic and lymphoid system tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "hematopoietic cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "hematopoietic neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "hematopoietic tumors",
                            "description": ""
                        },
                        {
                            "id": "DOID:2531",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:2531",
                            "name": "malignant hematopoietic neoplasm",
                            "description": ""
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "P10721",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10721"
                }
            ],
            "glycoeffect": [],
            "start_pos": 820,
            "end_pos": 820,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "D",
            "sequence_mut": "G",
            "comment": "Somatic mutation passed 1 out of 6 filters: DB annot. (1).",
            "chr_id": "4",
            "chr_pos": "54733167",
            "ref_nt": "A",
            "alt_nt": "G",
            "minor_allelic_frequency": "",
            "site_lbl": "D820",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "P10721",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10721"
                }
            ],
            "glycoeffect": [],
            "start_pos": 820,
            "end_pos": 820,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "D",
            "sequence_mut": "Y",
            "comment": "Somatic mutation passed 1 out of 6 filters: Lit. mined (2).",
            "chr_id": "4",
            "chr_pos": "54733166",
            "ref_nt": "G",
            "alt_nt": "T",
            "minor_allelic_frequency": "",
            "site_lbl": "D820",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "P10721",
                    "database": "BioMuta",
                    "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10721"
                }
            ],
            "glycoeffect": [],
            "start_pos": 888,
            "end_pos": 888,
            "subjects_tested": "0",
            "subjects_positive": "0",
            "frequency": "0.0",
            "sequence_org": "R",
            "sequence_mut": "Q",
            "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).",
            "chr_id": "4",
            "chr_pos": "54736787",
            "ref_nt": "G",
            "alt_nt": "A",
            "minor_allelic_frequency": "",
            "site_lbl": "R888",
            "disease": [
                {
                    "disease_id": "DOID:9256",
                    "recommended_name": {
                        "id": "DOID:9256",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9256",
                        "name": "colorectal cancer",
                        "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
                    },
                    "synonyms": [
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer",
                            "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of colorectum",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, advanced, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer with chromosomal instability, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectum cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectum neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of colorectum",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "CRC",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "large intestine cancer",
                            "description": ""
                        },
                        {
                            "id": "MIM:114500",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/114500",
                            "name": "Colorectal cancer",
                            "description": "Colorectal cancer"
                        }
                    ]
                },
                {
                    "disease_id": "DOID:10283",
                    "recommended_name": {
                        "id": "DOID:10283",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:10283",
                        "name": "prostate cancer",
                        "description": "A male reproductive organ cancer that is located_in the prostate."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "NGP - new growth of prostate",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "hereditary prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "malignant tumor of the prostate",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "prostate cancer, familial",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "prostate neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "prostatic cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "prostatic neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "tumor of the prostate",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012597",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012597",
                            "name": "prostate cancer, hereditary, 9",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012597",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012597",
                            "name": "prostate cancer, hereditary, 9",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012597",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012597",
                            "name": "prostate cancer, hereditary, type 9",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012597",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012597",
                            "name": "HPC9",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "prostate cancer, hereditary, 12",
                            "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "EHBP1 familial prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "familial prostate cancer caused by mutation in EHBP1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "prostate cancer, hereditary, 12",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "prostate cancer, hereditary, type 12",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "HPC12",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012244",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012244",
                            "name": "prostate cancer, hereditary, 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012244",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012244",
                            "name": "prostate cancer, hereditary, 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012244",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012244",
                            "name": "prostate cancer, hereditary, type 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012244",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012244",
                            "name": "HPC5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012093",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012093",
                            "name": "prostate cancer, hereditary, 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012093",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012093",
                            "name": "prostate cancer, hereditary, 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012093",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012093",
                            "name": "prostate cancer, hereditary, type 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012093",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012093",
                            "name": "prostate cancer, susceptibility to, 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012093",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012093",
                            "name": "HPC3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "prostate cancer, hereditary, 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "prostate cancer, hereditary, 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "prostate cancer, hereditary, type 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "prostate cancer, susceptibility to, 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "HPC4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "prostate cancer, hereditary, on chromosome 7",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "prostate cancer, hereditary, 13",
                            "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "MSMB familial prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "familial prostate cancer caused by mutation in MSMB",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "prostate cancer, hereditary, 13",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "prostate cancer, hereditary, type 13",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "HPC13",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "prostate cancer, hereditary, 8",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "prostate cancer, hereditary, 8",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "prostate cancer, hereditary, type 8",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "HPC8",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "predisposing for prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "prostate cancer, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012300",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012300",
                            "name": "prostate cancer, hereditary, 6",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012300",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012300",
                            "name": "prostate cancer, hereditary, 6",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012300",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012300",
                            "name": "prostate cancer, hereditary, type 6",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012300",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012300",
                            "name": "HPC6",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012300",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012300",
                            "name": "prostate cancer, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012620",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012620",
                            "name": "prostate cancer, hereditary, 10",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012620",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012620",
                            "name": "HPC10",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012620",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012620",
                            "name": "prostate cancer, hereditary, 10",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "familial prostate carcinoma",
                            "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "familial prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "hereditary prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "hereditary prostate carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, familial",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, hereditary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012470",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012470",
                            "name": "prostate cancer, hereditary, 7",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012470",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012470",
                            "name": "HPC7",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012470",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012470",
                            "name": "prostate cancer, hereditary, 7",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012470",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012470",
                            "name": "prostate cancer aggressiveness",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "prostate cancer, hereditary, 1",
                            "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "RNASEL familial prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "familial prostate cancer caused by mutation in RNASEL",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "prostate cancer 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "prostate cancer, hereditary, 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "prostate cancer, hereditary, type 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "HPC1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "Prca1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012768",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012768",
                            "name": "prostate cancer, hereditary, 11",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012768",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012768",
                            "name": "HPC11",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012768",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012768",
                            "name": "prostate cancer, hereditary, 11",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012769",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012769",
                            "name": "prostate cancer, hereditary, 14",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012769",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012769",
                            "name": "HPC14",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012769",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012769",
                            "name": "prostate cancer, hereditary, 14",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012770",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012770",
                            "name": "prostate cancer, hereditary, 15",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012770",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012770",
                            "name": "HPC15",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012770",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012770",
                            "name": "prostate cancer, hereditary, 15",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010257",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010257",
                            "name": "prostate cancer, hereditary, X-linked 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010257",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010257",
                            "name": "HPCX1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010257",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010257",
                            "name": "prostate cancer, hereditary, X-linked 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010257",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010257",
                            "name": "prostate cancer susceptibility, X-linked",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010405",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010405",
                            "name": "prostate cancer, hereditary, X-linked 2",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010405",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010405",
                            "name": "HPCX2",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010405",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010405",
                            "name": "prostate cancer, hereditary, X-linked 2",
                            "description": ""
                        },
                        {
                            "id": "MIM:611868",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/611868",
                            "name": "Prostate cancer, hereditary, 12",
                            "description": "Prostate cancer, hereditary, 12"
                        },
                        {
                            "id": "MIM:611928",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/611928",
                            "name": "Prostate cancer, hereditary, 13",
                            "description": "Prostate cancer, hereditary, 13"
                        },
                        {
                            "id": "MIM:176807",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/176807",
                            "name": "Prostate cancer",
                            "description": "Prostate cancer"
                        },
                        {
                            "id": "MIM:601518",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/601518",
                            "name": "Prostate cancer, hereditary, 1",
                            "description": "Prostate cancer, hereditary, 1"
                        },
                        {
                            "id": "MIM:611955",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/611955",
                            "name": "Prostate cancer, hereditary, 11",
                            "description": "Prostate cancer, hereditary, 11"
                        }
                    ]
                },
                {
                    "disease_id": "DOID:363",
                    "recommended_name": {
                        "id": "DOID:363",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:363",
                        "name": "uterine cancer",
                        "description": "A female reproductive organ cancer that is located_in the uterus."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "CA - cancer of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "Tumour of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "malignant neoplasm of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "malignant uterine tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "neoplasm of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "uterine tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "uterus neoplasm",
                            "description": ""
                        }
                    ]
                }
            ],
            "keywords": [
                "biomuta",
                "somatic",
                "cancer",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1720018880",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1720018880"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain",
                "o-glyco-site-loss"
            ],
            "start_pos": 90,
            "end_pos": 90,
            "sequence_org": "T",
            "sequence_mut": "N",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TNT->NNT).",
            "chr_id": "4",
            "chr_pos": "54695713",
            "ref_nt": "A",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "T90",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "ebi",
                "germline",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1720020252",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1720020252"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 93,
            "end_pos": 93,
            "sequence_org": "G",
            "sequence_mut": "S",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NTG->NTS).",
            "chr_id": "4",
            "chr_pos": "54695721",
            "ref_nt": "A",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "G93",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "ebi",
                "germline",
                "disease"
            ]
        },
        {
            "evidence": [
                {
                    "id": "rs1578009883",
                    "database": "dbSNP",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1578009883"
                },
                {
                    "id": "rs1578009883",
                    "database": "ENSEMBL",
                    "url": "https://www.ensembl.org/id/rs1578009883"
                }
            ],
            "glycoeffect": [
                "n-glyco-sequon-gain"
            ],
            "start_pos": 952,
            "end_pos": 952,
            "sequence_org": "D",
            "sequence_mut": "N",
            "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DHS->NHS).",
            "chr_id": "4",
            "chr_pos": "54738480",
            "ref_nt": "A",
            "alt_nt": "null",
            "minor_allelic_frequency": "",
            "site_lbl": "D952",
            "disease": [
                {
                    "disease_id": "DOID:9253",
                    "recommended_name": {
                        "id": "DOID:9253",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9253",
                        "name": "gastrointestinal stromal tumor",
                        "description": ""
                    },
                    "synonyms": [
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GANT",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "GIST",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "Stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "DOID:9253",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:9253",
                            "name": "gastrointestinal stromal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor (GIST) is the most common mesenchymal neoplasm of the gastrointestinal (GI) tract, typically presenting in adults over the age of 40 (mean age 63), and only rarely in children, in various regions of the GI tract, most commonly the stomach or small intestine but also less commonly in the esophagus, appendix, rectum and colon. GISTs can be asymptomatic or present with various non-specific signs, depending on the location and size of tumor, such as loss of appetite, anemia, weight loss, fatigue, abdominal discomfort or fullness, nausea, vomiting, as well as an abdominal mass, blood in stool, and intestinal obstruction. GISTs can also be seen in familial syndromes such as Carney triad and neurofibromatosis type 1."
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gant",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal sarcoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, familial, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumor, isolated cases",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumour (gist)",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gist",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumor of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "stromal tumour of gastrointestinal tract",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumors",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011719",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011719",
                            "name": "gastrointestinal stromal tumours",
                            "description": ""
                        },
                        {
                            "id": "MIM:606764",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/606764",
                            "name": "Gastrointestinal stromal tumor",
                            "description": "Gastrointestinal stromal tumor"
                        }
                    ]
                }
            ],
            "keywords": [
                "ebi",
                "germline",
                "disease"
            ]
        }
    ],
    "mutagenesis": [
        {
            "start_pos": 381,
            "end_pos": 381,
            "sequence_org": "R",
            "sequence_mut": "A",
            "comment": "Reduces autophosphorylation in response to KITLG/SCF.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "17662946",
                    "url": "https://glygen.org/publication/PubMed/17662946"
                }
            ]
        },
        {
            "start_pos": 386,
            "end_pos": 386,
            "sequence_org": "E",
            "sequence_mut": "A",
            "comment": "Reduces autophosphorylation in response to KITLG/SCF.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "17662946",
                    "url": "https://glygen.org/publication/PubMed/17662946"
                }
            ]
        },
        {
            "start_pos": 571,
            "end_pos": 571,
            "sequence_org": "I",
            "sequence_mut": "A",
            "comment": "Reduction in SH2B2/APS binding. Abolishes SH2B2/APS binding; when associated with A-939.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "12444928",
                    "url": "https://glygen.org/publication/PubMed/12444928"
                }
            ]
        },
        {
            "start_pos": 623,
            "end_pos": 623,
            "sequence_org": "K",
            "sequence_mut": "M",
            "comment": "Stronger interaction with MPDZ.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "11018522",
                    "url": "https://glygen.org/publication/PubMed/11018522"
                }
            ]
        },
        {
            "start_pos": 741,
            "end_pos": 741,
            "sequence_org": "S",
            "sequence_mut": "A",
            "comment": "Abolishes down-regulation of kinase activity by PKC/PRKCA-mediated phosphorylation; when associated with A-746.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "7539802",
                    "url": "https://glygen.org/publication/PubMed/7539802"
                }
            ]
        },
        {
            "start_pos": 746,
            "end_pos": 746,
            "sequence_org": "S",
            "sequence_mut": "A",
            "comment": "Abolishes down-regulation of kinase activity by PKC/PRKCA-mediated phosphorylation; when associated with A-741.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "7539802",
                    "url": "https://glygen.org/publication/PubMed/7539802"
                }
            ]
        },
        {
            "start_pos": 823,
            "end_pos": 823,
            "sequence_org": "Y",
            "sequence_mut": "F",
            "comment": "No decrease in activity. Leads to autophosphorylation at Tyr-900.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "20147452",
                    "url": "https://glygen.org/publication/PubMed/20147452"
                }
            ]
        },
        {
            "start_pos": 939,
            "end_pos": 939,
            "sequence_org": "L",
            "sequence_mut": "A",
            "comment": "Reduction in SH2B2/APS binding. Abolishes SH2B2/APS binding; when associated with A-571.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "12444928",
                    "url": "https://glygen.org/publication/PubMed/12444928"
                }
            ]
        }
    ],
    "expression_tissue": [
        {
            "tissue": {
                "name": "Adult mammalian kidney",
                "namespace": "UBERON",
                "id": "0000082",
                "url": "http://purl.obolibrary.org/obo/UBERON_0000082"
            },
            "score": "85.95",
            "present": "HIGH",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000157404",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157404"
                }
            ]
        },
        {
            "tissue": {
                "name": "Oral cavity",
                "namespace": "UBERON",
                "id": "0000167",
                "url": "http://purl.obolibrary.org/obo/UBERON_0000167"
            },
            "score": "74.86",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000157404",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157404"
                }
            ]
        },
        {
            "tissue": {
                "name": "Stomach",
                "namespace": "UBERON",
                "id": "0000945",
                "url": "http://purl.obolibrary.org/obo/UBERON_0000945"
            },
            "score": "87.43",
            "present": "HIGH",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000157404",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157404"
                }
            ]
        },
        {
            "tissue": {
                "name": "Uterus",
                "namespace": "UBERON",
                "id": "0000995",
                "url": "http://purl.obolibrary.org/obo/UBERON_0000995"
            },
            "score": "61.37",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000157404",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157404"
                }
            ]
        },
        {
            "tissue": {
                "name": "Esophagus",
                "namespace": "UBERON",
                "id": "0001043",
                "url": "http://purl.obolibrary.org/obo/UBERON_0001043"
            },
            "score": "82.97",
            "present": "HIGH",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000157404",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157404"
                }
            ]
        },
        {
            "tissue": {
                "name": "Rectum",
                "namespace": "UBERON",
                "id": "0001052",
                "url": "http://purl.obolibrary.org/obo/UBERON_0001052"
            },
            "score": "87.47",
            "present": "HIGH",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000157404",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157404"
                }
            ]
        },
        {
            "tissue": {
                "name": "Colon",
                "namespace": "UBERON",
                "id": "0001155",
                "url": "http://purl.obolibrary.org/obo/UBERON_0001155"
            },
            "score": "73.28",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000157404",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157404"
                }
            ]
        },
        {
            "tissue": {
                "name": "Urinary bladder",
                "namespace": "UBERON",
                "id": "0001255",
                "url": "http://purl.obolibrary.org/obo/UBERON_0001255"
            },
            "score": "85.32",
            "present": "HIGH",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000157404",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157404"
                }
            ]
        },
        {
            "tissue": {
                "name": "Thyroid gland",
                "namespace": "UBERON",
                "id": "0002046",
                "url": "http://purl.obolibrary.org/obo/UBERON_0002046"
            },
            "score": "85.26",
            "present": "HIGH",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000157404",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157404"
                }
            ]
        },
        {
            "tissue": {
                "name": "Lung",
                "namespace": "UBERON",
                "id": "0002048",
                "url": "http://purl.obolibrary.org/obo/UBERON_0002048"
            },
            "score": "90.38",
            "present": "HIGH",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000157404",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157404"
                }
            ]
        },
        {
            "tissue": {
                "name": "Liver",
                "namespace": "UBERON",
                "id": "0002107",
                "url": "http://purl.obolibrary.org/obo/UBERON_0002107"
            },
            "score": "65.61",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000157404",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157404"
                }
            ]
        },
        {
            "tissue": {
                "name": "Prostate gland",
                "namespace": "UBERON",
                "id": "0002367",
                "url": "http://purl.obolibrary.org/obo/UBERON_0002367"
            },
            "score": "73.92",
            "present": "MEDIUM",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000157404",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157404"
                }
            ]
        },
        {
            "tissue": {
                "name": "Thoracic mammary gland",
                "namespace": "UBERON",
                "id": "0005200",
                "url": "http://purl.obolibrary.org/obo/UBERON_0005200"
            },
            "score": "87.99",
            "present": "HIGH",
            "evidence": [
                {
                    "database": "Bgee",
                    "id": "ENSG00000157404",
                    "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157404"
                }
            ]
        }
    ],
    "expression_disease": [
        {
            "significant": "Yes",
            "trend": "down",
            "name": "Prostate cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:10283",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P10721",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10721"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:10283",
                    "recommended_name": {
                        "id": "DOID:10283",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:10283",
                        "name": "prostate cancer",
                        "description": "A male reproductive organ cancer that is located_in the prostate."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "NGP - new growth of prostate",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "hereditary prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "malignant tumor of the prostate",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "prostate cancer, familial",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "prostate neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "prostatic cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "prostatic neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:10283",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10283",
                            "name": "tumor of the prostate",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012597",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012597",
                            "name": "prostate cancer, hereditary, 9",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012597",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012597",
                            "name": "prostate cancer, hereditary, 9",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012597",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012597",
                            "name": "prostate cancer, hereditary, type 9",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012597",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012597",
                            "name": "HPC9",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "prostate cancer, hereditary, 12",
                            "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "EHBP1 familial prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "familial prostate cancer caused by mutation in EHBP1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "prostate cancer, hereditary, 12",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "prostate cancer, hereditary, type 12",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012741",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012741",
                            "name": "HPC12",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012244",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012244",
                            "name": "prostate cancer, hereditary, 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012244",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012244",
                            "name": "prostate cancer, hereditary, 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012244",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012244",
                            "name": "prostate cancer, hereditary, type 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012244",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012244",
                            "name": "HPC5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012093",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012093",
                            "name": "prostate cancer, hereditary, 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012093",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012093",
                            "name": "prostate cancer, hereditary, 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012093",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012093",
                            "name": "prostate cancer, hereditary, type 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012093",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012093",
                            "name": "prostate cancer, susceptibility to, 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012093",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012093",
                            "name": "HPC3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "prostate cancer, hereditary, 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "prostate cancer, hereditary, 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "prostate cancer, hereditary, type 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "prostate cancer, susceptibility to, 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "HPC4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012094",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012094",
                            "name": "prostate cancer, hereditary, on chromosome 7",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "prostate cancer, hereditary, 13",
                            "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "MSMB familial prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "familial prostate cancer caused by mutation in MSMB",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "prostate cancer, hereditary, 13",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "prostate cancer, hereditary, type 13",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012758",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012758",
                            "name": "HPC13",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "prostate cancer, hereditary, 8",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "prostate cancer, hereditary, 8",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "prostate cancer, hereditary, type 8",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "HPC8",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "predisposing for prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011270",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011270",
                            "name": "prostate cancer, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012300",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012300",
                            "name": "prostate cancer, hereditary, 6",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012300",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012300",
                            "name": "prostate cancer, hereditary, 6",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012300",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012300",
                            "name": "prostate cancer, hereditary, type 6",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012300",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012300",
                            "name": "HPC6",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012300",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012300",
                            "name": "prostate cancer, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012620",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012620",
                            "name": "prostate cancer, hereditary, 10",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012620",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012620",
                            "name": "HPC10",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012620",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012620",
                            "name": "prostate cancer, hereditary, 10",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "familial prostate carcinoma",
                            "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "familial prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "hereditary prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "hereditary prostate carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, familial",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0023122",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0023122",
                            "name": "prostate cancer, hereditary",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012470",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012470",
                            "name": "prostate cancer, hereditary, 7",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012470",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012470",
                            "name": "HPC7",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012470",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012470",
                            "name": "prostate cancer, hereditary, 7",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012470",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012470",
                            "name": "prostate cancer aggressiveness",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "prostate cancer, hereditary, 1",
                            "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "RNASEL familial prostate cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "familial prostate cancer caused by mutation in RNASEL",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "prostate cancer 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "prostate cancer, hereditary, 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "prostate cancer, hereditary, type 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "HPC1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0011098",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0011098",
                            "name": "Prca1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012768",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012768",
                            "name": "prostate cancer, hereditary, 11",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012768",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012768",
                            "name": "HPC11",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012768",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012768",
                            "name": "prostate cancer, hereditary, 11",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012769",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012769",
                            "name": "prostate cancer, hereditary, 14",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012769",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012769",
                            "name": "HPC14",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012769",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012769",
                            "name": "prostate cancer, hereditary, 14",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012770",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012770",
                            "name": "prostate cancer, hereditary, 15",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012770",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012770",
                            "name": "HPC15",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012770",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012770",
                            "name": "prostate cancer, hereditary, 15",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010257",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010257",
                            "name": "prostate cancer, hereditary, X-linked 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010257",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010257",
                            "name": "HPCX1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010257",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010257",
                            "name": "prostate cancer, hereditary, X-linked 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010257",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010257",
                            "name": "prostate cancer susceptibility, X-linked",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010405",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010405",
                            "name": "prostate cancer, hereditary, X-linked 2",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010405",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010405",
                            "name": "HPCX2",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0010405",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0010405",
                            "name": "prostate cancer, hereditary, X-linked 2",
                            "description": ""
                        },
                        {
                            "id": "MIM:611868",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/611868",
                            "name": "Prostate cancer, hereditary, 12",
                            "description": "Prostate cancer, hereditary, 12"
                        },
                        {
                            "id": "MIM:611928",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/611928",
                            "name": "Prostate cancer, hereditary, 13",
                            "description": "Prostate cancer, hereditary, 13"
                        },
                        {
                            "id": "MIM:176807",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/176807",
                            "name": "Prostate cancer",
                            "description": "Prostate cancer"
                        },
                        {
                            "id": "MIM:601518",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/601518",
                            "name": "Prostate cancer, hereditary, 1",
                            "description": "Prostate cancer, hereditary, 1"
                        },
                        {
                            "id": "MIM:611955",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/611955",
                            "name": "Prostate cancer, hereditary, 11",
                            "description": "Prostate cancer, hereditary, 11"
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "down",
            "name": "Stomach cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:10534",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P10721",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10721"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:10534",
                    "recommended_name": {
                        "id": "DOID:10534",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:10534",
                        "name": "stomach cancer",
                        "description": "A gastrointestinal system cancer that is located_in the stomach."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:10534",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10534",
                            "name": "gastric cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:10534",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:10534",
                            "name": "gastric neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer",
                            "description": "A primary or metastatic malignant neoplasm involving the stomach."
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "Ca lesser curvature - stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "cancer of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer risk after h. pylori infection",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant gastric neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant gastric tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant gastric tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant neoplasm of lesser curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant neoplasm of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant neoplasm of the stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant stomach neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of body of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of greater curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of lesser curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumor of the stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of body of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of greater curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of lesser curve of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant tumour of the stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "stomach cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "Ca body - stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "ca greater curvature of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "malignant neoplasm of body of stomach",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001056",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001056",
                            "name": "gastric cancer, intestinal",
                            "description": ""
                        },
                        {
                            "id": "MIM:613659",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/613659",
                            "name": "Gastric cancer",
                            "description": "Gastric cancer"
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "down",
            "name": "Urinary bladder cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:11054",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P10721",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10721"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:11054",
                    "recommended_name": {
                        "id": "DOID:11054",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:11054",
                        "name": "urinary bladder cancer",
                        "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:11054",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11054",
                            "name": "bladder cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:11054",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11054",
                            "name": "tumor of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder cancer",
                            "description": "A primary or metastatic malignant neoplasm involving the bladder."
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "tumor of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "tumour of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "bladder cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "cancer of urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant bladder neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant bladder tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant bladder tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm of bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm of the urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm of urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm, bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant neoplasm, urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor of bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor of the urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor of urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumor, urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumour of bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumour of the bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumour of the urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant tumour of urinary bladder",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant urinary bladder neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant urinary bladder tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "malignant urinary bladder tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder malignant neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder malignant tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0001187",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0001187",
                            "name": "urinary bladder malignant tumour",
                            "description": ""
                        },
                        {
                            "id": "MIM:109800",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/109800",
                            "name": "Bladder cancer",
                            "description": "Bladder cancer"
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "down",
            "name": "Head and neck cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:11934",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P10721",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10721"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:11934",
                    "recommended_name": {
                        "id": "DOID:11934",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:11934",
                        "name": "head and neck cancer",
                        "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:11934",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11934",
                            "name": "head and neck neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:11934",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11934",
                            "name": "head and neck tumours",
                            "description": ""
                        },
                        {
                            "id": "DOID:11934",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11934",
                            "name": "head/neck neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:11934",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:11934",
                            "name": "tumor of head and neck",
                            "description": ""
                        }
                    ]
                }
            ]
        },
        {
            "significant": "No",
            "trend": "down",
            "name": "Lung cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:1324",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P10721",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10721"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:1324",
                    "recommended_name": {
                        "id": "DOID:1324",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1324",
                        "name": "lung cancer",
                        "description": "A respiratory system cancer that is located_in the lung."
                    },
                    "synonyms": [
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "LNCR1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012159",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012159",
                            "name": "lung cancer susceptibility 1",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "LNCR3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "lung cancer susceptibility 3",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012942",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012942",
                            "name": "adenocarcinoma of lung, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "LNCR4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0012955",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0012955",
                            "name": "lung cancer susceptibility 4",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "LNCR5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0013631",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0013631",
                            "name": "lung cancer susceptibility 5",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": "A malignant neoplasm involving the lung."
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "adenocarcinoma of lung, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "cancer of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant lung tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant neoplasm of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumor of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "malignant tumour of the lung",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "Nonsmall cell lung cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "alveolar cell carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung cancer, protection against",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0008903",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0008903",
                            "name": "lung neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MIM:211980",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/211980",
                            "name": "Lung cancer",
                            "description": "Lung cancer"
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "down",
            "name": "Breast cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:1612",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P10721",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10721"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:1612",
                    "recommended_name": {
                        "id": "DOID:1612",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1612",
                        "name": "breast cancer",
                        "description": "A thoracic cancer that originates in the mammary gland."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "breast tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "malignant neoplasm of breast",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "malignant tumor of the breast",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "mammary cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "mammary tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:1612",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1612",
                            "name": "primary breast cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "hereditary breast carcinoma",
                            "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, lobular, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, protection against, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "familial breast cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "familial breast carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "familial cancer of breast",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "familial cancer of the breast",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "hereditary breast cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "hereditary breast carcinoma",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, familial",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0016419",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0016419",
                            "name": "breast cancer, familial Male",
                            "description": ""
                        },
                        {
                            "id": "MIM:114480",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/114480",
                            "name": "Breast cancer",
                            "description": "Breast cancer"
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "down",
            "name": "Thyroid cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:1781",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P10721",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10721"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:1781",
                    "recommended_name": {
                        "id": "DOID:1781",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:1781",
                        "name": "thyroid cancer",
                        "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:1781",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1781",
                            "name": "thyroid gland cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:1781",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1781",
                            "name": "Thyroid gland neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:1781",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1781",
                            "name": "malignant neoplasm of thyroid gland",
                            "description": ""
                        },
                        {
                            "id": "DOID:1781",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1781",
                            "name": "malignant tumour of thyroid gland",
                            "description": ""
                        },
                        {
                            "id": "DOID:1781",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1781",
                            "name": "neoplasm of thyroid gland",
                            "description": ""
                        },
                        {
                            "id": "DOID:1781",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:1781",
                            "name": "thyroid neoplasm",
                            "description": ""
                        }
                    ]
                }
            ]
        },
        {
            "significant": "No",
            "trend": "up",
            "name": "Kidney cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:263",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P10721",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10721"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:263",
                    "recommended_name": {
                        "id": "DOID:263",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:263",
                        "name": "kidney cancer",
                        "description": "A urinary system cancer that is located_in the kidney."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:263",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:263",
                            "name": "malignant neoplasm of kidney except pelvis",
                            "description": ""
                        },
                        {
                            "id": "DOID:263",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:263",
                            "name": "malignant tumour of kidney",
                            "description": ""
                        },
                        {
                            "id": "DOID:263",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:263",
                            "name": "renal cancer",
                            "description": ""
                        }
                    ]
                }
            ]
        },
        {
            "significant": "No",
            "trend": "up",
            "name": "Liver cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:3571",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P10721",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10721"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:3571",
                    "recommended_name": {
                        "id": "DOID:3571",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:3571",
                        "name": "liver cancer",
                        "description": "A hepatobiliary system cancer that is located_in the liver."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "Ca liver - primary",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "Resectable malignant neoplasm of Liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "hepatic cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "hepatic neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "malignant hepato-biliary neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "malignant neoplasm of liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "malignant neoplasm of liver, primary",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "malignant tumor of liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "neoplasm of liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "non-resectable primary hepatic malignant neoplasm",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "primary liver cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "primary malignant neoplasm of liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "resectable malignant neoplasm of the liver",
                            "description": ""
                        },
                        {
                            "id": "DOID:3571",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:3571",
                            "name": "malignant neoplasm of liver, not specified as primary or secondary",
                            "description": ""
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "down",
            "name": "Uterine cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:363",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P10721",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10721"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:363",
                    "recommended_name": {
                        "id": "DOID:363",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:363",
                        "name": "uterine cancer",
                        "description": "A female reproductive organ cancer that is located_in the uterus."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "CA - cancer of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "Tumour of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "malignant neoplasm of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "malignant uterine tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "neoplasm of uterus",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "uterine tumor",
                            "description": ""
                        },
                        {
                            "id": "DOID:363",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:363",
                            "name": "uterus neoplasm",
                            "description": ""
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "down",
            "name": "Esophageal cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:5041",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P10721",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10721"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:5041",
                    "recommended_name": {
                        "id": "DOID:5041",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:5041",
                        "name": "esophageal cancer",
                        "description": "A gastrointestinal system cancer that is located_in the esophagus."
                    },
                    "synonyms": [
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "Ca lower third oesophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "Ca middle third oesophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "esophagus cancer",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant neoplasm of distal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant neoplasm of lower third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant neoplasm of middle third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant neoplasm of proximal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant neoplasm of upper third esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant tumor of Distal Third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant tumor of Proximal Third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant tumor of abdominal esophagus",
                            "description": ""
                        },
                        {
                            "id": "DOID:5041",
                            "resource": "Disease Ontology",
                            "url": "http://disease-ontology.org/term/DOID:5041",
                            "name": "malignant tumor of the middle Third of the esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal cancer",
                            "description": "A primary or metastatic malignant neoplasm involving the esophagus."
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "cancer of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "cancer of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal carcinoma, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal squamous cell carcinoma, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophagus cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant esophageal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant esophageal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant esophageal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant esophagus neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant esophagus tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of the esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of the oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant oesophagus neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant oesophagus tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of the esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of the oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "oesophagus cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Ca lower third esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Ca lower third oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Ca middle third esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Ca middle third oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of distal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of distal third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of lower third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of lower third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of middle third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of middle third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of proximal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of proximal third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of upper third esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant neoplasm of upper third oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of abdominal esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of distal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of proximal third of esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumor of the middle third of the esophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of abdominal oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of distal third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of proximal third of oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "malignant tumour of the middle third of the oesophagus",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Aerodigestive tract cancer, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "Escc, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "esophageal squamous cell carcinoma, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0007576",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0007576",
                            "name": "gastric cardia adenocarcinoma, susceptibility to",
                            "description": ""
                        },
                        {
                            "id": "MIM:133239",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/133239",
                            "name": "Esophageal cancer",
                            "description": "Esophageal cancer"
                        }
                    ]
                }
            ]
        },
        {
            "significant": "Yes",
            "trend": "down",
            "name": "Colorectal cancer [DO disease name]",
            "url": "http://disease-ontology.org/term/DOID:9256",
            "evidence": [
                {
                    "database": "BioXpress",
                    "id": "P10721",
                    "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10721"
                }
            ],
            "disease": [
                {
                    "disease_id": "DOID:9256",
                    "recommended_name": {
                        "id": "DOID:9256",
                        "resource": "Disease Ontology",
                        "url": "http://disease-ontology.org/term/DOID:9256",
                        "name": "colorectal cancer",
                        "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
                    },
                    "synonyms": [
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer",
                            "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of colorectum",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "cancer of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, advanced, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer with chromosomal instability, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, somatic",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colorectum cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectal tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant colorectum neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large bowel tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine neoplasm",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine tumor",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant large intestine tumour",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of colorectum",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant neoplasm of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumor of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of the large bowel",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "malignant tumour of the large intestine",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "CRC",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
                            "description": ""
                        },
                        {
                            "id": "MONDO:0005575",
                            "resource": "MONDO",
                            "url": "https://monarchinitiative.org/disease/MONDO:0005575",
                            "name": "large intestine cancer",
                            "description": ""
                        },
                        {
                            "id": "MIM:114500",
                            "resource": "MIM",
                            "url": "https://www.omim.org/entry/114500",
                            "name": "Colorectal cancer",
                            "description": "Colorectal cancer"
                        }
                    ]
                }
            ]
        }
    ],
    "species": [
        {
            "name": "Homo sapiens",
            "taxid": 9606,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "common_name": "Human"
        }
    ],
    "gene": [
        {
            "name": "KIT",
            "url": "https://www.uniprot.org/uniprot/P10721",
            "locus": {
                "chromosome": "4",
                "start_pos": 54740783,
                "end_pos": 54657267,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSG00000157404",
                        "url": "https://www.ensembl.org/id/ENSG00000157404"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSG00000157404",
            "url": "https://bgee.org/?page=gene&gene_id=ENSG00000157404",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "P10721",
            "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10721",
            "database": "BioMuta",
            "categories": [
                "Variation"
            ]
        },
        {
            "id": "2.7.10.1",
            "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.7.10.1&UniProtAcc=P10721",
            "database": "BRENDA",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "cd00096",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00096",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "cd05104",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05104",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "cd05860",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05860",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "CHEMBL1936",
            "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1936",
            "database": "ChEMBL",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "KIT",
            "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=KIT",
            "database": "GeneCards",
            "categories": [
                "Gene Annotation",
                "Organism-specific"
            ]
        },
        {
            "id": "3815",
            "url": "https://www.ncbi.nlm.nih.gov/gene/3815",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "1492",
            "url": "https://glyconnect.expasy.org/browser/proteins/1492",
            "database": "GlyConnect",
            "categories": [
                "Glycoproteomics",
                "Glycan"
            ]
        },
        {
            "id": "6342",
            "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=6342",
            "database": "HGNC",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "P10721",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:P10721*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR000719",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000719",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR001245",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001245",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR001824",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001824",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR003598",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR003598",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR003599",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR007110",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR008266",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR008266",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR011009",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR011009",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR013151",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013151",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR013783",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR017441",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017441",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR020635",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR020635",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR027263",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR027263",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR036179",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR042495",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR042495",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR043204",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR043204",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "hsa:3815",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3815",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "154800",
            "url": "http://www.omim.org/entry/154800",
            "database": "MIM",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "164920",
            "url": "http://www.omim.org/entry/164920",
            "database": "MIM",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "172800",
            "url": "http://www.omim.org/entry/172800",
            "database": "MIM",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "273300",
            "url": "http://www.omim.org/entry/273300",
            "database": "MIM",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "601626",
            "url": "http://www.omim.org/entry/601626",
            "database": "MIM",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "606764",
            "url": "http://www.omim.org/entry/606764",
            "database": "MIM",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "NX_P10721",
            "url": "https://www.nextprot.org/entry/NX_P10721",
            "database": "neXtProt",
            "categories": [
                "Protein",
                "Organism-specific"
            ]
        },
        {
            "id": "XYVSELH",
            "url": "https://omabrowser.org/oma/group/XYVSELH/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "1614410at2759",
            "url": "http://www.orthodb.org/?query=1614410at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR10075",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10075",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR15360",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15360",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR15360:SF4",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15360:SF4",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR24416",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24416",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR24416:SF46",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24416:SF46",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "1PKG",
            "url": "https://www.rcsb.org/structure/1PKG",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "1T45",
            "url": "https://www.rcsb.org/structure/1T45",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "1T46",
            "url": "https://www.rcsb.org/structure/1T46",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2E9W",
            "url": "https://www.rcsb.org/structure/2E9W",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2EC8",
            "url": "https://www.rcsb.org/structure/2EC8",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2IUH",
            "url": "https://www.rcsb.org/structure/2IUH",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "2VIF",
            "url": "https://www.rcsb.org/structure/2VIF",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "3G0E",
            "url": "https://www.rcsb.org/structure/3G0E",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "3G0F",
            "url": "https://www.rcsb.org/structure/3G0F",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4HVS",
            "url": "https://www.rcsb.org/structure/4HVS",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4K94",
            "url": "https://www.rcsb.org/structure/4K94",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4K9E",
            "url": "https://www.rcsb.org/structure/4K9E",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4PGZ",
            "url": "https://www.rcsb.org/structure/4PGZ",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "4U0I",
            "url": "https://www.rcsb.org/structure/4U0I",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6GQJ",
            "url": "https://www.rcsb.org/structure/6GQJ",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6GQK",
            "url": "https://www.rcsb.org/structure/6GQK",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6GQL",
            "url": "https://www.rcsb.org/structure/6GQL",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6GQM",
            "url": "https://www.rcsb.org/structure/6GQM",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6HH1",
            "url": "https://www.rcsb.org/structure/6HH1",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6ITT",
            "url": "https://www.rcsb.org/structure/6ITT",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6ITV",
            "url": "https://www.rcsb.org/structure/6ITV",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6KLA",
            "url": "https://www.rcsb.org/structure/6KLA",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6MOB",
            "url": "https://www.rcsb.org/structure/6MOB",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6XV9",
            "url": "https://www.rcsb.org/structure/6XV9",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6XVA",
            "url": "https://www.rcsb.org/structure/6XVA",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "6XVB",
            "url": "https://www.rcsb.org/structure/6XVB",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7KHG",
            "url": "https://www.rcsb.org/structure/7KHG",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7KHJ",
            "url": "https://www.rcsb.org/structure/7KHJ",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7KHK",
            "url": "https://www.rcsb.org/structure/7KHK",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7ZW8",
            "url": "https://www.rcsb.org/structure/7ZW8",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "7ZY6",
            "url": "https://www.rcsb.org/structure/7ZY6",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "8DFM",
            "url": "https://www.rcsb.org/structure/8DFM",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "8DFP",
            "url": "https://www.rcsb.org/structure/8DFP",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "8DFQ",
            "url": "https://www.rcsb.org/structure/8DFQ",
            "database": "PDB",
            "categories": [
                "3D Structure"
            ]
        },
        {
            "id": "PF00047",
            "url": "http://pfam.xfam.org/family/PF00047",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00069",
            "url": "http://pfam.xfam.org/family/PF00069",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF07714",
            "url": "http://pfam.xfam.org/family/PF07714",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "P10721",
            "url": "https://pharos.nih.gov/targets/P10721",
            "database": "PHAROS",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "PR:000054793",
            "url": "https://proconsortium.org/app/entry/PR:000054793",
            "database": "PRO",
            "categories": [
                "Glycoproteomics"
            ]
        },
        {
            "id": "PR_P10721",
            "url": "http://purl.obolibrary.org/obo/PR_P10721",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "R-HSA-1257604",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-1433557",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-1433559",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433559",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-2219530",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-5673001",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-6811558",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811558",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-8866910",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-9669914",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669914",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-9669917",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669917",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-9669921",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669921",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-9669924",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669924",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-9669926",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669926",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-9669929",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669929",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-9669933",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669933",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-9669934",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669934",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-9669935",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669935",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-9669936",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669936",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-9670439",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-HSA-9680187",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680187",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_000213",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000213",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "10596",
            "url": "https://www.rhea-db.org/rhea/10596",
            "database": "Rhea",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "P10721",
            "url": "DISABLED",
            "database": "UniCarbKB",
            "categories": [
                "Glycoproteomics"
            ]
        },
        {
            "id": "A0A0U2N547",
            "url": "https://www.uniprot.org/uniprot/A0A0U2N547",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A0U2N547-1",
            "url": "https://www.uniprot.org/uniprot/A0A0U2N547-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A8I5KPX7",
            "url": "https://www.uniprot.org/uniprot/A0A8I5KPX7",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A8I5KPX7-1",
            "url": "https://www.uniprot.org/uniprot/A0A8I5KPX7-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A8I5KQZ6",
            "url": "https://www.uniprot.org/uniprot/A0A8I5KQZ6",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A8I5KQZ6-1",
            "url": "https://www.uniprot.org/uniprot/A0A8I5KQZ6-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A8I5KR87",
            "url": "https://www.uniprot.org/uniprot/A0A8I5KR87",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A8I5KR87-1",
            "url": "https://www.uniprot.org/uniprot/A0A8I5KR87-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A8I5KRE7",
            "url": "https://www.uniprot.org/uniprot/A0A8I5KRE7",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A8I5KRE7-1",
            "url": "https://www.uniprot.org/uniprot/A0A8I5KRE7-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A8I5KS03",
            "url": "https://www.uniprot.org/uniprot/A0A8I5KS03",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A8I5KS03-1",
            "url": "https://www.uniprot.org/uniprot/A0A8I5KS03-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A8I5KXA4",
            "url": "https://www.uniprot.org/uniprot/A0A8I5KXA4",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A8I5KXA4-1",
            "url": "https://www.uniprot.org/uniprot/A0A8I5KXA4-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A8I5QKL5",
            "url": "https://www.uniprot.org/uniprot/A0A8I5QKL5",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A8I5QKL5-1",
            "url": "https://www.uniprot.org/uniprot/A0A8I5QKL5-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A8I5QKP7",
            "url": "https://www.uniprot.org/uniprot/A0A8I5QKP7",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A8I5QKP7-1",
            "url": "https://www.uniprot.org/uniprot/A0A8I5QKP7-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A8J8Z860",
            "url": "https://www.uniprot.org/uniprot/A0A8J8Z860",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A8J8Z860-1",
            "url": "https://www.uniprot.org/uniprot/A0A8J8Z860-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P10721",
            "url": "https://www.uniprot.org/uniprot/P10721",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P10721-1",
            "url": "https://www.uniprot.org/uniprot/P10721-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P10721-2",
            "url": "https://www.uniprot.org/uniprot/P10721-2",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "P10721-4",
            "url": "https://www.uniprot.org/uniprot/P10721-4",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSSSVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSANVTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWEDYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDRLVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDSSAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIVMILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSVGSTASSSQPLLVHDDV",
        "length": 976,
        "header": "sp|P10721-1|KIT_HUMAN Isoform 1 of Mast/stem cell growth factor receptor Kit  OS=Homo sapiens OX=9606 GN=KIT PE=1 SV=1 CANONICAL=P10721-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A0A0U2N547-1",
            "url": "",
            "sequence": {
                "sequence": "MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSSSVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSANVTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWEDYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDRLVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDSSAFKHNGTVECKAYNDVGKTSAYFNFAFKEQIHPHTLFTPLLIGFVIVAGMMCIIVMILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSVGSTASSSQPLLVHDDV",
                "length": 971,
                "header": "tr|A0A0U2N547-1|KIT_HUMAN Computationally mapped isoform of Mast/stem cell growth factor receptor Kit  OS=Homo sapiens OX=9606 GN=KIT PE=1 SV=1 CANONICAL=P10721-1"
            },
            "locus": {
                "chromosome": "4",
                "start_pos": 54738554,
                "end_pos": 54658015,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000686011.1",
                        "url": "https://www.ensembl.org/id/ENST00000686011.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000509704.1",
                        "url": "https://www.ensembl.org/id/ENSP00000509704.1"
                    }
                ]
            }
        },
        {
            "isoform_ac": "A0A8I5KPX7-1",
            "url": "",
            "sequence": {
                "sequence": "MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSSSVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSANVTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWEDYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDRLVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDSSAFKHNGTVECKAYNDVGKTSAYFNFAFKEQIHPHTLFTPLLIGFVIVAGMMCIIVMILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGMAFLASKNARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSVGSTASSSQPLLVHDDV",
                "length": 931,
                "header": "tr|A0A8I5KPX7-1|KIT_HUMAN Computationally mapped isoform of Mast/stem cell growth factor receptor Kit  OS=Homo sapiens OX=9606 GN=KIT PE=1 SV=1 CANONICAL=P10721-1"
            },
            "locus": {
                "chromosome": "4",
                "start_pos": 54738554,
                "end_pos": 54658015,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000687246.1",
                        "url": "https://www.ensembl.org/id/ENST00000687246.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000509114.1",
                        "url": "https://www.ensembl.org/id/ENSP00000509114.1"
                    }
                ]
            }
        },
        {
            "isoform_ac": "A0A8I5KQZ6-1",
            "url": "",
            "sequence": {
                "sequence": "MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSSSVYSTWKRENSQQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSANVTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWEDYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDRLVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDSSAFKHNGTVECKAYNDVGKTSAYFNFAFKEQIHPHTLFTPLLIGFVIVAGMMCIIVMILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSVGSTASSSQPLLVHDDV",
                "length": 973,
                "header": "tr|A0A8I5KQZ6-1|KIT_HUMAN Computationally mapped isoform of Mast/stem cell growth factor receptor Kit  OS=Homo sapiens OX=9606 GN=KIT PE=1 SV=1 CANONICAL=P10721-1"
            },
            "locus": {
                "chromosome": "4",
                "start_pos": 54738554,
                "end_pos": 54658015,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000690543.1",
                        "url": "https://www.ensembl.org/id/ENST00000690543.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000508831.1",
                        "url": "https://www.ensembl.org/id/ENSP00000508831.1"
                    }
                ]
            }
        },
        {
            "isoform_ac": "A0A8I5KR87-1",
            "url": "",
            "sequence": {
                "sequence": "MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSSSVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSANVTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWEDYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTSL",
                "length": 413,
                "header": "tr|A0A8I5KR87-1|A0A8I5KR87_HUMAN Computationally mapped isoform of Platelet-derived growth factor receptor-like protein  OS=Homo sapiens OX=9606 GN=KIT PE=1 SV=1 CANONICAL=P10721-1"
            },
            "locus": {
                "chromosome": "4",
                "start_pos": 54723040,
                "end_pos": 54658015,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000690519.1",
                        "url": "https://www.ensembl.org/id/ENST00000690519.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000508845.1",
                        "url": "https://www.ensembl.org/id/ENSP00000508845.1"
                    }
                ]
            }
        },
        {
            "isoform_ac": "A0A8I5KRE7-1",
            "url": "",
            "sequence": {
                "sequence": "MIKSVKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSSSVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSANVTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWEDYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDRLVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDSSAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIVMILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSVGSTASSSQPLLVHDDV",
                "length": 806,
                "header": "tr|A0A8I5KRE7-1|A0A8I5KRE7_HUMAN Computationally mapped isoform of Mast/stem cell growth factor receptor Kit  OS=Homo sapiens OX=9606 GN=KIT PE=1 SV=1 CANONICAL=P10721-1"
            },
            "locus": {
                "chromosome": "4",
                "start_pos": 54738554,
                "end_pos": 54698457,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000689994.1",
                        "url": "https://www.ensembl.org/id/ENST00000689994.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000509156.1",
                        "url": "https://www.ensembl.org/id/ENSP00000509156.1"
                    }
                ]
            }
        },
        {
            "isoform_ac": "A0A8I5KS03-1",
            "url": "",
            "sequence": {
                "sequence": "MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSSSVYSTWKRENSQQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSANVTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWEDYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDRLVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDSSAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIVMILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSVGSTASSSQPLLVHDDV",
                "length": 977,
                "header": "tr|A0A8I5KS03-1|A0A8I5KS03_HUMAN Computationally mapped isoform of Mast/stem cell growth factor receptor  OS=Homo sapiens OX=9606 GN=KIT PE=1 SV=1 CANONICAL=P10721-1"
            },
            "locus": {
                "chromosome": "4",
                "start_pos": 54738554,
                "end_pos": 54658015,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000687109.1",
                        "url": "https://www.ensembl.org/id/ENST00000687109.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000509371.1",
                        "url": "https://www.ensembl.org/id/ENSP00000509371.1"
                    }
                ]
            }
        },
        {
            "isoform_ac": "A0A8I5KXA4-1",
            "url": "",
            "sequence": {
                "sequence": "TKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSANVTTTLEVVAKPEILTYDRLVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDSSAFKHNGTVECKAYNDVGKTSAYFNFAFK",
                "length": 155,
                "header": "tr|A0A8I5KXA4-1|KIT_HUMAN Computationally mapped isoform of Mast/stem cell growth factor receptor Kit  OS=Homo sapiens OX=9606 GN=KIT PE=1 SV=1 CANONICAL=P10721-1"
            },
            "locus": {
                "chromosome": "4",
                "start_pos": 54726037,
                "end_pos": 54703724,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000685816.1",
                        "url": "https://www.ensembl.org/id/ENST00000685816.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000508749.1",
                        "url": "https://www.ensembl.org/id/ENSP00000508749.1"
                    }
                ]
            }
        },
        {
            "isoform_ac": "A0A8I5QKL5-1",
            "url": "",
            "sequence": {
                "sequence": "MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSSSVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSANVTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWEDYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDRLVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDSSAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIVMILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSVGSTASSSQPLLVHDDV",
                "length": 975,
                "header": "tr|A0A8I5QKL5-1|KIT_HUMAN Computationally mapped isoform of Mast/stem cell growth factor receptor Kit  OS=Homo sapiens OX=9606 GN=KIT PE=1 SV=1 CANONICAL=P10721-1"
            },
            "locus": {
                "chromosome": "4",
                "start_pos": 54738554,
                "end_pos": 54658015,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000692783.1",
                        "url": "https://www.ensembl.org/id/ENST00000692783.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000508733.1",
                        "url": "https://www.ensembl.org/id/ENSP00000508733.1"
                    }
                ]
            }
        },
        {
            "isoform_ac": "A0A8I5QKP7-1",
            "url": "",
            "sequence": {
                "sequence": "MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSSSVYSTWKRENSQQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSANVTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWEDYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDRLVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDSSAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIVMILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSVGSTASSSQPLLVHDDV",
                "length": 976,
                "header": "tr|A0A8I5QKP7-1|KIT_HUMAN Computationally mapped isoform of Mast/stem cell growth factor receptor Kit  OS=Homo sapiens OX=9606 GN=KIT PE=1 SV=1 CANONICAL=P10721-1"
            },
            "locus": {
                "chromosome": "4",
                "start_pos": 54738554,
                "end_pos": 54658015,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000689832.1",
                        "url": "https://www.ensembl.org/id/ENST00000689832.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000509084.1",
                        "url": "https://www.ensembl.org/id/ENSP00000509084.1"
                    }
                ]
            }
        },
        {
            "isoform_ac": "A0A8J8Z860-1",
            "url": "",
            "sequence": {
                "sequence": "MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSSSVYSTWKRENSQQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSANVTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWEDYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDRLVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDSSAFKHNGTVECKAYNDVGKTSAYFNFAFKEQIHPHTLFTPLLIGFVIVAGMMCIIVMILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSVGSTASSSQPLLVHDDV",
                "length": 972,
                "header": "tr|A0A8J8Z860-1|A0A8J8Z860_HUMAN Computationally mapped isoform of Mast/stem cell growth factor receptor  OS=Homo sapiens OX=9606 GN=KIT PE=1 SV=1 CANONICAL=P10721-1"
            },
            "locus": {
                "chromosome": "4",
                "start_pos": 54738554,
                "end_pos": 54658015,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000412167.7",
                        "url": "https://www.ensembl.org/id/ENST00000412167.7"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000390987.3",
                        "url": "https://www.ensembl.org/id/ENSP00000390987.3"
                    }
                ]
            }
        },
        {
            "isoform_ac": "P10721-1",
            "url": "",
            "sequence": {
                "sequence": "MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSSSVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSANVTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWEDYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDRLVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDSSAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIVMILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSVGSTASSSQPLLVHDDV",
                "length": 976,
                "header": "sp|P10721-1|KIT_HUMAN Isoform 1 of Mast/stem cell growth factor receptor Kit  OS=Homo sapiens OX=9606 GN=KIT PE=1 SV=1 CANONICAL=P10721-1"
            },
            "locus": {
                "chromosome": "4",
                "start_pos": 54738554,
                "end_pos": 54658015,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000288135.6",
                        "url": "https://www.ensembl.org/id/ENST00000288135.6"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000288135.6",
                        "url": "https://www.ensembl.org/id/ENSP00000288135.6"
                    }
                ]
            }
        },
        {
            "isoform_ac": "P10721-2",
            "url": "",
            "sequence": {
                "sequence": "MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSSSVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSANVTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWEDYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDRLVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDSSAFKHNGTVECKAYNDVGKTSAYFNFAFKEQIHPHTLFTPLLIGFVIVAGMMCIIVMILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSVGSTASSSQPLLVHDDV",
                "length": 972,
                "header": "sp|P10721-2|KIT_HUMAN Isoform 2 of Mast/stem cell growth factor receptor Kit  OS=Homo sapiens OX=9606 GN=KIT PE=1 SV=1 CANONICAL=P10721-1"
            },
            "locus": {
                "chromosome": "4",
                "start_pos": 54738554,
                "end_pos": 54658015,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENST00000687295.1",
                        "url": "https://www.ensembl.org/id/ENST00000687295.1"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSP00000509450.1",
                        "url": "https://www.ensembl.org/id/ENSP00000509450.1"
                    }
                ]
            }
        },
        {
            "isoform_ac": "P10721-4",
            "url": "",
            "sequence": {
                "sequence": "MSLPLSFPFLTFMVVIAKKNPLFLTGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSVGSTASSSQPLLVHDDV",
                "length": 257,
                "header": "sp|P10721-4|KIT_HUMAN Isoform 4 of Mast/stem cell growth factor receptor Kit  OS=Homo sapiens OX=9606 GN=KIT PE=1 SV=1 CANONICAL=P10721-1"
            },
            "locus": {}
        }
    ],
    "glycosylation": [
        {
            "glytoucan_ac": "G05724UK",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported_with_glycan",
            "site_seq": "N",
            "relation": "attached",
            "comment": "",
            "start_pos": 130,
            "start_aa": "Asn",
            "end_pos": 130,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn130",
            "evidence": [
                {
                    "id": "1492",
                    "database": "GlyConnect",
                    "url": "https://glyconnect.expasy.org/browser/proteins/1492"
                },
                {
                    "id": "29741879",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/29741879"
                }
            ]
        },
        {
            "glytoucan_ac": "G06356OH",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported_with_glycan",
            "site_seq": "N",
            "relation": "attached",
            "comment": "",
            "start_pos": 130,
            "start_aa": "Asn",
            "end_pos": 130,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn130",
            "evidence": [
                {
                    "id": "1492",
                    "database": "GlyConnect",
                    "url": "https://glyconnect.expasy.org/browser/proteins/1492"
                },
                {
                    "id": "29671580",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/29671580"
                }
            ]
        },
        {
            "glytoucan_ac": "G59626AS",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported_with_glycan",
            "site_seq": "N",
            "relation": "attached",
            "comment": "",
            "start_pos": 130,
            "start_aa": "Asn",
            "end_pos": 130,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn130",
            "evidence": [
                {
                    "id": "P10721",
                    "database": "UniCarbKB",
                    "url": ""
                },
                {
                    "id": "29671580",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/29671580"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported",
            "site_seq": "N",
            "relation": "attached",
            "comment": "",
            "start_pos": 130,
            "start_aa": "Asn",
            "end_pos": 130,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn130",
            "evidence": [
                {
                    "id": "P10721",
                    "database": "UniCarbKB",
                    "url": ""
                },
                {
                    "id": "29741879",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/29741879"
                },
                {
                    "id": "P10721",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P10721#ptm_processing"
                },
                {
                    "id": "16335952",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/16335952"
                },
                {
                    "id": "17662946",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/17662946"
                },
                {
                    "id": "2EC8",
                    "database": "RCSB PDB",
                    "url": "https://www.rcsb.org/sequence/2EC8"
                },
                {
                    "id": "23090970",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/23090970"
                },
                {
                    "id": "GLY_000143",
                    "database": "GlyGen",
                    "url": "https://data.glygen.org/GLY_000143"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 145,
            "start_aa": "Asn",
            "end_pos": 145,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn145",
            "evidence": [
                {
                    "id": "P10721",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P10721#ptm_processing"
                },
                {
                    "id": "23090970",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/23090970"
                },
                {
                    "id": "GLY_000143",
                    "database": "GlyGen",
                    "url": "https://data.glygen.org/GLY_000143"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 283,
            "start_aa": "Asn",
            "end_pos": 283,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn283",
            "evidence": [
                {
                    "id": "P10721",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P10721#ptm_processing"
                },
                {
                    "id": "17662946",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/17662946"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 293,
            "start_aa": "Asn",
            "end_pos": 293,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn293",
            "evidence": [
                {
                    "id": "P10721",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P10721#ptm_processing"
                },
                {
                    "id": "17662946",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/17662946"
                },
                {
                    "id": "2EC8",
                    "database": "RCSB PDB",
                    "url": "https://www.rcsb.org/sequence/2EC8"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 300,
            "start_aa": "Asn",
            "end_pos": 300,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn300",
            "evidence": [
                {
                    "id": "P10721",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P10721#ptm_processing"
                },
                {
                    "id": "17662946",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/17662946"
                },
                {
                    "id": "2EC8",
                    "database": "RCSB PDB",
                    "url": "https://www.rcsb.org/sequence/2EC8"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 320,
            "start_aa": "Asn",
            "end_pos": 320,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn320",
            "evidence": [
                {
                    "id": "P10721",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P10721#ptm_processing"
                },
                {
                    "id": "17662946",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/17662946"
                },
                {
                    "id": "2EC8",
                    "database": "RCSB PDB",
                    "url": "https://www.rcsb.org/sequence/2EC8"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 352,
            "start_aa": "Asn",
            "end_pos": 352,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn352",
            "evidence": [
                {
                    "id": "P10721",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P10721#ptm_processing"
                },
                {
                    "id": "17662946",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/17662946"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 367,
            "start_aa": "Asn",
            "end_pos": 367,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn367",
            "evidence": [
                {
                    "id": "P10721",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P10721#ptm_processing"
                },
                {
                    "id": "17662946",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/17662946"
                },
                {
                    "id": "2EC8",
                    "database": "RCSB PDB",
                    "url": "https://www.rcsb.org/sequence/2EC8"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 463,
            "start_aa": "Asn",
            "end_pos": 463,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn463",
            "evidence": [
                {
                    "id": "P10721",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P10721#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "G10773YW",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported_with_glycan",
            "site_seq": "N",
            "relation": "attached",
            "comment": "",
            "start_pos": 486,
            "start_aa": "Asn",
            "end_pos": 486,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn486",
            "evidence": [
                {
                    "id": "1492",
                    "database": "GlyConnect",
                    "url": "https://glyconnect.expasy.org/browser/proteins/1492"
                },
                {
                    "id": "29741879",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/29741879"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "reported",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 486,
            "start_aa": "Asn",
            "end_pos": 486,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn486",
            "evidence": [
                {
                    "id": "P10721",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/P10721#ptm_processing"
                },
                {
                    "id": "23090970",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/23090970"
                },
                {
                    "id": "GLY_000143",
                    "database": "GlyGen",
                    "url": "https://data.glygen.org/GLY_000143"
                }
            ]
        }
    ],
    "phosphorylation": [
        {
            "start_pos": 354,
            "end_pos": 354,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Thr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "18491316",
                    "url": "https://glygen.org/publication/PubMed/18491316"
                }
            ],
            "site_lbl": "Thr354"
        },
        {
            "start_pos": 362,
            "end_pos": 362,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "18491316",
                    "url": "https://glygen.org/publication/PubMed/18491316"
                }
            ],
            "site_lbl": "Tyr362"
        },
        {
            "start_pos": 501,
            "end_pos": 501,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "23459373",
                    "url": "https://glygen.org/publication/PubMed/23459373"
                }
            ],
            "site_lbl": "Ser501"
        },
        {
            "start_pos": 545,
            "end_pos": 545,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "9528781",
                    "url": "https://glygen.org/publication/PubMed/9528781"
                }
            ],
            "site_lbl": "Tyr545"
        },
        {
            "start_pos": 547,
            "end_pos": 547,
            "kinase_uniprot_canonical_ac": "P10721-1",
            "kinase_gene_name": "KIT",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "20147452",
                    "url": "https://glygen.org/publication/PubMed/20147452"
                },
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "site_lbl": "Tyr547"
        },
        {
            "start_pos": 547,
            "end_pos": 547,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "Phosphotyrosine; by autocatalysis",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "9528781",
                    "url": "https://glygen.org/publication/PubMed/9528781"
                }
            ],
            "site_lbl": "Tyr547"
        },
        {
            "start_pos": 553,
            "end_pos": 553,
            "kinase_uniprot_canonical_ac": "P10721-1",
            "kinase_gene_name": "KIT",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "20147452",
                    "url": "https://glygen.org/publication/PubMed/20147452"
                },
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "site_lbl": "Tyr553"
        },
        {
            "start_pos": 553,
            "end_pos": 553,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "Phosphotyrosine; by autocatalysis",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "9528781",
                    "url": "https://glygen.org/publication/PubMed/9528781"
                },
                {
                    "database": "PubMed",
                    "id": "10224103",
                    "url": "https://glygen.org/publication/PubMed/10224103"
                }
            ],
            "site_lbl": "Tyr553"
        },
        {
            "start_pos": 568,
            "end_pos": 568,
            "kinase_uniprot_canonical_ac": "P10721-1",
            "kinase_gene_name": "KIT",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "9799234",
                    "url": "https://glygen.org/publication/PubMed/9799234"
                },
                {
                    "database": "PubMed",
                    "id": "10523831",
                    "url": "https://glygen.org/publication/PubMed/10523831"
                },
                {
                    "database": "PubMed",
                    "id": "19049823",
                    "url": "https://glygen.org/publication/PubMed/19049823"
                },
                {
                    "database": "PubMed",
                    "id": "19265199",
                    "url": "https://glygen.org/publication/PubMed/19265199"
                },
                {
                    "database": "PubMed",
                    "id": "20147452",
                    "url": "https://glygen.org/publication/PubMed/20147452"
                },
                {
                    "database": "phospho.ELM",
                    "id": "P10721",
                    "url": "http://phospho.elm.eu.org/byAccession/P10721.html"
                },
                {
                    "database": "PubMed",
                    "id": "12824176",
                    "url": "https://glygen.org/publication/PubMed/12824176"
                },
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "site_lbl": "Tyr568"
        },
        {
            "start_pos": 568,
            "end_pos": 568,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "Phosphotyrosine; by autocatalysis",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "PRO",
                    "id": "P10721",
                    "url": "http://purl.obolibrary.org/obo/P10721"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "12444928",
                    "url": "https://glygen.org/publication/PubMed/12444928"
                },
                {
                    "database": "PubMed",
                    "id": "12878163",
                    "url": "https://glygen.org/publication/PubMed/12878163"
                },
                {
                    "database": "PubMed",
                    "id": "16780420",
                    "url": "https://glygen.org/publication/PubMed/16780420"
                },
                {
                    "database": "PubMed",
                    "id": "18214972",
                    "url": "https://glygen.org/publication/PubMed/18214972"
                },
                {
                    "database": "PubMed",
                    "id": "25717186",
                    "url": "https://glygen.org/publication/PubMed/25717186"
                },
                {
                    "database": "PubMed",
                    "id": "28403213",
                    "url": "https://glygen.org/publication/PubMed/28403213"
                },
                {
                    "database": "PubMed",
                    "id": "28915580",
                    "url": "https://glygen.org/publication/PubMed/28915580"
                },
                {
                    "database": "PubMed",
                    "id": "29482074",
                    "url": "https://glygen.org/publication/PubMed/29482074"
                },
                {
                    "database": "PubMed",
                    "id": "9038210",
                    "url": "https://glygen.org/publication/PubMed/9038210"
                },
                {
                    "database": "PubMed",
                    "id": "19265199",
                    "url": "https://glygen.org/publication/PubMed/19265199"
                },
                {
                    "database": "PubMed",
                    "id": "21030588",
                    "url": "https://glygen.org/publication/PubMed/21030588"
                }
            ],
            "site_lbl": "Tyr568"
        },
        {
            "start_pos": 570,
            "end_pos": 570,
            "kinase_uniprot_canonical_ac": "P10721-1",
            "kinase_gene_name": "KIT",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "9799234",
                    "url": "https://glygen.org/publication/PubMed/9799234"
                },
                {
                    "database": "PubMed",
                    "id": "10523831",
                    "url": "https://glygen.org/publication/PubMed/10523831"
                },
                {
                    "database": "PubMed",
                    "id": "20147452",
                    "url": "https://glygen.org/publication/PubMed/20147452"
                },
                {
                    "database": "phospho.ELM",
                    "id": "P10721",
                    "url": "http://phospho.elm.eu.org/byAccession/P10721.html"
                },
                {
                    "database": "PubMed",
                    "id": "12824176",
                    "url": "https://glygen.org/publication/PubMed/12824176"
                },
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "site_lbl": "Tyr570"
        },
        {
            "start_pos": 570,
            "end_pos": 570,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "Phosphotyrosine; by autocatalysis",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "PRO",
                    "id": "P10721",
                    "url": "http://purl.obolibrary.org/obo/P10721"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "12878163",
                    "url": "https://glygen.org/publication/PubMed/12878163"
                },
                {
                    "database": "PubMed",
                    "id": "18214972",
                    "url": "https://glygen.org/publication/PubMed/18214972"
                },
                {
                    "database": "PubMed",
                    "id": "25717186",
                    "url": "https://glygen.org/publication/PubMed/25717186"
                },
                {
                    "database": "PubMed",
                    "id": "28403213",
                    "url": "https://glygen.org/publication/PubMed/28403213"
                },
                {
                    "database": "PubMed",
                    "id": "28915580",
                    "url": "https://glygen.org/publication/PubMed/28915580"
                },
                {
                    "database": "PubMed",
                    "id": "29482074",
                    "url": "https://glygen.org/publication/PubMed/29482074"
                },
                {
                    "database": "PubMed",
                    "id": "9038210",
                    "url": "https://glygen.org/publication/PubMed/9038210"
                }
            ],
            "site_lbl": "Tyr570"
        },
        {
            "start_pos": 670,
            "end_pos": 670,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Thr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "30142229",
                    "url": "https://glygen.org/publication/PubMed/30142229"
                }
            ],
            "site_lbl": "Thr670"
        },
        {
            "start_pos": 703,
            "end_pos": 703,
            "kinase_uniprot_canonical_ac": "P10721-1",
            "kinase_gene_name": "KIT",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "10377264",
                    "url": "https://glygen.org/publication/PubMed/10377264"
                },
                {
                    "database": "PubMed",
                    "id": "17904548",
                    "url": "https://glygen.org/publication/PubMed/17904548"
                },
                {
                    "database": "PubMed",
                    "id": "19049823",
                    "url": "https://glygen.org/publication/PubMed/19049823"
                },
                {
                    "database": "PubMed",
                    "id": "19265199",
                    "url": "https://glygen.org/publication/PubMed/19265199"
                },
                {
                    "database": "PubMed",
                    "id": "20147452",
                    "url": "https://glygen.org/publication/PubMed/20147452"
                },
                {
                    "database": "phospho.ELM",
                    "id": "P10721",
                    "url": "http://phospho.elm.eu.org/byAccession/P10721.html"
                },
                {
                    "database": "PubMed",
                    "id": "16740725",
                    "url": "https://glygen.org/publication/PubMed/16740725"
                },
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "site_lbl": "Tyr703"
        },
        {
            "start_pos": 703,
            "end_pos": 703,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "Phosphotyrosine; by autocatalysis",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "IntAct",
                    "id": "P10721",
                    "url": "https://www.ebi.ac.uk/intact/interactors/id:P10721*"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "10377264",
                    "url": "https://glygen.org/publication/PubMed/10377264"
                },
                {
                    "database": "PRO",
                    "id": "P10721",
                    "url": "http://purl.obolibrary.org/obo/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "15007386",
                    "url": "https://glygen.org/publication/PubMed/15007386"
                },
                {
                    "database": "PubMed",
                    "id": "21887372",
                    "url": "https://glygen.org/publication/PubMed/21887372"
                },
                {
                    "database": "PubMed",
                    "id": "26498480",
                    "url": "https://glygen.org/publication/PubMed/26498480"
                },
                {
                    "database": "PubMed",
                    "id": "28403213",
                    "url": "https://glygen.org/publication/PubMed/28403213"
                },
                {
                    "database": "PubMed",
                    "id": "30242244",
                    "url": "https://glygen.org/publication/PubMed/30242244"
                },
                {
                    "database": "PubMed",
                    "id": "31484543",
                    "url": "https://glygen.org/publication/PubMed/31484543"
                },
                {
                    "database": "PubMed",
                    "id": "31857719",
                    "url": "https://glygen.org/publication/PubMed/31857719"
                },
                {
                    "database": "PubMed",
                    "id": "19265199",
                    "url": "https://glygen.org/publication/PubMed/19265199"
                },
                {
                    "database": "PubMed",
                    "id": "20147452",
                    "url": "https://glygen.org/publication/PubMed/20147452"
                }
            ],
            "site_lbl": "Tyr703"
        },
        {
            "start_pos": 721,
            "end_pos": 721,
            "kinase_uniprot_canonical_ac": "P10721-1",
            "kinase_gene_name": "KIT",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "19049823",
                    "url": "https://glygen.org/publication/PubMed/19049823"
                },
                {
                    "database": "PubMed",
                    "id": "19265199",
                    "url": "https://glygen.org/publication/PubMed/19265199"
                },
                {
                    "database": "PubMed",
                    "id": "19865100",
                    "url": "https://glygen.org/publication/PubMed/19865100"
                },
                {
                    "database": "PubMed",
                    "id": "20147452",
                    "url": "https://glygen.org/publication/PubMed/20147452"
                },
                {
                    "database": "PubMed",
                    "id": "16740725",
                    "url": "https://glygen.org/publication/PubMed/16740725"
                },
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "site_lbl": "Tyr721"
        },
        {
            "start_pos": 721,
            "end_pos": 721,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "Phosphotyrosine; by autocatalysis",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "9038210",
                    "url": "https://glygen.org/publication/PubMed/9038210"
                },
                {
                    "database": "IntAct",
                    "id": "P10721",
                    "url": "https://www.ebi.ac.uk/intact/interactors/id:P10721*"
                },
                {
                    "database": "PubMed",
                    "id": "1382595",
                    "url": "https://glygen.org/publication/PubMed/1382595"
                },
                {
                    "database": "PubMed",
                    "id": "7537096",
                    "url": "https://glygen.org/publication/PubMed/7537096"
                },
                {
                    "database": "phospho.ELM",
                    "id": "P10721",
                    "url": "http://phospho.elm.eu.org/byAccession/P10721.html"
                },
                {
                    "database": "PRO",
                    "id": "P10721",
                    "url": "http://purl.obolibrary.org/obo/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "15007386",
                    "url": "https://glygen.org/publication/PubMed/15007386"
                },
                {
                    "database": "PubMed",
                    "id": "16570044",
                    "url": "https://glygen.org/publication/PubMed/16570044"
                },
                {
                    "database": "PubMed",
                    "id": "21887372",
                    "url": "https://glygen.org/publication/PubMed/21887372"
                },
                {
                    "database": "PubMed",
                    "id": "26893362",
                    "url": "https://glygen.org/publication/PubMed/26893362"
                },
                {
                    "database": "PubMed",
                    "id": "28192400",
                    "url": "https://glygen.org/publication/PubMed/28192400"
                },
                {
                    "database": "PubMed",
                    "id": "28403213",
                    "url": "https://glygen.org/publication/PubMed/28403213"
                },
                {
                    "database": "PubMed",
                    "id": "30242244",
                    "url": "https://glygen.org/publication/PubMed/30242244"
                },
                {
                    "database": "PubMed",
                    "id": "31824842",
                    "url": "https://glygen.org/publication/PubMed/31824842"
                },
                {
                    "database": "PubMed",
                    "id": "20147452",
                    "url": "https://glygen.org/publication/PubMed/20147452"
                }
            ],
            "site_lbl": "Tyr721"
        },
        {
            "start_pos": 730,
            "end_pos": 730,
            "kinase_uniprot_canonical_ac": "P10721-1",
            "kinase_gene_name": "KIT",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "20147452",
                    "url": "https://glygen.org/publication/PubMed/20147452"
                },
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "site_lbl": "Tyr730"
        },
        {
            "start_pos": 730,
            "end_pos": 730,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "Phosphotyrosine; by autocatalysis",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "7509796",
                    "url": "https://glygen.org/publication/PubMed/7509796"
                },
                {
                    "database": "PRO",
                    "id": "P10721",
                    "url": "http://purl.obolibrary.org/obo/P10721"
                }
            ],
            "site_lbl": "Tyr730"
        },
        {
            "start_pos": 741,
            "end_pos": 741,
            "kinase_uniprot_canonical_ac": "P17252-1",
            "kinase_gene_name": "PRKCA",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "7539802",
                    "url": "https://glygen.org/publication/PubMed/7539802"
                }
            ],
            "site_lbl": "Ser741"
        },
        {
            "start_pos": 741,
            "end_pos": 741,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "Phosphoserine; by PKC/PRKCA",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "phospho.ELM",
                    "id": "P10721",
                    "url": "http://phospho.elm.eu.org/byAccession/P10721.html"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "7539802",
                    "url": "https://glygen.org/publication/PubMed/7539802"
                },
                {
                    "database": "PRO",
                    "id": "P10721",
                    "url": "http://purl.obolibrary.org/obo/P10721"
                }
            ],
            "site_lbl": "Ser741"
        },
        {
            "start_pos": 746,
            "end_pos": 746,
            "kinase_uniprot_canonical_ac": "P17252-1",
            "kinase_gene_name": "PRKCA",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "7539802",
                    "url": "https://glygen.org/publication/PubMed/7539802"
                }
            ],
            "site_lbl": "Ser746"
        },
        {
            "start_pos": 746,
            "end_pos": 746,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "Phosphoserine; by PKC/PRKCA",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "phospho.ELM",
                    "id": "P10721",
                    "url": "http://phospho.elm.eu.org/byAccession/P10721.html"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "7539802",
                    "url": "https://glygen.org/publication/PubMed/7539802"
                },
                {
                    "database": "PRO",
                    "id": "P10721",
                    "url": "http://purl.obolibrary.org/obo/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "17156394",
                    "url": "https://glygen.org/publication/PubMed/17156394"
                }
            ],
            "site_lbl": "Ser746"
        },
        {
            "start_pos": 747,
            "end_pos": 747,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "7509796",
                    "url": "https://glygen.org/publication/PubMed/7509796"
                }
            ],
            "site_lbl": "Tyr747"
        },
        {
            "start_pos": 821,
            "end_pos": 821,
            "kinase_uniprot_canonical_ac": "P17252-1",
            "kinase_gene_name": "PRKCA",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "7539802",
                    "url": "https://glygen.org/publication/PubMed/7539802"
                }
            ],
            "site_lbl": "Ser821"
        },
        {
            "start_pos": 821,
            "end_pos": 821,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "Phosphoserine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "7539802",
                    "url": "https://glygen.org/publication/PubMed/7539802"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "phospho.ELM",
                    "id": "P10721",
                    "url": "http://phospho.elm.eu.org/byAccession/P10721.html"
                }
            ],
            "site_lbl": "Ser821"
        },
        {
            "start_pos": 823,
            "end_pos": 823,
            "kinase_uniprot_canonical_ac": "P10721-1",
            "kinase_gene_name": "KIT",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "19049823",
                    "url": "https://glygen.org/publication/PubMed/19049823"
                },
                {
                    "database": "PubMed",
                    "id": "20147452",
                    "url": "https://glygen.org/publication/PubMed/20147452"
                },
                {
                    "database": "PubMed",
                    "id": "12824176",
                    "url": "https://glygen.org/publication/PubMed/12824176"
                },
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "site_lbl": "Tyr823"
        },
        {
            "start_pos": 823,
            "end_pos": 823,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "Phosphotyrosine; by autocatalysis",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "phospho.ELM",
                    "id": "P10721",
                    "url": "http://phospho.elm.eu.org/byAccession/P10721.html"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PRO",
                    "id": "P10721",
                    "url": "http://purl.obolibrary.org/obo/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "23803604",
                    "url": "https://glygen.org/publication/PubMed/23803604"
                },
                {
                    "database": "PubMed",
                    "id": "24465823",
                    "url": "https://glygen.org/publication/PubMed/24465823"
                },
                {
                    "database": "PubMed",
                    "id": "26498480",
                    "url": "https://glygen.org/publication/PubMed/26498480"
                },
                {
                    "database": "PubMed",
                    "id": "32530065",
                    "url": "https://glygen.org/publication/PubMed/32530065"
                }
            ],
            "site_lbl": "Tyr823"
        },
        {
            "start_pos": 891,
            "end_pos": 891,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "Phosphoserine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "12878163",
                    "url": "https://glygen.org/publication/PubMed/12878163"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "site_lbl": "Ser891"
        },
        {
            "start_pos": 900,
            "end_pos": 900,
            "kinase_uniprot_canonical_ac": "P10721-1",
            "kinase_gene_name": "KIT",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "12878163",
                    "url": "https://glygen.org/publication/PubMed/12878163"
                }
            ],
            "site_lbl": "Tyr900"
        },
        {
            "start_pos": 900,
            "end_pos": 900,
            "kinase_uniprot_canonical_ac": "P12931-1",
            "kinase_gene_name": "SRC",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "12878163",
                    "url": "https://glygen.org/publication/PubMed/12878163"
                },
                {
                    "database": "phospho.ELM",
                    "id": "P10721",
                    "url": "http://phospho.elm.eu.org/byAccession/P10721.html"
                }
            ],
            "site_lbl": "Tyr900"
        },
        {
            "start_pos": 900,
            "end_pos": 900,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "Phosphotyrosine; by autocatalysis",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "IntAct",
                    "id": "P10721",
                    "url": "https://www.ebi.ac.uk/intact/interactors/id:P10721*"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "12878163",
                    "url": "https://glygen.org/publication/PubMed/12878163"
                },
                {
                    "database": "phospho.ELM",
                    "id": "P10721",
                    "url": "http://phospho.elm.eu.org/byAccession/P10721.html"
                },
                {
                    "database": "PRO",
                    "id": "P10721",
                    "url": "http://purl.obolibrary.org/obo/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "20147452",
                    "url": "https://glygen.org/publication/PubMed/20147452"
                }
            ],
            "site_lbl": "Tyr900"
        },
        {
            "start_pos": 936,
            "end_pos": 936,
            "kinase_uniprot_canonical_ac": "P10721-1",
            "kinase_gene_name": "KIT",
            "residue": "Tyr",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "10377264",
                    "url": "https://glygen.org/publication/PubMed/10377264"
                },
                {
                    "database": "PubMed",
                    "id": "17904548",
                    "url": "https://glygen.org/publication/PubMed/17904548"
                },
                {
                    "database": "PubMed",
                    "id": "19049823",
                    "url": "https://glygen.org/publication/PubMed/19049823"
                },
                {
                    "database": "PubMed",
                    "id": "19265199",
                    "url": "https://glygen.org/publication/PubMed/19265199"
                },
                {
                    "database": "phospho.ELM",
                    "id": "P10721",
                    "url": "http://phospho.elm.eu.org/byAccession/P10721.html"
                },
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "site_lbl": "Tyr936"
        },
        {
            "start_pos": 936,
            "end_pos": 936,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Tyr",
            "comment": "Phosphotyrosine; by autocatalysis",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "IntAct",
                    "id": "P10721",
                    "url": "https://www.ebi.ac.uk/intact/interactors/id:P10721*"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "10377264",
                    "url": "https://glygen.org/publication/PubMed/10377264"
                },
                {
                    "database": "PubMed",
                    "id": "7537096",
                    "url": "https://glygen.org/publication/PubMed/7537096"
                },
                {
                    "database": "phospho.ELM",
                    "id": "P10721",
                    "url": "http://phospho.elm.eu.org/byAccession/P10721.html"
                },
                {
                    "database": "PubMed",
                    "id": "18083107",
                    "url": "https://glygen.org/publication/PubMed/18083107"
                },
                {
                    "database": "PRO",
                    "id": "P10721",
                    "url": "http://purl.obolibrary.org/obo/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "12444928",
                    "url": "https://glygen.org/publication/PubMed/12444928"
                },
                {
                    "database": "PubMed",
                    "id": "16780420",
                    "url": "https://glygen.org/publication/PubMed/16780420"
                },
                {
                    "database": "PubMed",
                    "id": "21887372",
                    "url": "https://glygen.org/publication/PubMed/21887372"
                },
                {
                    "database": "PubMed",
                    "id": "24465823",
                    "url": "https://glygen.org/publication/PubMed/24465823"
                },
                {
                    "database": "PubMed",
                    "id": "28403213",
                    "url": "https://glygen.org/publication/PubMed/28403213"
                },
                {
                    "database": "PubMed",
                    "id": "19265199",
                    "url": "https://glygen.org/publication/PubMed/19265199"
                }
            ],
            "site_lbl": "Tyr936"
        },
        {
            "start_pos": 959,
            "end_pos": 959,
            "kinase_uniprot_canonical_ac": "P17252-1",
            "kinase_gene_name": "PRKCA",
            "residue": "Ser",
            "comment": "",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "7539802",
                    "url": "https://glygen.org/publication/PubMed/7539802"
                }
            ],
            "site_lbl": "Ser959"
        },
        {
            "start_pos": 959,
            "end_pos": 959,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "Phosphoserine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "7539802",
                    "url": "https://glygen.org/publication/PubMed/7539802"
                },
                {
                    "database": "PubMed",
                    "id": "19369195",
                    "url": "https://glygen.org/publication/PubMed/19369195"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                },
                {
                    "database": "phospho.ELM",
                    "id": "P10721",
                    "url": "http://phospho.elm.eu.org/byAccession/P10721.html"
                }
            ],
            "site_lbl": "Ser959"
        }
    ],
    "glycation": [],
    "keywords": [
        "enzyme",
        "glycoprotein",
        "glycoprotein_reported",
        "glycoprotein_reported_with_glycan",
        "glycoprotein_predicted"
    ],
    "publication": [
        {
            "title": "Mutations of c-kit JM domain are found in a minority of human gastrointestinal stromal tumors.",
            "journal": "Oncogene",
            "date": "1999",
            "authors": "Moskaluk CA, Tian Q, Marshall CR, Rumpel CA, Franquemont DW, Frierson HF Jr",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10086344",
                    "url": "https://glygen.org/publication/PubMed/10086344"
                }
            ]
        },
        {
            "title": "Activation of serum- and glucocorticoid-regulated protein kinase by agonists that activate phosphatidylinositide 3-kinase is mediated by 3-phosphoinositide-dependent protein kinase-1 (PDK1) and PDK2.",
            "journal": "The Biochemical journal",
            "date": "1999",
            "authors": "Kobayashi T, Cohen P",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1257604",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10191262",
                    "url": "https://glygen.org/publication/PubMed/10191262"
                }
            ]
        },
        {
            "title": "Inhibition of spontaneous receptor phosphorylation by residues in a putative alpha-helix in the KIT intracellular juxtamembrane region.",
            "journal": "The Journal of biological chemistry",
            "date": "1999",
            "authors": "Ma Y, Cunningham ME, Wang X, Ghosh I, Regan L, Longley BJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669935",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669935"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10224103",
                    "url": "https://glygen.org/publication/PubMed/10224103"
                }
            ]
        },
        {
            "title": "STAT protein recruitment and activation in c-Kit deletion mutants.",
            "journal": "The Journal of biological chemistry",
            "date": "1999",
            "authors": "Brizzi MF, Dentelli P, Rosso A, Yarden Y, Pegoraro L",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10358045",
                    "url": "https://glygen.org/publication/PubMed/10358045"
                }
            ]
        },
        {
            "title": "Activating c-kit gene mutations in human germ cell tumors.",
            "journal": "The American journal of pathology",
            "date": "1999",
            "authors": "Tian Q, Frierson HF Jr, Krystal GW, Moskaluk CA",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10362788",
                    "url": "https://glygen.org/publication/PubMed/10362788"
                }
            ]
        },
        {
            "title": "APS, an adaptor protein containing Pleckstrin homology (PH) and Src homology-2 (SH2) domains inhibits the JAK-STAT pathway in collaboration with c-Cbl.",
            "journal": "Leukemia",
            "date": "1999",
            "authors": "Wakioka T, Sasaki A, Mitsui K, Yokouchi M, Inoue A, Komiya S, Yoshimura A",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433559",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433559"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10374881",
                    "url": "https://glygen.org/publication/PubMed/10374881"
                }
            ]
        },
        {
            "title": "Identification of Tyr-703 and Tyr-936 as the primary association sites for Grb2 and Grb7 in the c-Kit/stem cell factor receptor.",
            "journal": "The Biochemical journal",
            "date": "1999",
            "authors": "Thommes K, Lennartsson J, Carlberg M, Ronnstrand L",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721-1",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721-1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10377264",
                    "url": "https://glygen.org/publication/PubMed/10377264"
                }
            ]
        },
        {
            "title": "The receptor protein tyrosine phosphatase, PTP-RO, is upregulated during megakaryocyte differentiation and Is associated with the c-Kit receptor.",
            "journal": "Blood",
            "date": "1999",
            "authors": "Taniguchi Y, London R, Schinkmann K, Jiang S, Avraham H",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10397721",
                    "url": "https://glygen.org/publication/PubMed/10397721"
                }
            ]
        },
        {
            "title": "AP2alpha and AP2gamma: a comparison of binding site specificity and trans-activation of the estrogen receptor promoter and single site promoter constructs.",
            "journal": "Nucleic acids research",
            "date": "1999",
            "authors": "McPherson LA, Weigel RJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-8866910",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10497269",
                    "url": "https://glygen.org/publication/PubMed/10497269"
                }
            ]
        },
        {
            "title": "Two co-existing mechanisms for nuclear import of MAP kinase: passive diffusion of a monomer and active transport of a dimer.",
            "journal": "The EMBO journal",
            "date": "1999",
            "authors": "Adachi M, Fukuda M, Nishida E",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10508167",
                    "url": "https://glygen.org/publication/PubMed/10508167"
                }
            ]
        },
        {
            "title": "Phosphorylation of Shc by Src family kinases is necessary for stem cell factor receptor/c-kit mediated activation of the Ras/MAP kinase pathway and c-fos induction.",
            "journal": "Oncogene",
            "date": "1999",
            "authors": "Lennartsson J, Blume-Jensen P, Hermanson M, Ponten E, Carlberg M, Ronnstrand L",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10523831",
                    "url": "https://glygen.org/publication/PubMed/10523831"
                }
            ]
        },
        {
            "title": "Isoforms of c-KIT differ in activation of signalling pathways and transformation of NIH3T3 fibroblasts.",
            "journal": "Oncogene",
            "date": "1999",
            "authors": "Caruana G, Cambareri AC, Ashman LK",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10523834",
                    "url": "https://glygen.org/publication/PubMed/10523834"
                }
            ]
        },
        {
            "title": "AP-2 family members regulate basal and cAMP-induced expression of human chorionic gonadotropin.",
            "journal": "Nucleic acids research",
            "date": "2000",
            "authors": "LiCalsi C, Christophe S, Steger DJ, Buescher M, Fischer W, Mellon PL",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-8866910",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10648798",
                    "url": "https://glygen.org/publication/PubMed/10648798"
                }
            ]
        },
        {
            "title": "Molecular cloning of murine STAP-1, the stem-cell-specific adaptor protein containing PH and SH2 domains.",
            "journal": "Biochemical and biophysical research communications",
            "date": "2000",
            "authors": "Masuhara M, Nagao K, Nishikawa M, Sasaki M, Yoshimura A, Osawa M",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10679268",
                    "url": "https://glygen.org/publication/PubMed/10679268"
                }
            ]
        },
        {
            "title": "A novel RalGEF-like protein, RGL3, as a candidate effector for rit and Ras.",
            "journal": "The Journal of biological chemistry",
            "date": "2000",
            "authors": "Shao H, Andres DA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10869344",
                    "url": "https://glygen.org/publication/PubMed/10869344"
                }
            ]
        },
        {
            "title": "Crystal structure of human stem cell factor: implication for stem cell factor receptor dimerization and activation.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2000",
            "authors": "Zhang Z, Zhang R, Joachimiak A, Schlessinger J, Kong XP",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10884405",
                    "url": "https://glygen.org/publication/PubMed/10884405"
                }
            ]
        },
        {
            "title": "The direct association of the multiple PDZ domain containing proteins (MUPP-1) with the human c-Kit C-terminus is regulated by tyrosine kinase activity.",
            "journal": "FEBS letters",
            "date": "2000",
            "authors": "Mancini A, Koch A, Stefan M, Niemann H, Tamura T",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11018522",
                    "url": "https://glygen.org/publication/PubMed/11018522"
                }
            ]
        },
        {
            "title": "Flt3 ligand induces tyrosine phosphorylation of gab1 and gab2 and their association with shp-2, grb2, and PI3 kinase.",
            "journal": "Biochemical and biophysical research communications",
            "date": "2000",
            "authors": "Zhang S, Broxmeyer HE",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11027663",
                    "url": "https://glygen.org/publication/PubMed/11027663"
                }
            ]
        },
        {
            "title": "Three novel mutations of the proto-oncogene KIT cause human piebaldism.",
            "journal": "American journal of medical genetics",
            "date": "2000",
            "authors": "Syrris P, Malik NM, Murday VA, Patton MA, Carter ND, Hughes HE, Metcalfe K",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11074500",
                    "url": "https://glygen.org/publication/PubMed/11074500"
                }
            ]
        },
        {
            "title": "Mast cell disease associated with acute myeloid leukemia: detection of a new c-kit mutation Asp816His.",
            "journal": "American journal of hematology",
            "date": "2000",
            "authors": "Pullarkat VA, Pullarkat ST, Calverley DC, Brynes RK",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11074560",
                    "url": "https://glygen.org/publication/PubMed/11074560"
                }
            ]
        },
        {
            "title": "Flt3 mutations from patients with acute myeloid leukemia induce transformation of 32D cells mediated by the Ras and STAT5 pathways.",
            "journal": "Blood",
            "date": "2000",
            "authors": "Mizuki M, Fenski R, Halfter H, Matsumura I, Schmidt R, Muller C, Gruning W, Kratz-Albers K, Serve S, Steur C, Buchner T, Kienast J, Kanakura Y, Berdel WE, Serve H",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11090077",
                    "url": "https://glygen.org/publication/PubMed/11090077"
                }
            ]
        },
        {
            "title": "Crystal structure and functional analysis of Ras binding to its effector phosphoinositide 3-kinase gamma.",
            "journal": "Cell",
            "date": "2000",
            "authors": "Pacold ME, Suire S, Perisic O, Lara-Gonzalez S, Davis CT, Walker EH, Hawkins PT, Stephens L, Eccleston JF, Williams RL",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11136978",
                    "url": "https://glygen.org/publication/PubMed/11136978"
                }
            ]
        },
        {
            "title": "A novel potential effector of M-Ras and p21 Ras negatively regulates p21 Ras-mediated gene induction and cell growth.",
            "journal": "Oncogene",
            "date": "2001",
            "authors": "Ehrhardt GR, Korherr C, Wieler JS, Knaus M, Schrader JW",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11313946",
                    "url": "https://glygen.org/publication/PubMed/11313946"
                }
            ]
        },
        {
            "title": "Signal transducer and activator of transcription 3 activation is required for Asp(816) mutant c-Kit-mediated cytokine-independent survival and proliferation in human leukemia cells.",
            "journal": "Blood",
            "date": "2001",
            "authors": "Ning ZQ, Li J, Arceci RJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11369651",
                    "url": "https://glygen.org/publication/PubMed/11369651"
                }
            ]
        },
        {
            "title": "Synthesis and function of 3-phosphorylated inositol lipids.",
            "journal": "Annual review of biochemistry",
            "date": "2001",
            "authors": "Vanhaesebroeck B, Leevers SJ, Ahmadi K, Timms J, Katso R, Driscoll PC, Woscholski R, Parker PJ, Waterfield MD",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11395417",
                    "url": "https://glygen.org/publication/PubMed/11395417"
                }
            ]
        },
        {
            "title": "STAT3 activation is required for Asp(816) mutant c-Kit induced tumorigenicity.",
            "journal": "Oncogene",
            "date": "2001",
            "authors": "Ning ZQ, Li J, McGuinness M, Arceci RJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11494148",
                    "url": "https://glygen.org/publication/PubMed/11494148"
                }
            ]
        },
        {
            "title": "Germline mutation in the juxtamembrane domain of the kit gene in a family with gastrointestinal stromal tumors and urticaria pigmentosa.",
            "journal": "Cancer",
            "date": "2001",
            "authors": "Beghini A, Tibiletti MG, Roversi G, Chiaravalli AM, Serio G, Capella C, Larizza L",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11505412",
                    "url": "https://glygen.org/publication/PubMed/11505412"
                }
            ]
        },
        {
            "title": "Phosphatidylinositol 3 kinase contributes to the transformation of hematopoietic cells by the D816V c-Kit mutant.",
            "journal": "Blood",
            "date": "2001",
            "authors": "Chian R, Young S, Danilkovitch-Miagkova A, Ronnstrand L, Leonard E, Ferrao P, Ashman L, Linnekin D",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                },
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11520784",
                    "url": "https://glygen.org/publication/PubMed/11520784"
                }
            ]
        },
        {
            "title": "Evidence for existence of a nuclear pore complex-mediated, cytosol-independent pathway of nuclear translocation of ERK MAP kinase in permeabilized cells.",
            "journal": "The Journal of biological chemistry",
            "date": "2001",
            "authors": "Matsubayashi Y, Fukuda M, Nishida E",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11546808",
                    "url": "https://glygen.org/publication/PubMed/11546808"
                }
            ]
        },
        {
            "title": "PEA-15 mediates cytoplasmic sequestration of ERK MAP kinase.",
            "journal": "Developmental cell",
            "date": "2001",
            "authors": "Formstecher E, Ramos JW, Fauquet M, Calderwood DA, Hsieh JC, Canton B, Nguyen XT, Barnier JV, Camonis J, Ginsberg MH, Chneiweiss H",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11702783",
                    "url": "https://glygen.org/publication/PubMed/11702783"
                }
            ]
        },
        {
            "title": "ShcA tyrosine phosphorylation sites can replace ShcA binding in signalling by middle T-antigen.",
            "journal": "The EMBO journal",
            "date": "2001",
            "authors": "Nicholson PR, Empereur S, Glover HR, Dilworth SM",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11707405",
                    "url": "https://glygen.org/publication/PubMed/11707405"
                }
            ]
        },
        {
            "title": "Rac1 and RhoG promote cell survival by the activation of PI3K and Akt, independently of their ability to stimulate JNK and NF-kappaB.",
            "journal": "Oncogene",
            "date": "2002",
            "authors": "Murga C, Zohar M, Teramoto H, Gutkind JS",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1257604",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11803464",
                    "url": "https://glygen.org/publication/PubMed/11803464"
                }
            ]
        },
        {
            "title": "Role for the adaptor protein Grb10 in the activation of Akt.",
            "journal": "Molecular and cellular biology",
            "date": "2002",
            "authors": "Jahn T, Seipel P, Urschel S, Peschel C, Duyster J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11809791",
                    "url": "https://glygen.org/publication/PubMed/11809791"
                }
            ]
        },
        {
            "title": "Phosphatidylinositol 3-kinase and Src family kinases are required for phosphorylation and membrane recruitment of Dok-1 in c-Kit signaling.",
            "journal": "J. Biol. Chem.",
            "date": "2002",
            "authors": "Liang Xiquan, Wisniewski David, Strife Annabel, Shivakrupa , Clarkson Bayard, Resh Marilyn D",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11825908",
                    "url": "https://glygen.org/publication/PubMed/11825908"
                }
            ]
        },
        {
            "title": "The Cbl family of ubiquitin ligases: critical negative regulators of tyrosine kinase signaling in the immune system.",
            "journal": "Journal of leukocyte biology",
            "date": "2002",
            "authors": "Rao N, Dodge I, Band H",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433559",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433559"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11994499",
                    "url": "https://glygen.org/publication/PubMed/11994499"
                }
            ]
        },
        {
            "title": "ERK2 enters the nucleus by a carrier-independent mechanism.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2002",
            "authors": "Whitehurst AW, Wilsbacher JL, You Y, Luby-Phelps K, Moore MS, Cobb MH",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12032311",
                    "url": "https://glygen.org/publication/PubMed/12032311"
                }
            ]
        },
        {
            "title": "Recruitment of stem and progenitor cells from the bone marrow niche requires MMP-9 mediated release of kit-ligand.",
            "journal": "Cell",
            "date": "2002",
            "authors": "Heissig B, Hattori K, Dias S, Friedrich M, Ferris B, Hackett NR, Crystal RG, Besmer P, Lyden D, Moore MA, Werb Z, Rafii S",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12062105",
                    "url": "https://glygen.org/publication/PubMed/12062105"
                }
            ]
        },
        {
            "title": "The phosphatidylinositol 3-Kinase AKT pathway in human cancer.",
            "journal": "Nature reviews. Cancer",
            "date": "2002",
            "authors": "Vivanco I, Sawyers CL",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12094235",
                    "url": "https://glygen.org/publication/PubMed/12094235"
                }
            ]
        },
        {
            "title": "Activation of phosphoinositide 3-kinase gamma by Ras.",
            "journal": "Current biology : CB",
            "date": "2002",
            "authors": "Suire S, Hawkins P, Stephens L",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12121613",
                    "url": "https://glygen.org/publication/PubMed/12121613"
                }
            ]
        },
        {
            "title": "Multiple phosphoinositide 3-kinase-dependent steps in activation of protein kinase B.",
            "journal": "Molecular and cellular biology",
            "date": "2002",
            "authors": "Scheid MP, Marignani PA, Woodgett JR",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1257604",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12167717",
                    "url": "https://glygen.org/publication/PubMed/12167717"
                }
            ]
        },
        {
            "title": "Efficacy and safety of imatinib mesylate in advanced gastrointestinal stromal tumors.",
            "journal": "The New England journal of medicine",
            "date": "2002",
            "authors": "Demetri GD, von Mehren M, Blanke CD, Van den Abbeele AD, Eisenberg B, Roberts PJ, Heinrich MC, Tuveson DA, Singer S, Janicek M, Fletcher JA, Silverman SG, Silberman SL, Capdeville R, Kiese B, Peng B, Dimitrijevic S, Druker BJ, Corless C, Fletcher CD, Joensuu H",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669929",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669929"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12181401",
                    "url": "https://glygen.org/publication/PubMed/12181401"
                }
            ]
        },
        {
            "title": "Fer kinase is required for sustained p38 kinase activation and maximal chemotaxis of activated mast cells.",
            "journal": "Molecular and cellular biology",
            "date": "2002",
            "authors": "Craig AW, Greer PA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12192036",
                    "url": "https://glygen.org/publication/PubMed/12192036"
                }
            ]
        },
        {
            "title": "The adapter protein APS associates with the multifunctional docking sites Tyr-568 and Tyr-936 in c-Kit.",
            "journal": "The Biochemical journal",
            "date": "2003",
            "authors": "Wollberg P, Lennartsson J, Gottfridsson E, Yoshimura A, Ronnstrand L",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433559",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433559"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12444928",
                    "url": "https://glygen.org/publication/PubMed/12444928"
                }
            ]
        },
        {
            "title": "The Src-selective kinase inhibitor PP1 also inhibits Kit and Bcr-Abl tyrosine kinases.",
            "journal": "The Journal of biological chemistry",
            "date": "2003",
            "authors": "Tatton L, Morley GM, Chopra R, Khwaja A",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12475982",
                    "url": "https://glygen.org/publication/PubMed/12475982"
                }
            ]
        },
        {
            "title": "Juxtamembrane mutant V560GKit is more sensitive to Imatinib (STI571) compared with wild-type c-kit whereas the kinase domain mutant D816VKit is resistant.",
            "journal": "Molecular cancer therapeutics",
            "date": "2002",
            "authors": "Frost MJ, Ferrao PT, Hughes TP, Ashman LK",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12481435",
                    "url": "https://glygen.org/publication/PubMed/12481435"
                }
            ]
        },
        {
            "title": "Src family kinases are involved in the differential signaling from two splice forms of c-Kit.",
            "journal": "The Journal of biological chemistry",
            "date": "2003",
            "authors": "Voytyuk O, Lennartsson J, Mogi A, Caruana G, Courtneidge S, Ashman LK, Ronnstrand L",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12511554",
                    "url": "https://glygen.org/publication/PubMed/12511554"
                }
            ]
        },
        {
            "title": "Mutational analysis of class III receptor tyrosine kinases (C-KIT, C-FMS, FLT3) in idiopathic myelofibrosis.",
            "journal": "British journal of haematology",
            "date": "2003",
            "authors": "Abu-Duhier FM, Goodeve AC, Care RS, Gari M, Wilson GA, Peake IR, Reilly JT",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12580961",
                    "url": "https://glygen.org/publication/PubMed/12580961"
                }
            ]
        },
        {
            "title": "The role of PI3K in immune cells.",
            "journal": "Nature immunology",
            "date": "2003",
            "authors": "Koyasu S",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12660731",
                    "url": "https://glygen.org/publication/PubMed/12660731"
                }
            ]
        },
        {
            "title": "Autoinhibition of the kit receptor tyrosine kinase by the cytosolic juxtamembrane region.",
            "journal": "Molecular and cellular biology",
            "date": "2003",
            "authors": "Chan PM, Ilangumaran S, La Rose J, Chakrabartty A, Rottapel R",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669935",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669935"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12697809",
                    "url": "https://glygen.org/publication/PubMed/12697809"
                }
            ]
        },
        {
            "title": "Threonine 308 phosphorylated form of Akt translocates to the nucleus of PC12 cells under nerve growth factor stimulation and associates with the nuclear matrix protein nucleolin.",
            "journal": "Journal of cellular physiology",
            "date": "2003",
            "authors": "Borgatti P, Martelli AM, Tabellini G, Bellacosa A, Capitani S, Neri LM",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1257604",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12767043",
                    "url": "https://glygen.org/publication/PubMed/12767043"
                }
            ]
        },
        {
            "title": "Organization and nucleotide sequence of the human KIT (mast/stem cell growth factor receptor) proto-oncogene.",
            "journal": "Oncogene",
            "date": "1992",
            "authors": "Giebel L B, Strunk K M, Holmes S A, Spritz R A",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "1279499",
                    "url": "https://glygen.org/publication/PubMed/1279499"
                }
            ]
        },
        {
            "title": "Flt-3 and c-kit mutation studies in a spectrum of chronic myeloid disorders including systemic mast cell disease.",
            "journal": "Leukemia research",
            "date": "2003",
            "authors": "Pardanani A, Reeder TL, Kimlinger TK, Baek JY, Li CY, Butterfield JH, Tefferi A",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12801532",
                    "url": "https://glygen.org/publication/PubMed/12801532"
                }
            ]
        },
        {
            "title": "Structure of a c-kit product complex reveals the basis for kinase transactivation.",
            "journal": "The Journal of biological chemistry",
            "date": "2003",
            "authors": "Mol CD, Lim KB, Sridhar V, Zou H, Chien EY, Sang BC, Nowakowski J, Kassel DB, Cronin CN, McRee DE",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12824176",
                    "url": "https://glygen.org/publication/PubMed/12824176"
                }
            ]
        },
        {
            "title": "Identification of Tyr900 in the kinase domain of c-Kit as a Src-dependent phosphorylation site mediating interaction with c-Crk.",
            "journal": "Experimental cell research",
            "date": "2003",
            "authors": "Lennartsson J, Wernstedt C, Engstrom U, Hellman U, Ronnstrand L",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721-1",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721-1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12878163",
                    "url": "https://glygen.org/publication/PubMed/12878163"
                }
            ]
        },
        {
            "title": "Regulation of protein serine-threonine phosphatase type-2A by tyrosine phosphorylation.",
            "journal": "Science (New York, N.Y.)",
            "date": "1992",
            "authors": "Chen J, Martin BL, Brautigan DL",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-6811558",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811558"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "1325671",
                    "url": "https://glygen.org/publication/PubMed/1325671"
                }
            ]
        },
        {
            "title": "Dominant negative and loss of function mutations of the c-kit (mast/stem cell growth factor receptor) proto-oncogene in human piebaldism.",
            "journal": "American journal of human genetics",
            "date": "1992",
            "authors": "Spritz RA, Giebel LB, Holmes SA",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "1370874",
                    "url": "https://glygen.org/publication/PubMed/1370874"
                }
            ]
        },
        {
            "title": "p21ras activation via hemopoietin receptors and c-kit requires tyrosine kinase activity but not tyrosine phosphorylation of p21ras GTPase-activating protein.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "1992",
            "authors": "Duronio V, Welham MJ, Abraham S, Dryden P, Schrader JW",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "1371879",
                    "url": "https://glygen.org/publication/PubMed/1371879"
                }
            ]
        },
        {
            "title": "A recombinant ectodomain of the receptor for the stem cell factor (SCF) retains ligand-induced receptor dimerization and antagonizes SCF-stimulated cellular responses.",
            "journal": "The Journal of biological chemistry",
            "date": "1992",
            "authors": "Lev S, Yarden Y, Givol D",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "1375232",
                    "url": "https://glygen.org/publication/PubMed/1375232"
                }
            ]
        },
        {
            "title": "Human piebald trait resulting from a dominant negative mutant allele of the c-kit membrane receptor gene.",
            "journal": "The Journal of clinical investigation",
            "date": "1992",
            "authors": "Fleischman RA",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "1376329",
                    "url": "https://glygen.org/publication/PubMed/1376329"
                }
            ]
        },
        {
            "title": "Steel factor stimulates the tyrosine phosphorylation of the proto-oncogene product, p95vav, in human hemopoietic cells.",
            "journal": "The Journal of biological chemistry",
            "date": "1992",
            "authors": "Alai M, Mui AL, Cutler RL, Bustelo XR, Barbacid M, Krystal G",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "1381360",
                    "url": "https://glygen.org/publication/PubMed/1381360"
                }
            ]
        },
        {
            "title": "Inhibition of SH2 domain/phosphoprotein association by a nonhydrolyzable phosphonopeptide.",
            "journal": "Biochemistry",
            "date": "1992-10-20",
            "authors": "Domchek S M, Auger K R, Chatterjee S, Burke T R, Shoelson S E",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "1382595",
                    "url": "https://glygen.org/publication/PubMed/1382595"
                }
            ]
        },
        {
            "title": "PEA-15 binding to ERK1/2 MAPKs is required for its modulation of integrin activation.",
            "journal": "The Journal of biological chemistry",
            "date": "2003",
            "authors": "Chou FL, Hill JM, Hsieh JC, Pouyssegur J, Brunet A, Glading A, Uberall F, Ramos JW, Werner MH, Ginsberg MH",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14506247",
                    "url": "https://glygen.org/publication/PubMed/14506247"
                }
            ]
        },
        {
            "title": "KIT mutations are common in testicular seminomas.",
            "journal": "The American journal of pathology",
            "date": "2004",
            "authors": "Kemmer K, Corless CL, Fletcher JA, McGreevey L, Haley A, Griffith D, Cummings OW, Wait C, Town A, Heinrich MC",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14695343",
                    "url": "https://glygen.org/publication/PubMed/14695343"
                }
            ]
        },
        {
            "title": "The death effector domain protein PEA-15 prevents nuclear entry of ERK2 by inhibiting required interactions.",
            "journal": "The Journal of biological chemistry",
            "date": "2004",
            "authors": "Whitehurst AW, Robinson FL, Moore MS, Cobb MH",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14707138",
                    "url": "https://glygen.org/publication/PubMed/14707138"
                }
            ]
        },
        {
            "title": "Activator protein 2alpha inhibits tumorigenicity and represses vascular endothelial growth factor transcription in prostate cancer cells.",
            "journal": "Cancer research",
            "date": "2004",
            "authors": "Ruiz M, Pettaway C, Song R, Stoeltzing O, Ellis L, Bar-Eli M",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-8866910",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14744778",
                    "url": "https://glygen.org/publication/PubMed/14744778"
                }
            ]
        },
        {
            "title": "Mechanisms of oncogenic KIT signal transduction in primary gastrointestinal stromal tumors (GISTs).",
            "journal": "Oncogene",
            "date": "2004",
            "authors": "Duensing A, Medeiros F, McConarty B, Joseph NE, Panigrahy D, Singer S, Fletcher CD, Demetri GD, Fletcher JA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15007386",
                    "url": "https://glygen.org/publication/PubMed/15007386"
                }
            ]
        },
        {
            "title": "Use of c-KIT/PDGFRA mutational analysis to predict the clinical response to imatinib in patients with advanced gastrointestinal stromal tumours entered on phase I and II studies of the EORTC Soft Tissue and Bone Sarcoma Group.",
            "journal": "European journal of cancer (Oxford, England : 1990)",
            "date": "2004",
            "authors": "Debiec-Rychter M, Dumez H, Judson I, Wasag B, Verweij J, Brown M, Dimitrijevic S, Sciot R, Stul M, Vranck H, Scurr M, Hagemeijer A, van Glabbeke M, van Oosterom AT",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669921",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669921"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15010069",
                    "url": "https://glygen.org/publication/PubMed/15010069"
                }
            ]
        },
        {
            "title": "Expression of a truncated form of the c-Kit tyrosine kinase receptor and activation of Src kinase in human prostatic cancer.",
            "journal": "Am. J. Pathol.",
            "date": "2004",
            "authors": "Paronetto MP, Farini D, Sammarco I, Maturo G, Vespasiani G, Geremia R, Rossi P, Sette C",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15039213",
                    "url": "https://glygen.org/publication/PubMed/15039213"
                }
            ]
        },
        {
            "title": "Structural basis for the autoinhibition and STI-571 inhibition of c-Kit tyrosine kinase.",
            "journal": "J. Biol. Chem.",
            "date": "2004",
            "authors": "Mol CD, Dougan DR, Schneider TR, Skene RJ, Kraus ML, Scheibe DN, Snell GP, Zou H, Sang BC, Wilson KP",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669935",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669935"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15123710",
                    "url": "https://glygen.org/publication/PubMed/15123710"
                }
            ]
        },
        {
            "title": "Autophosphorylation of JAK2 on tyrosines 221 and 570 regulates its activity.",
            "journal": "Molecular and cellular biology",
            "date": "2004",
            "authors": "Argetsinger LS, Kouadio JL, Steen H, Stensballe A, Jensen ON, Carter-Su C",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15143187",
                    "url": "https://glygen.org/publication/PubMed/15143187"
                }
            ]
        },
        {
            "title": "A germline mutation in KIT in familial diffuse cutaneous mastocytosis.",
            "journal": "Journal of medical genetics",
            "date": "2004",
            "authors": "Tang X, Boxer M, Drummond A, Ogston P, Hodgins M, Burden AD",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15173254",
                    "url": "https://glygen.org/publication/PubMed/15173254"
                }
            ]
        },
        {
            "title": "A missense mutation in KIT kinase domain 1 correlates with imatinib resistance in gastrointestinal stromal tumors.",
            "journal": "Cancer research",
            "date": "2004",
            "authors": "Chen LL, Trent JC, Wu EF, Fuller GN, Ramdas L, Zhang W, Raymond AK, Prieto VG, Oyedeji CO, Hunt KK, Pollock RE, Feig BW, Hayes KJ, Choi H, Macapinlac HA, Hittelman W, Velasco MA, Patel S, Burgess MA, Benjamin RS, Frazier ML",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669917",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669917"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15342366",
                    "url": "https://glygen.org/publication/PubMed/15342366"
                }
            ]
        },
        {
            "title": "Phosphorylation of Grb2-associated binder 2 on serine 623 by ERK MAPK regulates its association with the phosphatase SHP-2 and decreases STAT5 activation.",
            "journal": "Journal of immunology (Baltimore, Md. : 1950)",
            "date": "2004",
            "authors": "Arnaud M, Crouin C, Deon C, Loyaux D, Bertoglio J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15356145",
                    "url": "https://glygen.org/publication/PubMed/15356145"
                }
            ]
        },
        {
            "title": "Molecular basis of the constitutive activity and STI571 resistance of Asp816Val mutant KIT receptor tyrosine kinase.",
            "journal": "Journal of molecular graphics & modelling",
            "date": "2004",
            "authors": "Foster R, Griffith R, Ferrao P, Ashman L",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669917",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669917"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15363456",
                    "url": "https://glygen.org/publication/PubMed/15363456"
                }
            ]
        },
        {
            "title": "Nuclear localization and regulation of erk- and rsk-encoded protein kinases.",
            "journal": "Molecular and cellular biology",
            "date": "1992",
            "authors": "Chen RH, Sarnecki C, Blenis J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "1545823",
                    "url": "https://glygen.org/publication/PubMed/1545823"
                }
            ]
        },
        {
            "title": "Aleukemic mast cell leukemia with abnormal immunophenotype and c-kit mutation D816V.",
            "journal": "Leukemia & lymphoma",
            "date": "2004",
            "authors": "Noack F, Sotlar K, Notter M, Thiel E, Valent P, Horny HP",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15512820",
                    "url": "https://glygen.org/publication/PubMed/15512820"
                }
            ]
        },
        {
            "title": "Signal transduction via the stem cell factor receptor/c-Kit.",
            "journal": "Cell. Mol. Life Sci.",
            "date": "2004",
            "authors": "Ronnstrand L",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15526160",
                    "url": "https://glygen.org/publication/PubMed/15526160"
                }
            ]
        },
        {
            "title": "Live Cell Imaging of ERK and MEK: simple binding equilibrium explains the regulated nucleocytoplasmic distribution of ERK.",
            "journal": "The Journal of biological chemistry",
            "date": "2005",
            "authors": "Burack WR, Shaw AS",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15546878",
                    "url": "https://glygen.org/publication/PubMed/15546878"
                }
            ]
        },
        {
            "title": "Normal and oncogenic forms of the receptor tyrosine kinase kit.",
            "journal": "Stem Cells",
            "date": "2005",
            "authors": "Lennartsson Johan, Jelacic Tanya, Linnekin Diana, Shivakrupa R",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15625120",
                    "url": "https://glygen.org/publication/PubMed/15625120"
                }
            ]
        },
        {
            "title": "Mechanisms of resistance to imatinib mesylate in gastrointestinal stromal tumors and activity of the PKC412 inhibitor against imatinib-resistant mutants.",
            "journal": "Gastroenterology",
            "date": "2005",
            "authors": "Debiec-Rychter M, Cools J, Dumez H, Sciot R, Stul M, Mentens N, Vranckx H, Wasag B, Prenen H, Roesel J, Hagemeijer A, Van Oosterom A, Marynen P",
            "evidence": [
                {
                    "database": "dbSNP",
                    "id": "rs769701248",
                    "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs769701248"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15685537",
                    "url": "https://glygen.org/publication/PubMed/15685537"
                }
            ]
        },
        {
            "title": "Phosphorylation and regulation of Akt/PKB by the rictor-mTOR complex.",
            "journal": "Science (New York, N.Y.)",
            "date": "2005",
            "authors": "Sarbassov DD, Guertin DA, Ali SM, Sabatini DM",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1257604",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15718470",
                    "url": "https://glygen.org/publication/PubMed/15718470"
                }
            ]
        },
        {
            "title": "Activation mutations of human c-KIT resistant to imatinib mesylate are sensitive to the tyrosine kinase inhibitor PKC412.",
            "journal": "Blood",
            "date": "2005",
            "authors": "Growney JD, Clark JJ, Adelsperger J, Stone R, Fabbro D, Griffin JD, Gilliland DG",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15790786",
                    "url": "https://glygen.org/publication/PubMed/15790786"
                }
            ]
        },
        {
            "title": "A mutation-created novel intra-exonic pre-mRNA splice site causes constitutive activation of KIT in human gastrointestinal stromal tumors.",
            "journal": "Oncogene",
            "date": "2005",
            "authors": "Chen LL, Sabripour M, Wu EF, Prieto VG, Fuller GN, Frazier ML",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15824741",
                    "url": "https://glygen.org/publication/PubMed/15824741"
                }
            ]
        },
        {
            "title": "PI 3-kinase p110beta: a new target for antithrombotic therapy.",
            "journal": "Nature medicine",
            "date": "2005",
            "authors": "Jackson SP, Schoenwaelder SM, Goncalves I, Nesbitt WS, Yap CL, Wright CE, Kenche V, Anderson KE, Dopheide SM, Yuan Y, Sturgeon SA, Prabaharan H, Thompson PE, Smith GD, Shepherd PR, Daniele N, Kulkarni S, Abbott B, Saylik D, Jones C, Lu L, Giuliano S, Hughan SC, Angus JA, Robertson AD, Salem HH",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15834429",
                    "url": "https://glygen.org/publication/PubMed/15834429"
                }
            ]
        },
        {
            "title": "Familial gastrointestinal stromal tumor syndrome: phenotypic and molecular features in a kindred.",
            "journal": "Journal of clinical oncology : official journal of the American Society of Clinical Oncology",
            "date": "2005",
            "authors": "Li FP, Fletcher JA, Heinrich MC, Garber JE, Sallan SE, Curiel-Lewandrowski C, Duensing A, van de Rijn M, Schnipper LE, Demetri GD",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15837988",
                    "url": "https://glygen.org/publication/PubMed/15837988"
                }
            ]
        },
        {
            "title": "Yin Yang 1 cooperates with activator protein 2 to stimulate ERBB2 gene expression in mammary cancer cells.",
            "journal": "The Journal of biological chemistry",
            "date": "2005",
            "authors": "Begon DY, Delacroix L, Vernimmen D, Jackers P, Winkler R",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-8866910",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15870067",
                    "url": "https://glygen.org/publication/PubMed/15870067"
                }
            ]
        },
        {
            "title": "A c-KIT codon 816 mutation, D816H, in the testicular germ cell tumor: case report of a Japanese patient with bilateral testicular seminomas.",
            "journal": "Acta medica Okayama",
            "date": "2005",
            "authors": "Tate G, Suzuki T, Kishimoto K, Mitsuya T",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15902997",
                    "url": "https://glygen.org/publication/PubMed/15902997"
                }
            ]
        },
        {
            "title": "STI 571 inhibition effect on KITAsn822Lys-mediated signal transduction cascade.",
            "journal": "Experimental hematology",
            "date": "2005",
            "authors": "Beghini A, Bellini M, Magnani I, Colapietro P, Cairoli R, Morra E, Larizza L",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15911092",
                    "url": "https://glygen.org/publication/PubMed/15911092"
                }
            ]
        },
        {
            "title": "Imatinib resistance in gastrointestinal stromal tumors.",
            "journal": "Current oncology reports",
            "date": "2005",
            "authors": "Chen LL, Sabripour M, Andtbacka RH, Patel SR, Feig BW, Macapinlac HA, Choi H, Wu EF, Frazier ML, Benjamin RS",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15946589",
                    "url": "https://glygen.org/publication/PubMed/15946589"
                }
            ]
        },
        {
            "title": "Human malignant melanoma: detection of BRAF- and c-kit-activating mutations by high-resolution amplicon melting analysis.",
            "journal": "Human pathology",
            "date": "2005",
            "authors": "Willmore-Payne C, Holden JA, Tripp S, Layfield LJ",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15948115",
                    "url": "https://glygen.org/publication/PubMed/15948115"
                }
            ]
        },
        {
            "title": "Activity of the tyrosine kinase inhibitor PKC412 in a patient with mast cell leukemia with the D816V KIT mutation.",
            "journal": "Blood",
            "date": "2005",
            "authors": "Gotlib J, Berube C, Growney JD, Chen CC, George TI, Williams C, Kajiguchi T, Ruan J, Lilleberg SL, Durocher JA, Lichy JH, Wang Y, Cohen PS, Arber DA, Heinrich MC, Neckers L, Galli SJ, Gilliland DG, Coutre SE",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669921",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669921"
                },
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15972446",
                    "url": "https://glygen.org/publication/PubMed/15972446"
                }
            ]
        },
        {
            "title": "Expression of KIT (CD117) in renal cell carcinoma and renal oncocytoma.",
            "journal": "Oncology",
            "date": "2005",
            "authors": "Kruger S, Sotlar K, Kausch I, Horny HP",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16015044",
                    "url": "https://glygen.org/publication/PubMed/16015044"
                }
            ]
        },
        {
            "title": "Extracellular KIT receptor mutants, commonly found in core binding factor AML, are constitutively active and respond to imatinib mesylate.",
            "journal": "Blood",
            "date": "2005",
            "authors": "Cammenga J, Horn S, Bergholz U, Sommer G, Besmer P, Fiedler W, Stocking C",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9680187",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680187"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16081693",
                    "url": "https://glygen.org/publication/PubMed/16081693"
                }
            ]
        },
        {
            "title": "Signaling by Kit protein-tyrosine kinase--the stem cell factor receptor.",
            "journal": "Biochem. Biophys. Res. Commun.",
            "date": "2005",
            "authors": "Roskoski R Jr",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16129412",
                    "url": "https://glygen.org/publication/PubMed/16129412"
                }
            ]
        },
        {
            "title": "Sequence analysis of the protein kinase gene family in human testicular germ-cell tumors of adolescents and adults.",
            "journal": "Genes, chromosomes & cancer",
            "date": "2006",
            "authors": "Bignell G, Smith R, Hunter C, Stephens P, Davies H, Greenman C, Teague J, Butler A, Edkins S, Stevens C, O'Meara S, Parker A, Avis T, Barthorpe S, Brackenbury L, Buck G, Clements J, Cole J, Dicks E, Edwards K, Forbes S, Gorton M, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jones D, Kosmidou V, Laman R, Lugg R, Menzies A, Perry J, Petty R, Raine K, Shepherd R, Small A, Solomon H, Stephens Y, Tofts C, Varian J, Webb A, West S, Widaa S, Yates A, Gillis AJ, Stoop HJ, van Gurp RJ, Oosterhuis JW, Looijenga LH, Futreal PA, Wooster R, Stratton MR",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16175573",
                    "url": "https://glygen.org/publication/PubMed/16175573"
                }
            ]
        },
        {
            "title": "KIT (c-kit oncogene product) pathway is constitutively activated in human testicular germ cell tumors.",
            "journal": "Biochemical and biophysical research communications",
            "date": "2005",
            "authors": "Nakai Y, Nonomura N, Oka D, Shiba M, Arai Y, Nakayama M, Inoue H, Nishimura K, Aozasa K, Mizutani Y, Miki T, Okuyama A",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16188233",
                    "url": "https://glygen.org/publication/PubMed/16188233"
                }
            ]
        },
        {
            "title": "PKC412 inhibits in vitro growth of neoplastic human mast cells expressing the D816V-mutated variant of KIT: comparison with AMN107, imatinib, and cladribine (2CdA) and evaluation of cooperative drug effects.",
            "journal": "Blood",
            "date": "2006",
            "authors": "Gleixner KV, Mayerhofer M, Aichberger KJ, Derdak S, Sonneck K, Bohm A, Gruze A, Samorapoompichit P, Manley PW, Fabbro D, Pickl WF, Sillaber C, Valent P",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669921",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669921"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16189265",
                    "url": "https://glygen.org/publication/PubMed/16189265"
                }
            ]
        },
        {
            "title": "The c-kit (CD117) sequence variation M541L, but not N564K, is frequent in the general population, and is not associated with CML in Caucasians.",
            "journal": "Leukemia",
            "date": "2006",
            "authors": "Kruger S, Emig M, Lohse P, Ehninger G, Hochhaus A, Schackert HK",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16307017",
                    "url": "https://glygen.org/publication/PubMed/16307017"
                }
            ]
        },
        {
            "title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.",
            "journal": "Journal of proteome research",
            "date": "2005",
            "authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721#ptm_processing"
                },
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16335952",
                    "url": "https://glygen.org/publication/PubMed/16335952"
                }
            ]
        },
        {
            "title": "The oncogenic properties of mutant p110alpha and p110beta phosphatidylinositol 3-kinases in human mammary epithelial cells.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2005",
            "authors": "Zhao JJ, Liu Z, Wang L, Shin E, Loda MF, Roberts TM",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16339315",
                    "url": "https://glygen.org/publication/PubMed/16339315"
                }
            ]
        },
        {
            "title": "Imatinib binding and cKIT inhibition is abrogated by the cKIT kinase domain I missense mutation Val654Ala.",
            "journal": "Molecular cancer therapeutics",
            "date": "2005",
            "authors": "McLean SR, Gana-Weisz M, Hartzoulakis B, Frow R, Whelan J, Selwood D, Boshoff C",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669917",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669917"
                },
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16373716",
                    "url": "https://glygen.org/publication/PubMed/16373716"
                }
            ]
        },
        {
            "title": "Dasatinib (BMS-354825), a dual SRC/ABL kinase inhibitor, inhibits the kinase activity of wild-type, juxtamembrane, and activation loop mutant KIT isoforms associated with human malignancies.",
            "journal": "Cancer research",
            "date": "2006",
            "authors": "Schittenhelm MM, Shiraga S, Schroeder A, Corbin AS, Griffith D, Lee FY, Bokemeyer C, Deininger MW, Druker BJ, Heinrich MC",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16397263",
                    "url": "https://glygen.org/publication/PubMed/16397263"
                }
            ]
        },
        {
            "title": "B56-containing PP2A dephosphorylate ERK and their activity is controlled by the early gene IEX-1 and ERK.",
            "journal": "The EMBO journal",
            "date": "2006",
            "authors": "Letourneux C, Rocher G, Porteu F",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-6811558",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811558"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16456541",
                    "url": "https://glygen.org/publication/PubMed/16456541"
                }
            ]
        },
        {
            "title": "Stem cell factor and its receptor c-Kit as targets for inflammatory diseases.",
            "journal": "European journal of pharmacology",
            "date": "2006",
            "authors": "Reber L, Da Silva CA, Frossard N",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16483568",
                    "url": "https://glygen.org/publication/PubMed/16483568"
                }
            ]
        },
        {
            "title": "Co expression of SCF and KIT in gastrointestinal stromal tumours (GISTs) suggests an autocrine/paracrine mechanism.",
            "journal": "British journal of cancer",
            "date": "2006",
            "authors": "Theou-Anton N, Tabone S, Brouty-Boye D, Saffroy R, Ronnstrand L, Lemoine A, Emile JF",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16570044",
                    "url": "https://glygen.org/publication/PubMed/16570044"
                }
            ]
        },
        {
            "title": "Rapamycin inhibits growth and survival of D816V-mutated c-kit mast cells.",
            "journal": "Blood",
            "date": "2006",
            "authors": "Gabillot-Carre M, Lepelletier Y, Humbert M, de Sepuvelda P, Hamouda NB, Zappulla JP, Liblau R, Ribadeau-Dumas A, Machavoine F, Letard S, Baude C, Hermant A, Yang Y, Vargaftig J, Bodemer C, Morelon E, Lortholary O, Recher C, Laurent G, Dy M, Arock M, Dubreuil P, Hermine O",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16597595",
                    "url": "https://glygen.org/publication/PubMed/16597595"
                }
            ]
        },
        {
            "title": "Roles of tyrosine 589 and 591 in STAT5 activation and transformation mediated by FLT3-ITD.",
            "journal": "Blood",
            "date": "2006",
            "authors": "Rocnik JL, Okabe R, Yu JC, Lee BH, Giese N, Schenkein DP, Gilliland DG",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16627759",
                    "url": "https://glygen.org/publication/PubMed/16627759"
                }
            ]
        },
        {
            "title": "A pharmacological map of the PI3-K family defines a role for p110alpha in insulin signaling.",
            "journal": "Cell",
            "date": "2006",
            "authors": "Knight ZA, Gonzalez B, Feldman ME, Zunder ER, Goldenberg DD, Williams O, Loewith R, Stokoe D, Balla A, Toth B, Balla T, Weiss WA, Williams RL, Shokat KM",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16647110",
                    "url": "https://glygen.org/publication/PubMed/16647110"
                }
            ]
        },
        {
            "title": "BRAF and c-kit gene copy number in mutation-positive malignant melanoma.",
            "journal": "Human pathology",
            "date": "2006",
            "authors": "Willmore-Payne C, Holden JA, Hirschowitz S, Layfield LJ",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16647948",
                    "url": "https://glygen.org/publication/PubMed/16647948"
                }
            ]
        },
        {
            "title": "Identification of Y589 and Y599 in the juxtamembrane domain of Flt3 as ligand-induced autophosphorylation sites involved in binding of Src family kinases and the protein tyrosine phosphatase SHP2.",
            "journal": "Blood",
            "date": "2006",
            "authors": "Heiss E, Masson K, Sundberg C, Pedersen M, Sun J, Bengtsson S, Ronnstrand L",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16684964",
                    "url": "https://glygen.org/publication/PubMed/16684964"
                }
            ]
        },
        {
            "title": "Therapeutic effect of imatinib in gastrointestinal stromal tumors: AKT signaling dependent and independent mechanisms.",
            "journal": "Cancer research",
            "date": "2006",
            "authors": "Tarn C, Skorobogatko YV, Taguchi T, Eisenberg B, von Mehren M, Godwin AK",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16707477",
                    "url": "https://glygen.org/publication/PubMed/16707477"
                }
            ]
        },
        {
            "title": "Signalling and functional diversity within the Axl subfamily of receptor tyrosine kinases.",
            "journal": "Cytokine & growth factor reviews",
            "date": "2006",
            "authors": "Hafizi S, Dahlback B",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16737840",
                    "url": "https://glygen.org/publication/PubMed/16737840"
                }
            ]
        },
        {
            "title": "Flavopiridol targets c-KIT transcription and induces apoptosis in gastrointestinal stromal tumor cells.",
            "journal": "Cancer research",
            "date": "2006",
            "authors": "Sambol EB, Ambrosini G, Geha RC, Kennealey PT, Decarolis P, O'connor R, Wu YV, Motwani M, Chen JH, Schwartz GK, Singer S",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16740725",
                    "url": "https://glygen.org/publication/PubMed/16740725"
                }
            ]
        },
        {
            "title": "Detection of c-kit exons 11- and 17-activating mutations in testicular seminomas by high-resolution melting amplicon analysis.",
            "journal": "Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc",
            "date": "2006",
            "authors": "Willmore-Payne C, Holden JA, Chadwick BE, Layfield LJ",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16741525",
                    "url": "https://glygen.org/publication/PubMed/16741525"
                }
            ]
        },
        {
            "title": "Functional analyses and molecular modeling of two c-Kit mutations responsible for imatinib secondary resistance in GIST patients.",
            "journal": "Oncogene",
            "date": "2006",
            "authors": "Tamborini E, Pricl S, Negri T, Lagonigro MS, Miselli F, Greco A, Gronchi A, Casali PG, Ferrone M, Fermeglia M, Carbone A, Pierotti MA, Pilotti S",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669917",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669917"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16751810",
                    "url": "https://glygen.org/publication/PubMed/16751810"
                }
            ]
        },
        {
            "title": "Direct binding of Cbl to Tyr568 and Tyr936 of the stem cell factor receptor/c-Kit is required for ligand-induced ubiquitination, internalization and degradation.",
            "journal": "The Biochemical journal",
            "date": "2006",
            "authors": "Masson K, Heiss E, Band H, Ronnstrand L",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433559",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433559"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16780420",
                    "url": "https://glygen.org/publication/PubMed/16780420"
                }
            ]
        },
        {
            "title": "Rational design of inhibitors that bind to inactive kinase conformations.",
            "journal": "Nature chemical biology",
            "date": "2006",
            "authors": "Liu Y, Gray NS",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669921",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669921"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16783341",
                    "url": "https://glygen.org/publication/PubMed/16783341"
                }
            ]
        },
        {
            "title": "The scaffolding adapter Gab2, via Shp-2, regulates kit-evoked mast cell proliferation by activating the Rac/JNK pathway.",
            "journal": "The Journal of biological chemistry",
            "date": "2006",
            "authors": "Yu M, Luo J, Yang W, Wang Y, Mizuki M, Kanakura Y, Besmer P, Neel BG, Gu H",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16873377",
                    "url": "https://glygen.org/publication/PubMed/16873377"
                }
            ]
        },
        {
            "title": "Oncogenic Kit signaling and therapeutic intervention in a mouse model of gastrointestinal stromal tumor.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2006",
            "authors": "Rossi F, Ehlers I, Agosti V, Socci ND, Viale A, Sommer G, Yozgat Y, Manova K, Antonescu CR, Besmer P",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16908864",
                    "url": "https://glygen.org/publication/PubMed/16908864"
                }
            ]
        },
        {
            "title": "Allele-specific polymerase chain reaction for the imatinib-resistant KIT D816V and D816F mutations in mastocytosis and acute myelogenous leukemia.",
            "journal": "The Journal of molecular diagnostics : JMD",
            "date": "2006",
            "authors": "Corless CL, Harrell P, Lacouture M, Bainbridge T, Le C, Gatter K, White C Jr, Granter S, Heinrich MC",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17065430",
                    "url": "https://glygen.org/publication/PubMed/17065430"
                }
            ]
        },
        {
            "title": "Haematopoietic progenitor cells utilise conventional PKC to suppress PKB/Akt activity in response to c-Kit stimulation.",
            "journal": "British journal of haematology",
            "date": "2007",
            "authors": "Edling CE, Pedersen M, Carlsson L, Ronnstrand L, Palmer RH, Hallberg B",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17156394",
                    "url": "https://glygen.org/publication/PubMed/17156394"
                }
            ]
        },
        {
            "title": "Association of p21ras with phosphatidylinositol 3-kinase.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "1991",
            "authors": "Sjolander A, Yamamoto K, Huber BE, Lapetina EG",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "1716764",
                    "url": "https://glygen.org/publication/PubMed/1716764"
                }
            ]
        },
        {
            "title": "Mutation of the KIT (mast/stem cell growth factor receptor) protooncogene in human piebaldism.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "1991",
            "authors": "Giebel LB, Spritz RA",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "1717985",
                    "url": "https://glygen.org/publication/PubMed/1717985"
                }
            ]
        },
        {
            "title": "Gastrointestinal stromal tumor (GIST) pathogenesis, familial GIST, and animal models.",
            "journal": "Seminars in diagnostic pathology",
            "date": "2006",
            "authors": "Antonescu CR",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669933",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669933"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17193819",
                    "url": "https://glygen.org/publication/PubMed/17193819"
                }
            ]
        },
        {
            "title": "KIT and PDGFRA mutations in gastrointestinal stromal tumors (GISTs).",
            "journal": "Seminars in diagnostic pathology",
            "date": "2006",
            "authors": "Lasota J, Miettinen M",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669935",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669935"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17193822",
                    "url": "https://glygen.org/publication/PubMed/17193822"
                }
            ]
        },
        {
            "title": "Inhibition of B56-containing protein phosphatase 2As by the early response gene IEX-1 leads to control of Akt activity.",
            "journal": "The Journal of biological chemistry",
            "date": "2007",
            "authors": "Rocher G, Letourneux C, Lenormand P, Porteu F",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-6811558",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811558"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17200115",
                    "url": "https://glygen.org/publication/PubMed/17200115"
                }
            ]
        },
        {
            "title": "Comparative analysis of signaling pathways between mast cell growth factor (c-kit ligand) and granulocyte-macrophage colony-stimulating factor in a human factor-dependent myeloid cell line involves phosphorylation of Raf-1, GTPase-activating protein and mitogen-activated protein kinase.",
            "journal": "Experimental hematology",
            "date": "1991",
            "authors": "Miyazawa K, Hendrie PC, Mantel C, Wood K, Ashman LK, Broxmeyer HE",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "1721591",
                    "url": "https://glygen.org/publication/PubMed/1721591"
                }
            ]
        },
        {
            "title": "Structural basis for stem cell factor-KIT signaling and activation of class III receptor tyrosine kinases.",
            "journal": "The EMBO journal",
            "date": "2007",
            "authors": "Liu H, Chen X, Focia PJ, He X",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17255936",
                    "url": "https://glygen.org/publication/PubMed/17255936"
                }
            ]
        },
        {
            "title": "Juxtamembrane-type c-kit gene mutation found in aggressive systemic mastocytosis induces imatinib-resistant constitutive KIT activation.",
            "journal": "Laboratory investigation; a journal of technical methods and pathology",
            "date": "2007",
            "authors": "Nakagomi N, Hirota S",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17259998",
                    "url": "https://glygen.org/publication/PubMed/17259998"
                }
            ]
        },
        {
            "title": "Different ADAMs have distinct influences on Kit ligand processing: phorbol-ester-stimulated ectodomain shedding of Kitl1 by ADAM17 is reduced by ADAM19.",
            "journal": "Journal of cell science",
            "date": "2007",
            "authors": "Kawaguchi N, Horiuchi K, Becherer JD, Toyama Y, Besmer P, Blobel CP",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17344430",
                    "url": "https://glygen.org/publication/PubMed/17344430"
                }
            ]
        },
        {
            "title": "Patterns of somatic mutation in human cancer genomes.",
            "journal": "Nature",
            "date": "2007",
            "authors": "Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17344846",
                    "url": "https://glygen.org/publication/PubMed/17344846"
                }
            ]
        },
        {
            "title": "Resistance to c-KIT kinase inhibitors conferred by V654A mutation.",
            "journal": "Molecular cancer therapeutics",
            "date": "2007",
            "authors": "Roberts KG, Odell AF, Byrnes EM, Baleato RM, Griffith R, Lyons AB, Ashman LK",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669917",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669917"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17363509",
                    "url": "https://glygen.org/publication/PubMed/17363509"
                }
            ]
        },
        {
            "title": "KIT oncoprotein interactions in gastrointestinal stromal tumors: therapeutic relevance.",
            "journal": "Oncogene",
            "date": "2007",
            "authors": "Zhu MJ, Ou WB, Fletcher CD, Cohen PS, Demetri GD, Fletcher JA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17452978",
                    "url": "https://glygen.org/publication/PubMed/17452978"
                }
            ]
        },
        {
            "title": "Characterization of tyrosine kinase I domain c-kit gene mutation Asn655Lys newly found in primary jejunal gastrointestinal stromal tumor.",
            "journal": "The American journal of gastroenterology",
            "date": "2007",
            "authors": "Kinoshita K, Hirota S, Isozaki K, Nishitani A, Tsutsui S, Watabe K, Tamura S, Ishikawa T, Kanda T, Nishida T, Hayashi N",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17489795",
                    "url": "https://glygen.org/publication/PubMed/17489795"
                }
            ]
        },
        {
            "title": "Sorafenib inhibits imatinib-resistant KIT and platelet-derived growth factor receptor beta gatekeeper mutants.",
            "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
            "date": "2007",
            "authors": "Guida T, Anaganti S, Provitera L, Gedrich R, Sullivan E, Wilhelm SM, Santoro M, Carlomagno F",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669936",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669936"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17545544",
                    "url": "https://glygen.org/publication/PubMed/17545544"
                }
            ]
        },
        {
            "title": "KIT oncogenic signaling mechanisms in imatinib-resistant gastrointestinal stromal tumor: PI3-kinase/AKT is a crucial survival pathway.",
            "journal": "Oncogene",
            "date": "2007",
            "authors": "Bauer S, Duensing A, Demetri GD, Fletcher JA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17546049",
                    "url": "https://glygen.org/publication/PubMed/17546049"
                }
            ]
        },
        {
            "title": "The tyrosine kinase FES is an essential effector of KITD816V proliferation signal.",
            "journal": "Blood",
            "date": "2007",
            "authors": "Voisset E, Lopez S, Dubreuil P, De Sepulveda P",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17595334",
                    "url": "https://glygen.org/publication/PubMed/17595334"
                }
            ]
        },
        {
            "title": "Mechanism of two classes of cancer mutations in the phosphoinositide 3-kinase catalytic subunit.",
            "journal": "Science (New York, N.Y.)",
            "date": "2007",
            "authors": "Miled N, Yan Y, Hon WC, Perisic O, Zvelebil M, Inbar Y, Schneidman-Duhovny D, Wolfson HJ, Backer JM, Williams RL",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17626883",
                    "url": "https://glygen.org/publication/PubMed/17626883"
                }
            ]
        },
        {
            "title": "Structural basis for activation of the receptor tyrosine kinase KIT by stem cell factor.",
            "journal": "Cell",
            "date": "2007",
            "authors": "Yuzawa S, Opatowsky Y, Zhang Z, Mandiyan V, Lax I, Schlessinger J",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721#ptm_processing"
                },
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17662946",
                    "url": "https://glygen.org/publication/PubMed/17662946"
                }
            ]
        },
        {
            "title": "Sorafenib inhibits the imatinib-resistant KITT670I gatekeeper mutation in gastrointestinal stromal tumor.",
            "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
            "date": "2007",
            "authors": "Guo T, Agaram NP, Wong GC, Hom G, D'Adamo D, Maki RG, Schwartz GK, Veach D, Clarkson BD, Singer S, DeMatteo RP, Besmer P, Antonescu CR",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669926",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669926"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17699867",
                    "url": "https://glygen.org/publication/PubMed/17699867"
                }
            ]
        },
        {
            "title": "Imatinib in the management of multiple gastrointestinal stromal tumors associated with a germline KIT K642E mutation.",
            "journal": "Archives of pathology & laboratory medicine",
            "date": "2007",
            "authors": "Graham J, Debiec-Rychter M, Corless CL, Reid R, Davidson R, White JD",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17824795",
                    "url": "https://glygen.org/publication/PubMed/17824795"
                }
            ]
        },
        {
            "title": "Immunophenotypic profile predictive of KIT activating mutations in AML1-ETO leukemia.",
            "journal": "American journal of clinical pathology",
            "date": "2007",
            "authors": "De J, Zanjani R, Hibbard M, Davis BH",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17875504",
                    "url": "https://glygen.org/publication/PubMed/17875504"
                }
            ]
        },
        {
            "title": "Grb2 mediates negative regulation of stem cell factor receptor/c-Kit signaling by recruitment of Cbl.",
            "journal": "Experimental cell research",
            "date": "2007",
            "authors": "Sun J, Pedersen M, Bengtsson S, Ronnstrand L",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433559",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433559"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17904548",
                    "url": "https://glygen.org/publication/PubMed/17904548"
                }
            ]
        },
        {
            "title": "ANCCA, an estrogen-regulated AAA+ ATPase coactivator for ERalpha, is required for coregulator occupancy and chromatin modification.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2007",
            "authors": "Zou JX, Revenko AS, Li LB, Gemo AT, Chen HW",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-8866910",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17998543",
                    "url": "https://glygen.org/publication/PubMed/17998543"
                }
            ]
        },
        {
            "title": "Oncogenic signaling of class I PI3K isoforms.",
            "journal": "Oncogene",
            "date": "2008",
            "authors": "Denley A, Kang S, Karst U, Vogt PK",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17998941",
                    "url": "https://glygen.org/publication/PubMed/17998941"
                }
            ]
        },
        {
            "title": "The structure of a human p110alpha/p85alpha complex elucidates the effects of oncogenic PI3Kalpha mutations.",
            "journal": "Science (New York, N.Y.)",
            "date": "2007",
            "authors": "Huang CH, Mandelker D, Schmidt-Kittler O, Samuels Y, Velculescu VE, Kinzler KW, Vogelstein B, Gabelli SB, Amzel LM",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18079394",
                    "url": "https://glygen.org/publication/PubMed/18079394"
                }
            ]
        },
        {
            "title": "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer.",
            "journal": "Cell",
            "date": "2007",
            "authors": "Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18083107",
                    "url": "https://glygen.org/publication/PubMed/18083107"
                }
            ]
        },
        {
            "title": "A mouse model of a human multiple GIST family with KIT-Asp820Tyr mutation generated by a knock-in strategy.",
            "journal": "The Journal of pathology",
            "date": "2008",
            "authors": "Nakai N, Ishikawa T, Nishitani A, Liu NN, Shincho M, Hao H, Isozaki K, Kanda T, Nishida T, Fujimoto J, Hirota S",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18098338",
                    "url": "https://glygen.org/publication/PubMed/18098338"
                }
            ]
        },
        {
            "title": "Systemic mastocytosis associated with chronic idiopathic myelofibrosis: a distinct subtype of systemic mastocytosis associated with a [corrected] clonal hematological non-mast [corrected] cell lineage disorder carrying the activating point mutations KITD816V and JAK2V617F.",
            "journal": "The Journal of molecular diagnostics : JMD",
            "date": "2008",
            "authors": "Sotlar K, Bache A, Stellmacher F, Bultmann B, Valent P, Horny HP",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18165278",
                    "url": "https://glygen.org/publication/PubMed/18165278"
                }
            ]
        },
        {
            "title": "Detailed conformational dynamics of juxtamembrane region and activation loop in c-Kit kinase activation process.",
            "journal": "Proteins",
            "date": "2008",
            "authors": "Zou J, Wang YD, Ma FX, Xiang ML, Shi B, Wei YQ, Yang SY",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18214972",
                    "url": "https://glygen.org/publication/PubMed/18214972"
                }
            ]
        },
        {
            "title": "Mutations in the catalytic subunit of class IA PI3K confer leukemogenic potential to hematopoietic cells.",
            "journal": "Oncogene",
            "date": "2008",
            "authors": "Horn S, Bergholz U, Jucker M, McCubrey JA, Trumper L, Stocking C, Basecke J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18317450",
                    "url": "https://glygen.org/publication/PubMed/18317450"
                }
            ]
        },
        {
            "title": "Regulation of hematopoietic stem cells by the steel factor/KIT signaling pathway.",
            "journal": "Clin. Cancer Res.",
            "date": "2008",
            "authors": "Kent David, Copley Michael, Benz Claudia, Dykstra Brad, Bowie Michelle, Eaves Connie",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18381929",
                    "url": "https://glygen.org/publication/PubMed/18381929"
                }
            ]
        },
        {
            "title": "Phosphoproteome analysis of the human Chang liver cells using SCX and a complementary mass spectrometric strategy.",
            "journal": "Proteomics",
            "date": "2008",
            "authors": "Sui S, Wang J, Yang B, Song L, Zhang J, Chen M, Liu J, Lu Z, Cai Y, Chen S, Bi W, Zhu Y, He F, Qian X",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721-1",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721-1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18491316",
                    "url": "https://glygen.org/publication/PubMed/18491316"
                }
            ]
        },
        {
            "title": "Dose-dependent, complete response to imatinib of a metastatic mucosal melanoma with a K642E KIT mutation.",
            "journal": "Pigment cell & melanoma research",
            "date": "2008",
            "authors": "Lutzky J, Bauer J, Bastian BC",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18510589",
                    "url": "https://glygen.org/publication/PubMed/18510589"
                }
            ]
        },
        {
            "title": "Adaptor protein Lnk associates with Tyr(568) in c-Kit.",
            "journal": "The Biochemical journal",
            "date": "2008",
            "authors": "Gueller S, Gery S, Nowak V, Liu L, Serve H, Koeffler HP",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433559",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433559"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18588518",
                    "url": "https://glygen.org/publication/PubMed/18588518"
                }
            ]
        },
        {
            "title": "Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis.",
            "journal": "Arthritis Res. Ther.",
            "date": "2008",
            "authors": "Jin P, Zhang J, Sumariwalla PF, Ni I, Jorgensen B, Crawford D, Phillips S, Feldmann M, Shepard HM, Paleolog EM",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18593464",
                    "url": "https://glygen.org/publication/PubMed/18593464"
                }
            ]
        },
        {
            "title": "Essential roles of PI(3)K-p110beta in cell growth, metabolism and tumorigenesis.",
            "journal": "Nature",
            "date": "2008",
            "authors": "Jia S, Liu Z, Zhang S, Liu P, Zhang L, Lee SH, Zhang J, Signoretti S, Loda M, Roberts TM, Zhao JJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18594509",
                    "url": "https://glygen.org/publication/PubMed/18594509"
                }
            ]
        },
        {
            "title": "Identification and characterization of NVP-BEZ235, a new orally available dual phosphatidylinositol 3-kinase/mammalian target of rapamycin inhibitor with potent in vivo antitumor activity.",
            "journal": "Molecular cancer therapeutics",
            "date": "2008",
            "authors": "Maira SM, Stauffer F, Brueggen J, Furet P, Schnell C, Fritsch C, Brachmann S, Chene P, De Pover A, Schoemaker K, Fabbro D, Gabriel D, Simonen M, Murphy L, Finan P, Sellers W, Garcia-Echeverria C",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18606717",
                    "url": "https://glygen.org/publication/PubMed/18606717"
                }
            ]
        },
        {
            "title": "Gab2 is involved in differential phosphoinositide 3-kinase signaling by two splice forms of c-Kit.",
            "journal": "The Journal of biological chemistry",
            "date": "2008",
            "authors": "Sun J, Pedersen M, Ronnstrand L",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18697750",
                    "url": "https://glygen.org/publication/PubMed/18697750"
                }
            ]
        },
        {
            "title": "Familial gastrointestinal stromal tumors caused by the novel KIT exon 17 germline mutation N822Y.",
            "journal": "The American journal of surgical pathology",
            "date": "2008",
            "authors": "Thalheimer A, Schlemmer M, Bueter M, Merkelbach-Bruse S, Schildhaus HU, Buettner R, Hartung E, Thiede A, Meyer D, Fein M, Maroske J, Wardelmann E",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18724244",
                    "url": "https://glygen.org/publication/PubMed/18724244"
                }
            ]
        },
        {
            "title": "The identification of 2-(1H-indazol-4-yl)-6-(4-methanesulfonyl-piperazin-1-ylmethyl)-4-morpholin-4-yl-t hieno[3,2-d]pyrimidine (GDC-0941) as a potent, selective, orally bioavailable inhibitor of class I PI3 kinase for the treatment of cancer .",
            "journal": "Journal of medicinal chemistry",
            "date": "2008",
            "authors": "Folkes AJ, Ahmadi K, Alderton WK, Alix S, Baker SJ, Box G, Chuckowree IS, Clarke PA, Depledge P, Eccles SA, Friedman LS, Hayes A, Hancox TC, Kugendradas A, Lensun L, Moore P, Olivero AG, Pang J, Patel S, Pergl-Wilson GH, Raynaud FI, Robson A, Saghir N, Salphati L, Sohal S, Ultsch MH, Valenti M, Wallweber HJ, Wan NC, Wiesmann C, Workman P, Zhyvoloup A, Zvelebil MJ, Shuttleworth SJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18754654",
                    "url": "https://glygen.org/publication/PubMed/18754654"
                }
            ]
        },
        {
            "title": "PTEN-deficient cancers depend on PIK3CB.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2008",
            "authors": "Wee S, Wiederschain D, Maira SM, Loo A, Miller C, deBeaumont R, Stegmeier F, Yao YM, Lengauer C",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18755892",
                    "url": "https://glygen.org/publication/PubMed/18755892"
                }
            ]
        },
        {
            "title": "Essential role of ERK dimers in the activation of cytoplasmic but not nuclear substrates by ERK-scaffold complexes.",
            "journal": "Molecular cell",
            "date": "2008",
            "authors": "Casar B, Pinto A, Crespo P",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18775330",
                    "url": "https://glygen.org/publication/PubMed/18775330"
                }
            ]
        },
        {
            "title": "NVP-BEZ235, a dual PI3K/mTOR inhibitor, prevents PI3K signaling and inhibits the growth of cancer cells with activating PI3K mutations.",
            "journal": "Cancer research",
            "date": "2008",
            "authors": "Serra V, Markman B, Scaltriti M, Eichhorn PJ, Valero V, Guzman M, Botero ML, Llonch E, Atzori F, Di Cosimo S, Maira M, Garcia-Echeverria C, Parra JL, Arribas J, Baselga J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18829560",
                    "url": "https://glygen.org/publication/PubMed/18829560"
                }
            ]
        },
        {
            "title": "mTOR complex 2 (mTORC2) controls hydrophobic motif phosphorylation and activation of serum- and glucocorticoid-induced protein kinase 1 (SGK1).",
            "journal": "The Biochemical journal",
            "date": "2008",
            "authors": "Garcia-Martinez JM, Alessi DR",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1257604",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18925875",
                    "url": "https://glygen.org/publication/PubMed/18925875"
                }
            ]
        },
        {
            "title": "Complete response of stage IV anal mucosal melanoma expressing KIT Val560Asp to the multikinase inhibitor sorafenib.",
            "journal": "Nature clinical practice. Oncology",
            "date": "2008",
            "authors": "Quintas-Cardama A, Lazar AJ, Woodman SE, Kim K, Ross M, Hwu P",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18936790",
                    "url": "https://glygen.org/publication/PubMed/18936790"
                }
            ]
        },
        {
            "title": "Chemotherapy and dasatinib induce long-term hematologic and molecular remission in systemic mastocytosis with acute myeloid leukemia with KIT D816V.",
            "journal": "Leukemia research",
            "date": "2009",
            "authors": "Ustun C, Corless CL, Savage N, Fiskus W, Manaloor E, Heinrich MC, Lewis G, Ramalingam P, Kepten I, Jillella A, Bhalla K",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "18986703",
                    "url": "https://glygen.org/publication/PubMed/18986703"
                }
            ]
        },
        {
            "title": "The GTPase superfamily: conserved structure and molecular mechanism.",
            "journal": "Nature",
            "date": "1991",
            "authors": "Bourne HR, Sanders DA, McCormick F",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "1898771",
                    "url": "https://glygen.org/publication/PubMed/1898771"
                }
            ]
        },
        {
            "title": "The c-Kit/D816V mutation eliminates the differences in signal transduction and biological responses between two isoforms of c-Kit.",
            "journal": "Cellular signalling",
            "date": "2009",
            "authors": "Pedersen M, Ronnstrand L, Sun J",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19049823",
                    "url": "https://glygen.org/publication/PubMed/19049823"
                }
            ]
        },
        {
            "title": "Targeting cancer with small molecule kinase inhibitors.",
            "journal": "Nature reviews. Cancer",
            "date": "2009",
            "authors": "Zhang J, Yang PL, Gray NS",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669921",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669921"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19104514",
                    "url": "https://glygen.org/publication/PubMed/19104514"
                }
            ]
        },
        {
            "title": "KIT kinase mutants show unique mechanisms of drug resistance to imatinib and sunitinib in gastrointestinal stromal tumor patients.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2009",
            "authors": "Gajiwala KS, Wu JC, Christensen J, Deshmukh GD, Diehl W, DiNitto JP, English JM, Greig MJ, He YA, Jacques SL, Lunney EA, McTigue M, Molina D, Quenzer T, Wells PA, Yu X, Zhang Y, Zou A, Emmett MR, Marshall AG, Zhang HM, Demetri GD",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669917",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669917"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19164557",
                    "url": "https://glygen.org/publication/PubMed/19164557"
                }
            ]
        },
        {
            "title": "PI 3-kinase and cancer: changing accents.",
            "journal": "Current opinion in genetics & development",
            "date": "2009",
            "authors": "Vogt PK, Gymnopoulos M, Hart JR",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19185485",
                    "url": "https://glygen.org/publication/PubMed/19185485"
                }
            ]
        },
        {
            "title": "The D816V mutation of c-Kit circumvents a requirement for Src family kinases in c-Kit signal transduction.",
            "journal": "The Journal of biological chemistry",
            "date": "2009",
            "authors": "Sun J, Pedersen M, Ronnstrand L",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19265199",
                    "url": "https://glygen.org/publication/PubMed/19265199"
                }
            ]
        },
        {
            "title": "ERK dimers and scaffold proteins: unexpected partners for a forgotten (cytoplasmic) task.",
            "journal": "Cell cycle (Georgetown, Tex.)",
            "date": "2009",
            "authors": "Casar B, Pinto A, Crespo P",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19279408",
                    "url": "https://glygen.org/publication/PubMed/19279408"
                }
            ]
        },
        {
            "title": "Androgen-induced coactivator ANCCA mediates specific androgen receptor signaling in prostate cancer.",
            "journal": "Cancer research",
            "date": "2009",
            "authors": "Zou JX, Guo L, Revenko AS, Tepper CG, Gemo AT, Kung HJ, Chen HW",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-8866910",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19318566",
                    "url": "https://glygen.org/publication/PubMed/19318566"
                }
            ]
        },
        {
            "title": "Large-scale proteomics analysis of the human kinome.",
            "journal": "Molecular & cellular proteomics : MCP",
            "date": "2009",
            "authors": "Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19369195",
                    "url": "https://glygen.org/publication/PubMed/19369195"
                }
            ]
        },
        {
            "title": "Sunitinib-resistant gastrointestinal stromal tumors harbor cis-mutations in the activation loop of the KIT gene.",
            "journal": "International journal of clinical oncology",
            "date": "2009",
            "authors": "Nishida T, Takahashi T, Nishitani A, Doi T, Shirao K, Komatsu Y, Nakajima K, Hirota S",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669934",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669934"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19390946",
                    "url": "https://glygen.org/publication/PubMed/19390946"
                }
            ]
        },
        {
            "title": "Ligand-independent HER2/HER3/PI3K complex is disrupted by trastuzumab and is effectively inhibited by the PI3K inhibitor GDC-0941.",
            "journal": "Cancer cell",
            "date": "2009",
            "authors": "Junttila TT, Akita RW, Parsons K, Fields C, Lewis Phillips GD, Friedman LS, Sampath D, Sliwkowski MX",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19411071",
                    "url": "https://glygen.org/publication/PubMed/19411071"
                }
            ]
        },
        {
            "title": "PtdIns5P protects Akt from dephosphorylation through PP2A inhibition.",
            "journal": "Biochemical and biophysical research communications",
            "date": "2009",
            "authors": "Ramel D, Lagarrigue F, Dupuis-Coronas S, Chicanne G, Leslie N, Gaits-Iacovoni F, Payrastre B, Tronchere H",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-6811558",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811558"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19576174",
                    "url": "https://glygen.org/publication/PubMed/19576174"
                }
            ]
        },
        {
            "title": "Identification of c-kit gene mutations in primary adenoid cystic carcinoma of the salivary gland.",
            "journal": "Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc",
            "date": "2009",
            "authors": "Vila L, Liu H, Al-Quran SZ, Coco DP, Dong HJ, Liu C",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19617878",
                    "url": "https://glygen.org/publication/PubMed/19617878"
                }
            ]
        },
        {
            "title": "In vivo effect of imatinib on progression of cecal GIST-like tumors in exon 17-type c-kit knock-in mice.",
            "journal": "Laboratory investigation; a journal of technical methods and pathology",
            "date": "2009",
            "authors": "Ishikawa T, Nakai N, Liu NN, Shiba K, Isozaki K, Matsuda I, Ito T, Fujimoto J, Hatakeyama K, Kanda T, Hirota S",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19636292",
                    "url": "https://glygen.org/publication/PubMed/19636292"
                }
            ]
        },
        {
            "title": "Targeting the phosphoinositide 3-kinase pathway in cancer.",
            "journal": "Nature reviews. Drug discovery",
            "date": "2009",
            "authors": "Liu P, Cheng H, Roberts TM, Zhao JJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19644473",
                    "url": "https://glygen.org/publication/PubMed/19644473"
                }
            ]
        },
        {
            "title": "Activity of dasatinib against L576P KIT mutant melanoma: molecular, cellular, and clinical correlates.",
            "journal": "Molecular cancer therapeutics",
            "date": "2009",
            "authors": "Woodman SE, Trent JC, Stemke-Hale K, Lazar AJ, Pricl S, Pavan GM, Fermeglia M, Gopal YN, Yang D, Podoloff DA, Ivan D, Kim KB, Papadopoulos N, Hwu P, Mills GB, Davies MA",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19671763",
                    "url": "https://glygen.org/publication/PubMed/19671763"
                }
            ]
        },
        {
            "title": "[Tyrosine kinase mutation and acute myeloid leukemia with T (8; 21)].",
            "journal": "Zhongguo shi yan xue ye xue za zhi",
            "date": "2009",
            "authors": "Han YL, Zhang SJ, Qiao C, Dai D, Sun XM, Xu YL, Qian SX, Xu W, Wang JS, Li JY",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19698218",
                    "url": "https://glygen.org/publication/PubMed/19698218"
                }
            ]
        },
        {
            "title": "Correlation between KIT expression and KIT mutation in melanoma: a study of 173 cases with emphasis on the acral-lentiginous/mucosal type.",
            "journal": "Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc",
            "date": "2009",
            "authors": "Torres-Cabala CA, Wang WL, Trent J, Yang D, Chen S, Galbincea J, Kim KB, Woodman S, Davies M, Plaza JA, Nash JW, Prieto VG, Lazar AJ, Ivan D",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19718013",
                    "url": "https://glygen.org/publication/PubMed/19718013"
                }
            ]
        },
        {
            "title": "Activate and resist: L576P-KIT in GIST.",
            "journal": "Molecular cancer therapeutics",
            "date": "2009",
            "authors": "Conca E, Negri T, Gronchi A, Fumagalli E, Tamborini E, Pavan GM, Fermeglia M, Pierotti MA, Pricl S, Pilotti S",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19723893",
                    "url": "https://glygen.org/publication/PubMed/19723893"
                }
            ]
        },
        {
            "title": "KIT(D816V+) systemic mastocytosis associated with KIT(D816V+) acute erythroid leukaemia: first case report with molecular evidence for same progenitor cell derivation.",
            "journal": "Journal of clinical pathology",
            "date": "2009",
            "authors": "McClintock-Treep SA, Horny HP, Sotlar K, Foucar MK, Reichard KK",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19729359",
                    "url": "https://glygen.org/publication/PubMed/19729359"
                }
            ]
        },
        {
            "title": "c-Kit mutants require hypoxia-inducible factor 1alpha to transform melanocytes.",
            "journal": "Oncogene",
            "date": "2010",
            "authors": "Monsel G, Ortonne N, Bagot M, Bensussan A, Dumaz N",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19802003",
                    "url": "https://glygen.org/publication/PubMed/19802003"
                }
            ]
        },
        {
            "title": "A frequent kinase domain mutation that changes the interaction between PI3Kalpha and the membrane.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2009",
            "authors": "Mandelker D, Gabelli SB, Schmidt-Kittler O, Zhu J, Cheong I, Huang CH, Kinzler KW, Vogelstein B, Amzel LM",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1257604",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19805105",
                    "url": "https://glygen.org/publication/PubMed/19805105"
                }
            ]
        },
        {
            "title": "ATAD2 is a novel cofactor for MYC, overexpressed and amplified in aggressive tumors.",
            "journal": "Cancer research",
            "date": "2009",
            "authors": "Ciro M, Prosperini E, Quarto M, Grazini U, Walfridsson J, McBlane F, Nucifero P, Pacchiana G, Capra M, Christensen J, Helin K",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-8866910",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19843847",
                    "url": "https://glygen.org/publication/PubMed/19843847"
                }
            ]
        },
        {
            "title": "Pediatric mastocytosis is a clonal disease associated with D816V and other activating c-KIT mutations.",
            "journal": "The Journal of investigative dermatology",
            "date": "2010",
            "authors": "Bodemer C, Hermine O, Palmerini F, Yang Y, Grandpeix-Guyodo C, Leventhal PS, Hadj-Rabia S, Nasca L, Georgin-Lavialle S, Cohen-Akenine A, Launay JM, Barete S, Feger F, Arock M, Catteau B, Sans B, Stalder JF, Skowron F, Thomas L, Lorette G, Plantin P, Bordigoni P, Lortholary O, de Prost Y, Moussy A, Sobol H, Dubreuil P",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-9680187",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680187"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19865100",
                    "url": "https://glygen.org/publication/PubMed/19865100"
                }
            ]
        },
        {
            "title": "ERK nuclear translocation is dimerization-independent but controlled by the rate of phosphorylation.",
            "journal": "The Journal of biological chemistry",
            "date": "2010",
            "authors": "Lidke DS, Huang F, Post JN, Rieger B, Wilsbacher J, Thomas JL, Pouyssegur J, Jovin TM, Lenormand P",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19920141",
                    "url": "https://glygen.org/publication/PubMed/19920141"
                }
            ]
        },
        {
            "title": "Somatic mutations in p85alpha promote tumorigenesis through class IA PI3K activation.",
            "journal": "Cancer cell",
            "date": "2009",
            "authors": "Jaiswal BS, Janakiraman V, Kljavin NM, Chaudhuri S, Stern HM, Wang W, Kan Z, Dbouk HA, Peters BA, Waring P, Dela Vega T, Kenski DM, Bowman KK, Lorenzo M, Li H, Wu J, Modrusan Z, Stinson J, Eby M, Yue P, Kaminker JS, de Sauvage FJ, Backer JM, Seshagiri S",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19962665",
                    "url": "https://glygen.org/publication/PubMed/19962665"
                }
            ]
        },
        {
            "title": "Function of activation loop tyrosine phosphorylation in the mechanism of c-Kit auto-activation and its implication in sunitinib resistance.",
            "journal": "Journal of biochemistry",
            "date": "2010",
            "authors": "DiNitto JP, Deshmukh GD, Zhang Y, Jacques SL, Coli R, Worrall JW, Diehl W, English JM, Wu JC",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20147452",
                    "url": "https://glygen.org/publication/PubMed/20147452"
                }
            ]
        },
        {
            "title": "Phosphoinositide 3-kinase pathway activation in phosphate and tensin homolog (PTEN)-deficient prostate cancer cells is independent of receptor tyrosine kinases and mediated by the p110beta and p110delta catalytic subunits.",
            "journal": "The Journal of biological chemistry",
            "date": "2010",
            "authors": "Jiang X, Chen S, Asara JM, Balk SP",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20231295",
                    "url": "https://glygen.org/publication/PubMed/20231295"
                }
            ]
        },
        {
            "title": "Tyrosines 868, 966, and 972 in the kinase domain of JAK2 are autophosphorylated and required for maximal JAK2 kinase activity.",
            "journal": "Molecular endocrinology (Baltimore, Md.)",
            "date": "2010",
            "authors": "Argetsinger LS, Stuckey JA, Robertson SA, Koleva RI, Cline JM, Marto JA, Myers MG Jr, Carter-Su C",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20304997",
                    "url": "https://glygen.org/publication/PubMed/20304997"
                }
            ]
        },
        {
            "title": "mTOR complex-2 activates ENaC by phosphorylating SGK1.",
            "journal": "Journal of the American Society of Nephrology : JASN",
            "date": "2010",
            "authors": "Lu M, Wang J, Jones KT, Ives HE, Feldman ME, Yao LJ, Shokat KM, Ashrafi K, Pearce D",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1257604",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20338997",
                    "url": "https://glygen.org/publication/PubMed/20338997"
                }
            ]
        },
        {
            "title": "High frequency of concomitant mastocytosis in patients with acute myeloid leukemia exhibiting the transforming KIT mutation D816V.",
            "journal": "Molecular oncology",
            "date": "2010",
            "authors": "Fritsche-Polanz R, Fritz M, Huber A, Sotlar K, Sperr WR, Mannhalter C, Fodinger M, Valent P",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20471335",
                    "url": "https://glygen.org/publication/PubMed/20471335"
                }
            ]
        },
        {
            "title": "RalGDS family members couple Ras to Ral signalling and that's not all.",
            "journal": "Cellular signalling",
            "date": "2010",
            "authors": "Ferro E, Trabalzini L",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20478380",
                    "url": "https://glygen.org/publication/PubMed/20478380"
                }
            ]
        },
        {
            "title": "Phosphatidylinositol 3-kinase-delta inhibitor CAL-101 shows promising preclinical activity in chronic lymphocytic leukemia by antagonizing intrinsic and extrinsic cellular survival signals.",
            "journal": "Blood",
            "date": "2010",
            "authors": "Herman SE, Gordon AL, Wagner AJ, Heerema NA, Zhao W, Flynn JM, Jones J, Andritsos L, Puri KD, Lannutti BJ, Giese NA, Zhang X, Wei L, Byrd JC, Johnson AJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20522708",
                    "url": "https://glygen.org/publication/PubMed/20522708"
                }
            ]
        },
        {
            "title": "Functional characterization of ATAD2 as a new cancer/testis factor and a predictor of poor prognosis in breast and lung cancers.",
            "journal": "Oncogene",
            "date": "2010",
            "authors": "Caron C, Lestrat C, Marsal S, Escoffier E, Curtet S, Virolle V, Barbry P, Debernardi A, Brambilla C, Brambilla E, Rousseaux S, Khochbin S",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-8866910",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20581866",
                    "url": "https://glygen.org/publication/PubMed/20581866"
                }
            ]
        },
        {
            "title": "Expression of a truncated form of KIT tyrosine kinase in human spermatozoa correlates with sperm DNA integrity.",
            "journal": "Hum. Reprod.",
            "date": "2010",
            "authors": "Muciaccia Barbara, Sette Claudio, Paronetto Maria Paola, Barchi Marco, Pensini Simona, D'Agostino Angela, Gandini Loredana, Geremia Raffaele, Stefanini Mario, Rossi Pellegrino",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20601678",
                    "url": "https://glygen.org/publication/PubMed/20601678"
                }
            ]
        },
        {
            "title": "Retinoic acid enhances sensitivity of neuroblastoma cells for imatinib mesylate.",
            "journal": "Pediatr. Blood Cancer",
            "date": "2010",
            "authors": "Neumann Ingo, Foell J\u00fcrgen L, Bremer Marianne, Volkmer Ines, Korholz Dieter, Burdach Stefan, Staege Martin S",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20658618",
                    "url": "https://glygen.org/publication/PubMed/20658618"
                }
            ]
        },
        {
            "title": "KIT polymorphisms and mutations determine responses of neoplastic mast cells to bafetinib (INNO-406).",
            "journal": "Experimental hematology",
            "date": "2010",
            "authors": "Peter B, Hadzijusufovic E, Blatt K, Gleixner KV, Pickl WF, Thaiwong T, Yuzbasiyan-Gurkan V, Willmann M, Valent P",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20685234",
                    "url": "https://glygen.org/publication/PubMed/20685234"
                }
            ]
        },
        {
            "title": "Cancer-derived mutations in the regulatory subunit p85alpha of phosphoinositide 3-kinase function through the catalytic subunit p110alpha.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2010",
            "authors": "Sun M, Hillmann P, Hofmann BT, Hart JR, Vogt PK",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20713702",
                    "url": "https://glygen.org/publication/PubMed/20713702"
                }
            ]
        },
        {
            "title": "ETV1 is a lineage survival factor that cooperates with KIT in gastrointestinal stromal tumours.",
            "journal": "Nature",
            "date": "2010",
            "authors": "Chi P, Chen Y, Zhang L, Guo X, Wongvipat J, Shamu T, Fletcher JA, Dewell S, Maki RG, Zheng D, Antonescu CR, Allis CD, Sawyers CL",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20927104",
                    "url": "https://glygen.org/publication/PubMed/20927104"
                }
            ]
        },
        {
            "title": "Structural basis for c-KIT inhibition by the suppressor of cytokine signaling 6 (SOCS6) ubiquitin ligase.",
            "journal": "The Journal of biological chemistry",
            "date": "2011",
            "authors": "Zadjali F, Pike AC, Vesterlund M, Sun J, Wu C, Li SS, Ronnstrand L, Knapp S, Bullock AN, Flores-Morales A",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21030588",
                    "url": "https://glygen.org/publication/PubMed/21030588"
                }
            ]
        },
        {
            "title": "Tumor-intrinsic and -extrinsic roles of c-Kit: mast cells as the primary off-target of tyrosine kinase inhibitors.",
            "journal": "Oncogene",
            "date": "2011",
            "authors": "Pittoni P, Piconese S, Tripodo C, Colombo M P",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21057534",
                    "url": "https://glygen.org/publication/PubMed/21057534"
                }
            ]
        },
        {
            "title": "Ras superfamily GEFs and GAPs: validated and tractable targets for cancer therapy?",
            "journal": "Nature reviews. Cancer",
            "date": "2010",
            "authors": "Vigil D, Cherfils J, Rossman KL, Der CJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21102635",
                    "url": "https://glygen.org/publication/PubMed/21102635"
                }
            ]
        },
        {
            "title": "Mechanisms of STAT protein activation by oncogenic KIT mutants in neoplastic mast cells.",
            "journal": "The Journal of biological chemistry",
            "date": "2011",
            "authors": "Chaix A, Lopez S, Voisset E, Gros L, Dubreuil P, De Sepulveda P",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21135090",
                    "url": "https://glygen.org/publication/PubMed/21135090"
                }
            ]
        },
        {
            "title": "V559A and N822I double KIT mutant melanoma with predictable response to imatinib?",
            "journal": "Pigment cell & melanoma research",
            "date": "2011",
            "authors": "McDonnell K, Betz B, Fullen D, Lao CD",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21159146",
                    "url": "https://glygen.org/publication/PubMed/21159146"
                }
            ]
        },
        {
            "title": "PTEN restoration and PIK3CB knockdown synergistically suppress glioblastoma growth in vitro and in xenografts.",
            "journal": "Journal of neuro-oncology",
            "date": "2011",
            "authors": "Chen H, Mei L, Zhou L, Shen X, Guo C, Zheng Y, Zhu H, Zhu Y, Huang L",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21188471",
                    "url": "https://glygen.org/publication/PubMed/21188471"
                }
            ]
        },
        {
            "title": "C-KIT mutation cooperates with full-length AML1-ETO to induce acute myeloid leukemia in mice.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2011",
            "authors": "Wang YY, Zhao LJ, Wu CF, Liu P, Shi L, Liang Y, Xiong SM, Mi JQ, Chen Z, Ren R, Chen SJ",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21262832",
                    "url": "https://glygen.org/publication/PubMed/21262832"
                }
            ]
        },
        {
            "title": "Inhibition of PI3K/mTOR pathways in glioblastoma and implications for combination therapy with temozolomide.",
            "journal": "Neuro-oncology",
            "date": "2011",
            "authors": "Prasad G, Sottero T, Yang X, Mueller S, James CD, Weiss WA, Polley MY, Ozawa T, Berger MS, Aftab DT, Prados MD, Haas-Kogan DA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21317208",
                    "url": "https://glygen.org/publication/PubMed/21317208"
                }
            ]
        },
        {
            "title": "Feedback upregulation of HER3 (ErbB3) expression and activity attenuates antitumor effect of PI3K inhibitors.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2012",
            "authors": "Chakrabarty A, Sanchez V, Kuba MG, Rinehart C, Arteaga CL",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21368164",
                    "url": "https://glygen.org/publication/PubMed/21368164"
                }
            ]
        },
        {
            "title": "Activation and function of the MAPKs and their substrates, the MAPK-activated protein kinases.",
            "journal": "Microbiology and molecular biology reviews : MMBR",
            "date": "2011",
            "authors": "Cargnello M, Roux PP",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21372320",
                    "url": "https://glygen.org/publication/PubMed/21372320"
                }
            ]
        },
        {
            "title": "PIK3R1 (p85alpha) is somatically mutated at high frequency in primary endometrial cancer.",
            "journal": "Cancer research",
            "date": "2011",
            "authors": "Urick ME, Rudd ML, Godwin AK, Sgroi D, Merino M, Bell DW",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21478295",
                    "url": "https://glygen.org/publication/PubMed/21478295"
                }
            ]
        },
        {
            "title": "Identification of the M541L sequence variation of the transmembrane KIT domain in Merkel cell carcinoma.",
            "journal": "Anticancer research",
            "date": "2011",
            "authors": "Krasagakis K, Metaxari M, Zervou M, Stathopoulos EN, Eberle J, Kanitakis J, Georgoulias V, Kruger-Krasagakis S, Tavernarakis N, Tosca AD",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21498700",
                    "url": "https://glygen.org/publication/PubMed/21498700"
                }
            ]
        },
        {
            "title": "Identification of novel target genes of nerve growth factor (NGF) in human mastocytoma cell line (HMC-1 (V560G c-Kit)) by transcriptome analysis.",
            "journal": "BMC genomics",
            "date": "2011",
            "authors": "Dutta P, Koch A, Breyer B, Schneider H, Dittrich-Breiholz O, Kracht M, Tamura T",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21501463",
                    "url": "https://glygen.org/publication/PubMed/21501463"
                }
            ]
        },
        {
            "title": "KIT amplification and gene mutations in acral/mucosal melanoma in Korea.",
            "journal": "APMIS : acta pathologica, microbiologica, et immunologica Scandinavica",
            "date": "2011",
            "authors": "Yun J, Lee J, Jang J, Lee EJ, Jang KT, Kim JH, Kim KM",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21569090",
                    "url": "https://glygen.org/publication/PubMed/21569090"
                }
            ]
        },
        {
            "title": "Mechanism of activation of human c-KIT kinase by internal tandem duplications of the juxtamembrane domain and point mutations at aspartic acid 816.",
            "journal": "Biochemical and biophysical research communications",
            "date": "2011",
            "authors": "Kim SY, Kang JJ, Lee HH, Kang JJ, Kim B, Kim CG, Park TK, Kang H",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21640708",
                    "url": "https://glygen.org/publication/PubMed/21640708"
                }
            ]
        },
        {
            "title": "A drug targeting only p110alpha can block phosphoinositide 3-kinase signalling and tumour growth in certain cell types.",
            "journal": "The Biochemical journal",
            "date": "2011",
            "authors": "Jamieson S, Flanagan JU, Kolekar S, Buchanan C, Kendall JD, Lee WJ, Rewcastle GW, Denny WA, Singh R, Dickson J, Baguley BC, Shepherd PR",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21668414",
                    "url": "https://glygen.org/publication/PubMed/21668414"
                }
            ]
        },
        {
            "title": "Novel, activating KIT-N822I mutation in familial cutaneous mastocytosis.",
            "journal": "Experimental hematology",
            "date": "2011",
            "authors": "Wasag B, Niedoszytko M, Piskorz A, Lange M, Renke J, Jassem E, Biernat W, Debiec-Rychter M, Limon J",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21689725",
                    "url": "https://glygen.org/publication/PubMed/21689725"
                }
            ]
        },
        {
            "title": "RAS Interaction with PI3K: More Than Just Another Effector Pathway.",
            "journal": "Genes & cancer",
            "date": "2011",
            "authors": "Castellano E, Downward J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21779497",
                    "url": "https://glygen.org/publication/PubMed/21779497"
                }
            ]
        },
        {
            "title": "Therapeutic strategies for targeting ras proteins.",
            "journal": "Genes & cancer",
            "date": "2011",
            "authors": "Gysin S, Salt M, Young A, McCormick F",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21779505",
                    "url": "https://glygen.org/publication/PubMed/21779505"
                }
            ]
        },
        {
            "title": "Dynamics of the phosphoinositide 3-kinase p110delta interaction with p85alpha and membranes reveals aspects of regulation distinct from p110alpha.",
            "journal": "Structure (London, England : 1993)",
            "date": "2011",
            "authors": "Burke JE, Vadas O, Berndt A, Finegan T, Perisic O, Williams RL",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1257604",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21827948",
                    "url": "https://glygen.org/publication/PubMed/21827948"
                }
            ]
        },
        {
            "title": "C-KIT signaling depends on microphthalmia-associated transcription factor for effects on cell proliferation.",
            "journal": "PloS one",
            "date": "2011",
            "authors": "Phung B, Sun J, Schepsky A, Steingrimsson E, Ronnstrand L",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21887372",
                    "url": "https://glygen.org/publication/PubMed/21887372"
                }
            ]
        },
        {
            "title": "Novel phosphoinositide 3-kinase/mTOR dual inhibitor, NVP-BGT226, displays potent growth-inhibitory activity against human head and neck cancer cells in vitro and in vivo.",
            "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
            "date": "2011",
            "authors": "Chang KY, Tsai SY, Wu CM, Yen CJ, Chuang BF, Chang JY",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21976531",
                    "url": "https://glygen.org/publication/PubMed/21976531"
                }
            ]
        },
        {
            "title": "High frequency of PIK3R1 and PIK3R2 mutations in endometrial cancer elucidates a novel mechanism for regulation of PTEN protein stability.",
            "journal": "Cancer discovery",
            "date": "2011",
            "authors": "Cheung LW, Hennessy BT, Li J, Yu S, Myers AP, Djordjevic B, Lu Y, Stemke-Hale K, Dyer MD, Zhang F, Ju Z, Cantley LC, Scherer SE, Liang H, Lu KH, Broaddus RR, Mills GB",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21984976",
                    "url": "https://glygen.org/publication/PubMed/21984976"
                }
            ]
        },
        {
            "title": "RAS oncogenes: weaving a tumorigenic web.",
            "journal": "Nature reviews. Cancer",
            "date": "2011",
            "authors": "Pylayeva-Gupta Y, Grabocka E, Bar-Sagi D",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21993244",
                    "url": "https://glygen.org/publication/PubMed/21993244"
                }
            ]
        },
        {
            "title": "Gastrointestinal stromal tumours: origin and molecular oncology.",
            "journal": "Nature reviews. Cancer",
            "date": "2011",
            "authors": "Corless CL, Barnett CM, Heinrich MC",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22089421",
                    "url": "https://glygen.org/publication/PubMed/22089421"
                }
            ]
        },
        {
            "title": "Regulation of lipid binding underlies the activation mechanism of class IA PI3-kinases.",
            "journal": "Oncogene",
            "date": "2012",
            "authors": "Hon WC, Berndt A, Williams RL",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22120714",
                    "url": "https://glygen.org/publication/PubMed/22120714"
                }
            ]
        },
        {
            "title": "Systemic mastocytosis is uncommon in KIT D816V mutation positive core-binding factor acute myeloid leukemia.",
            "journal": "Leukemia & lymphoma",
            "date": "2012",
            "authors": "Kristensen T, Preiss B, Broesby-Olsen S, Vestergaard H, Friis L, Moller MB",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22145956",
                    "url": "https://glygen.org/publication/PubMed/22145956"
                }
            ]
        },
        {
            "title": "Mast-cell leukemia exome sequencing reveals a mutation in the IgE mast-cell receptor beta chain and KIT V654A.",
            "journal": "Leukemia",
            "date": "2012",
            "authors": "Spector MS, Iossifov I, Kritharis A, He C, Kolitz JE, Lowe SW, Allen SL",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22173243",
                    "url": "https://glygen.org/publication/PubMed/22173243"
                }
            ]
        },
        {
            "title": "Identification and characterization of NVP-BKM120, an orally available pan-class I PI3-kinase inhibitor.",
            "journal": "Molecular cancer therapeutics",
            "date": "2012",
            "authors": "Maira SM, Pecchi S, Huang A, Burger M, Knapp M, Sterker D, Schnell C, Guthy D, Nagel T, Wiesmann M, Brachmann S, Fritsch C, Dorsch M, Chene P, Shoemaker K, De Pover A, Menezes D, Martiny-Baron G, Fabbro D, Wilson CJ, Schlegel R, Hofmann F, Garcia-Echeverria C, Sellers WR, Voliva CF",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22188813",
                    "url": "https://glygen.org/publication/PubMed/22188813"
                }
            ]
        },
        {
            "title": "Mast cells and eosinophils in mastocytosis, chronic eosinophilic leukemia, and non-clonal disorders.",
            "journal": "Seminars in hematology",
            "date": "2012",
            "authors": "Gotlib J, Akin C",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22449623",
                    "url": "https://glygen.org/publication/PubMed/22449623"
                }
            ]
        },
        {
            "title": "ERK1/2 MAP kinases: structure, function, and regulation.",
            "journal": "Pharmacological research",
            "date": "2012",
            "authors": "Roskoski R Jr",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22569528",
                    "url": "https://glygen.org/publication/PubMed/22569528"
                }
            ]
        },
        {
            "title": "Functional characterization of an isoform-selective inhibitor of PI3K-p110beta as a potential anticancer agent.",
            "journal": "Cancer discovery",
            "date": "2012",
            "authors": "Ni J, Liu Q, Xie S, Carlson C, Von T, Vogel K, Riddle S, Benes C, Eck M, Roberts T, Gray N, Zhao J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22588880",
                    "url": "https://glygen.org/publication/PubMed/22588880"
                }
            ]
        },
        {
            "title": "A comprehensive survey of Ras mutations in cancer.",
            "journal": "Cancer research",
            "date": "2012",
            "authors": "Prior IA, Lewis PD, Mattos C",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22589270",
                    "url": "https://glygen.org/publication/PubMed/22589270"
                }
            ]
        },
        {
            "title": "[Familial gastrointestinal stroma tumor due to mutation in exon 13 (K642E) of the KIT gene].",
            "journal": "Medicina clinica",
            "date": "2012",
            "authors": "Pena-Irun A, Villa-Puente M, Garcia-Espinosa R, Cavadas-Lopez A",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22626674",
                    "url": "https://glygen.org/publication/PubMed/22626674"
                }
            ]
        },
        {
            "title": "Sorafenib inhibits many kinase mutations associated with drug-resistant gastrointestinal stromal tumors.",
            "journal": "Molecular cancer therapeutics",
            "date": "2012",
            "authors": "Heinrich MC, Marino-Enriquez A, Presnell A, Donsky RS, Griffith DJ, McKinley A, Patterson J, Taguchi T, Liang CW, Fletcher JA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669936",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669936"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22665524",
                    "url": "https://glygen.org/publication/PubMed/22665524"
                }
            ]
        },
        {
            "title": "Probing the GTPase cycle with real-time NMR: GAP and GEF activities in cell extracts.",
            "journal": "Methods (San Diego, Calif.)",
            "date": "2012",
            "authors": "Marshall CB, Meiri D, Smith MJ, Mazhab-Jafari MT, Gasmi-Seabrook GM, Rottapel R, Stambolic V, Ikura M",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22750304",
                    "url": "https://glygen.org/publication/PubMed/22750304"
                }
            ]
        },
        {
            "title": "The p110alpha and p110beta isoforms of PI3K play divergent roles in mammary gland development and tumorigenesis.",
            "journal": "Genes & development",
            "date": "2012",
            "authors": "Utermark T, Rao T, Cheng H, Wang Q, Lee SH, Wang ZC, Iglehart JD, Roberts TM, Muller WJ, Zhao JJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22802530",
                    "url": "https://glygen.org/publication/PubMed/22802530"
                }
            ]
        },
        {
            "title": "Evaluation of chemically modified carrier proteins for developing monoclonal antibodies against a clinically relevant mutation of cKIT.",
            "journal": "Journal of immunological methods",
            "date": "2012",
            "authors": "Jara-Acevedo R, Gonzalez-Gonzalez M, Jara-Acevedo M, Claros J, Conde A, Lopez-Perez R, Orfao A, Fuentes M",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22835433",
                    "url": "https://glygen.org/publication/PubMed/22835433"
                }
            ]
        },
        {
            "title": "Systemic mastocytosis associated with t(8;21) acute myeloid leukemia in a child: detection of the D816A mutation of KIT.",
            "journal": "Pediatric blood & cancer",
            "date": "2012",
            "authors": "Yabe M, Masukawa A, Kato S, Yabe H, Nakamura N, Matsushita H",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22847983",
                    "url": "https://glygen.org/publication/PubMed/22847983"
                }
            ]
        },
        {
            "title": "[Secondary mutation of c-kit/PDGFRalpha genotypes after imatinib mesylate therapy and its relationship with efficacy of sunitinib].",
            "journal": "Zhonghua bing li xue za zhi = Chinese journal of pathology",
            "date": "2012",
            "authors": "Hong JL, Li J, Li J, Shen L",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22932406",
                    "url": "https://glygen.org/publication/PubMed/22932406"
                }
            ]
        },
        {
            "title": "Prevalence of c-KIT mutations in gonadoblastoma and dysgerminomas of patients with disorders of sex development (DSD) and ovarian dysgerminomas.",
            "journal": "PloS one",
            "date": "2012",
            "authors": "Hersmus R, Stoop H, van de Geijn GJ, Eini R, Biermann K, Oosterhuis JW, Dhooge C, Schneider DT, Meijssen IC, Dinjens WN, Dubbink HJ, Drop SL, Looijenga LH",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22937135",
                    "url": "https://glygen.org/publication/PubMed/22937135"
                }
            ]
        },
        {
            "title": "Stem cell factor receptor/c-Kit: from basic science to clinical implications.",
            "journal": "Physiological reviews",
            "date": "2012",
            "authors": "Lennartsson J, Ronnstrand L",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23073628",
                    "url": "https://glygen.org/publication/PubMed/23073628"
                }
            ]
        },
        {
            "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.",
            "journal": "Molecular & cellular proteomics : MCP",
            "date": "2013",
            "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M",
            "evidence": [
                {
                    "database": "GlyGen",
                    "id": "GLY_000143",
                    "url": "https://data.glygen.org/GLY_000143"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23090970",
                    "url": "https://glygen.org/publication/PubMed/23090970"
                }
            ]
        },
        {
            "title": "The protein tyrosine phosphatase, Shp2, positively contributes to FLT3-ITD-induced hematopoietic progenitor hyperproliferation and malignant disease in vivo.",
            "journal": "Leukemia",
            "date": "2013",
            "authors": "Nabinger SC, Li XJ, Ramdas B, He Y, Zhang X, Zeng L, Richine B, Bowling JD, Fukuda S, Goenka S, Liu Z, Feng GS, Yu M, Sandusky GE, Boswell HS, Zhang ZY, Kapur R, Chan RJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23103841",
                    "url": "https://glygen.org/publication/PubMed/23103841"
                }
            ]
        },
        {
            "title": "Integrative analysis of prognostic factors in Chinese core binding factor leukemia.",
            "journal": "Biochemical and biophysical research communications",
            "date": "2012",
            "authors": "Wang D, Qiao C, Xiao M, Geng Z, Shang Z, He J, Huang M, Yang Y, Zhang N, Liu Y, Li J, Li C, Zhou J",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23107788",
                    "url": "https://glygen.org/publication/PubMed/23107788"
                }
            ]
        },
        {
            "title": "Regulation of small GTPases by GEFs, GAPs, and GDIs.",
            "journal": "Physiological reviews",
            "date": "2013",
            "authors": "Cherfils J, Zeghouf M",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23303910",
                    "url": "https://glygen.org/publication/PubMed/23303910"
                }
            ]
        },
        {
            "title": "Nonredundant functions for Ras GTPase-activating proteins in tissue homeostasis.",
            "journal": "Science signaling",
            "date": "2013",
            "authors": "King PD, Lubeck BA, Lapinski PE",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23443682",
                    "url": "https://glygen.org/publication/PubMed/23443682"
                }
            ]
        },
        {
            "title": "Extracellular domain c-kit mutation with duplication of Ser501Ala502 found in gastrointestinal stromal tumors is more imatinib- and nilotinib-sensitive than that with duplication of Ala502Tyr503.",
            "journal": "Laboratory investigation; a journal of technical methods and pathology",
            "date": "2013",
            "authors": "Liu NN, Ohkouchi M, Hashikura Y, Kajimoto N, Matsuda I, Isozaki K, Toh Y, Takahashi T, Nishida T, Hirota S",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23459373",
                    "url": "https://glygen.org/publication/PubMed/23459373"
                }
            ]
        },
        {
            "title": "Intermittent and continuous imatinib in a human GIST xenograft model carrying KIT exon 17 resistance mutation D816H.",
            "journal": "Acta oncologica (Stockholm, Sweden)",
            "date": "2013",
            "authors": "Revheim ME, Kristian A, Malinen E, Bruland OS, Berner JM, Holm R, Joensuu H, Seierstad T",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23480638",
                    "url": "https://glygen.org/publication/PubMed/23480638"
                }
            ]
        },
        {
            "title": "Structure of ERK2 bound to PEA-15 reveals a mechanism for rapid release of activated MAPK.",
            "journal": "Nature communications",
            "date": "2013",
            "authors": "Mace PD, Wallez Y, Egger MF, Dobaczewska MK, Robinson H, Pasquale EB, Riedl SJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23575685",
                    "url": "https://glygen.org/publication/PubMed/23575685"
                }
            ]
        },
        {
            "title": "The prognostic impact of c-KIT mutation in systemic mastocytosis associated with acute myeloid leukaemia patients.",
            "journal": "Leukemia research",
            "date": "2013",
            "authors": "Won D, Chi HS, Shim H, Jang S, Park CJ, Lee JH",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23683787",
                    "url": "https://glygen.org/publication/PubMed/23683787"
                }
            ]
        },
        {
            "title": "Chromatin and epigenetic determinants of estrogen receptor alpha (ESR1) signaling.",
            "journal": "Molecular and cellular endocrinology",
            "date": "2014",
            "authors": "Magnani L, Lupien M",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-8866910",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23684889",
                    "url": "https://glygen.org/publication/PubMed/23684889"
                }
            ]
        },
        {
            "title": "Phosphorylation of the activation loop tyrosine 823 in c-Kit is crucial for cell survival and proliferation.",
            "journal": "The Journal of biological chemistry",
            "date": "2013",
            "authors": "Agarwal S, Kazi JU, Ronnstrand L",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23803604",
                    "url": "https://glygen.org/publication/PubMed/23803604"
                }
            ]
        },
        {
            "title": "Diagnosis and treatment of KIT-mutant metastatic melanoma.",
            "journal": "Journal of clinical oncology : official journal of the American Society of Clinical Oncology",
            "date": "2013",
            "authors": "Lyle M, Long GV",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23940219",
                    "url": "https://glygen.org/publication/PubMed/23940219"
                }
            ]
        },
        {
            "title": "Prognostic impact of blast cell counts in dysplastic bone marrow disorders (MDS and CMML I) with concomitant fibrosis.",
            "journal": "Annals of hematology",
            "date": "2014",
            "authors": "Machherndl-Spandl S, Sega W, Bosmuller H, Germing U, Gruber Ch, Nachtkamp K, Reinecke P, Sperr WR, Wimazal F, Mullauer L, Sotlar K, Horny HP, Tuchler H, Valent P, Krieger O",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24241126",
                    "url": "https://glygen.org/publication/PubMed/24241126"
                }
            ]
        },
        {
            "title": "A new germline mutation in KIT associated with diffuse cutaneous mastocytosis in a Chinese family.",
            "journal": "Clinical and experimental dermatology",
            "date": "2014",
            "authors": "Wang HJ, Lin ZM, Zhang J, Yin JH, Yang Y",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24289326",
                    "url": "https://glygen.org/publication/PubMed/24289326"
                }
            ]
        },
        {
            "title": "A new KIT mutation (N505I) in acral melanoma confers constitutive signaling, favors tumorigenic properties, and is sensitive to imatinib.",
            "journal": "The Journal of investigative dermatology",
            "date": "2014",
            "authors": "Allegra M, Giacchero D, Segalen C, Dumaz N, Butori C, Hofman V, Hofman P, Lacour JP, Bertolotto C, Bahadoran P, Ballotti R",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24317392",
                    "url": "https://glygen.org/publication/PubMed/24317392"
                }
            ]
        },
        {
            "title": "The FIP1L1-PDGFRA fusion gene and the KIT D816V mutation are coexisting in a small subset of myeloid/lymphoid neoplasms with eosinophilia.",
            "journal": "Blood",
            "date": "2014",
            "authors": "Schmitt-Graeff AH, Erben P, Schwaab J, Vollmer-Kary B, Metzgeroth G, Sotlar K, Horny HP, Kreipe HH, Fisch P, Reiter A",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24458279",
                    "url": "https://glygen.org/publication/PubMed/24458279"
                }
            ]
        },
        {
            "title": "CADM1 controls actin cytoskeleton assembly and regulates extracellular matrix adhesion in human mast cells.",
            "journal": "PloS one",
            "date": "2014",
            "authors": "Moiseeva Elena P, Straatman Kees R, Leyland Mark L, Bradding Peter",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24465823",
                    "url": "https://glygen.org/publication/PubMed/24465823"
                }
            ]
        },
        {
            "title": "Human proto-oncogene c-kit: a new cell surface receptor tyrosine kinase for an unidentified ligand.",
            "journal": "EMBO J.",
            "date": "1987",
            "authors": "Yarden Y, Kuang W J, Yang-Feng T, Coussens L, Munemitsu S, Dull T J, Chen E, Schlessinger J, Francke U, Ullrich A",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "2448137",
                    "url": "https://glygen.org/publication/PubMed/2448137"
                }
            ]
        },
        {
            "title": "Ponatinib induces apoptosis in imatinib-resistant human mast cells by dephosphorylating mutant D816V KIT and silencing beta-catenin signaling.",
            "journal": "Molecular cancer therapeutics",
            "date": "2014",
            "authors": "Jin B, Ding K, Pan J",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24552773",
                    "url": "https://glygen.org/publication/PubMed/24552773"
                }
            ]
        },
        {
            "title": "Multiple gastrointestinal stromal tumors with novel germline c-kit gene mutation, K642T, at exon 13.",
            "journal": "Human pathology",
            "date": "2014",
            "authors": "Yamanoi K, Higuchi K, Kishimoto H, Nishida Y, Nakamura M, Sudoh M, Hirota S",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24565205",
                    "url": "https://glygen.org/publication/PubMed/24565205"
                }
            ]
        },
        {
            "title": "FLAG-induced remission in a patient with acute mast cell leukemia (MCL) exhibiting t(7;10)(q22;q26) and KIT D816H.",
            "journal": "Leukemia research reports",
            "date": "2014",
            "authors": "Valent P, Blatt K, Eisenwort G, Herrmann H, Cerny-Reiterer S, Thalhammer R, Mullauer L, Hoermann G, Sadovnik I, Schwarzinger I, Sperr WR, Mannhalter C, Horny HP",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24596674",
                    "url": "https://glygen.org/publication/PubMed/24596674"
                }
            ]
        },
        {
            "title": "KRAS and KIT Gatekeeper Mutations Confer Polyclonal Primary Imatinib Resistance in GI Stromal Tumors: Relevance of Concomitant Phosphatidylinositol 3-Kinase/AKT Dysregulation.",
            "journal": "Journal of clinical oncology : official journal of the American Society of Clinical Oncology",
            "date": "2015",
            "authors": "Serrano C, Wang Y, Marino-Enriquez A, Lee JC, Ravegnini G, Morgan JA, Bertagnolli MM, Beadling C, Demetri GD, Corless CL, Heinrich MC, Fletcher JA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24687822",
                    "url": "https://glygen.org/publication/PubMed/24687822"
                }
            ]
        },
        {
            "title": "The Frequency of Mutations in Exon 11 of the c-kit Gene in Patients With Leukemia.",
            "journal": "Turkish journal of haematology : official journal of Turkish Society of Haematology",
            "date": "2012",
            "authors": "Hussain SR, Babu SG, Naqvi H, Singh P, Mahdi F",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24744618",
                    "url": "https://glygen.org/publication/PubMed/24744618"
                }
            ]
        },
        {
            "title": "PI3K/AKT signaling pathway and cancer: an updated review.",
            "journal": "Annals of medicine",
            "date": "2014",
            "authors": "Martini M, De Santis MC, Braccini L, Gulluni F, Hirsch E",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24897931",
                    "url": "https://glygen.org/publication/PubMed/24897931"
                }
            ]
        },
        {
            "title": "`RAF` neighborhood: protein-protein interaction in the Raf/Mek/Erk pathway.",
            "journal": "FEBS letters",
            "date": "2014",
            "authors": "Cseh B, Doma E, Baccarini M",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24937142",
                    "url": "https://glygen.org/publication/PubMed/24937142"
                }
            ]
        },
        {
            "title": "A novel melting curve-based method for detecting c-kit mutations in acute myeloid leukemia.",
            "journal": "Oncology letters",
            "date": "2014",
            "authors": "Lu Q, Huang X, Chen H, Zhao X",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24959227",
                    "url": "https://glygen.org/publication/PubMed/24959227"
                }
            ]
        },
        {
            "title": "Cytogenetically normal acute myeloid leukemia with a novel KIT mutation in exon 11 G565V developing a sole trisomy 13 at relapse: a clinical dilemma.",
            "journal": "Acta haematologica",
            "date": "2015",
            "authors": "Nieto MJ, Scalise A, Najfeld V",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24968822",
                    "url": "https://glygen.org/publication/PubMed/24968822"
                }
            ]
        },
        {
            "title": "Identification of kit(M541L) somatic mutation in chronic eosinophilic leukemia, not otherwise specified and its implication in low-dose imatinib response.",
            "journal": "Oncotarget",
            "date": "2014",
            "authors": "Iurlo A, Gianelli U, Beghini A, Spinelli O, Orofino N, Lazzaroni F, Cambiaghi S, Intermesoli T, Rambaldi A, Cortelezzi A",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25015329",
                    "url": "https://glygen.org/publication/PubMed/25015329"
                }
            ]
        },
        {
            "title": "Chronic mast cell leukemia (MCL) with KIT S476I: a rare entity defined by leukemic expansion of mature mast cells and absence of organ damage.",
            "journal": "Annals of hematology",
            "date": "2015",
            "authors": "Valent P, Berger J, Cerny-Reiterer S, Peter B, Eisenwort G, Hoermann G, Mullauer L, Mannhalter C, Steurer M, Bettelheim P, Horny HP, Arock M",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25209843",
                    "url": "https://glygen.org/publication/PubMed/25209843"
                }
            ]
        },
        {
            "title": "Ral small GTPase signaling and oncogenesis: More than just 15minutes of fame.",
            "journal": "Biochimica et biophysica acta",
            "date": "2014",
            "authors": "Gentry LR, Martin TD, Reiner DJ, Der CJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25219551",
                    "url": "https://glygen.org/publication/PubMed/25219551"
                }
            ]
        },
        {
            "title": "Ponatinib inhibits polyclonal drug-resistant KIT oncoproteins and shows therapeutic potential in heavily pretreated gastrointestinal stromal tumor (GIST) patients.",
            "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
            "date": "2014",
            "authors": "Garner AP, Gozgit JM, Anjum R, Vodala S, Schrock A, Zhou T, Serrano C, Eilers G, Zhu M, Ketzer J, Wardwell S, Ning Y, Song Y, Kohlmann A, Wang F, Clackson T, Heinrich MC, Fletcher JA, Bauer S, Rivera VM",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669917",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669917"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25239608",
                    "url": "https://glygen.org/publication/PubMed/25239608"
                }
            ]
        },
        {
            "title": "The overexpression of KIT proto-oncogene in acute leukemic cells is not necessarily caused by the gene mutation.",
            "journal": "Acta haematologica",
            "date": "2015",
            "authors": "Szatkowski D, Hellmann A",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25247397",
                    "url": "https://glygen.org/publication/PubMed/25247397"
                }
            ]
        },
        {
            "title": "Combined inhibition of MAP kinase and KIT signaling synergistically destabilizes ETV1 and suppresses GIST tumor growth.",
            "journal": "Cancer discovery",
            "date": "2015",
            "authors": "Ran L, Sirota I, Cao Z, Murphy D, Chen Y, Shukla S, Xie Y, Kaufmann MC, Gao D, Zhu S, Rossi F, Wongvipat J, Taguchi T, Tap WD, Mellinghoff IK, Besmer P, Antonescu CR, Chen Y, Chi P",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25572173",
                    "url": "https://glygen.org/publication/PubMed/25572173"
                }
            ]
        },
        {
            "title": "The CD20 homologue MS4A4 directs trafficking of KIT toward clathrin-independent endocytosis pathways and thus regulates receptor signaling and recycling.",
            "journal": "Molecular biology of the cell",
            "date": "2015",
            "authors": "Cruse G, Beaven MA, Music SC, Bradding P, Gilfillan AM, Metcalfe DD",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25717186",
                    "url": "https://glygen.org/publication/PubMed/25717186"
                }
            ]
        },
        {
            "title": "De novo leukemic variant of mast cell leukemia with KIT D816V.",
            "journal": "Annals of laboratory medicine",
            "date": "2015",
            "authors": "Bang HI, Park R, Park ES, Choi IH, Kim KH, Shin JW, Choi TY, Han K, Won JH",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25729733",
                    "url": "https://glygen.org/publication/PubMed/25729733"
                }
            ]
        },
        {
            "title": "Detection of KIT and PDGFRA mutations in the plasma of patients with gastrointestinal stromal tumor.",
            "journal": "Targeted oncology",
            "date": "2015",
            "authors": "Kang G, Bae BN, Sohn BS, Pyo JS, Kang GH, Kim KM",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25735500",
                    "url": "https://glygen.org/publication/PubMed/25735500"
                }
            ]
        },
        {
            "title": "The role of Tcfap2c in tumorigenesis and cancer growth in an activated Neu model of mammary carcinogenesis.",
            "journal": "Oncogene",
            "date": "2015",
            "authors": "Park JM, Wu T, Cyr AR, Woodfield GW, De Andrade JP, Spanheimer PM, Li T, Sugg SL, Lal G, Domann FE, Zhang W, Weigel RJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-8866910",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25772240",
                    "url": "https://glygen.org/publication/PubMed/25772240"
                }
            ]
        },
        {
            "title": "Screening of C-kit gene Mutation in Acute Myeloid Leukaemia in Northern India.",
            "journal": "Iranian journal of cancer prevention",
            "date": "2012",
            "authors": "Hussain SR, Raza ST, Babu SG, Singh P, Naqvi H, Mahdi F",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25780536",
                    "url": "https://glygen.org/publication/PubMed/25780536"
                }
            ]
        },
        {
            "title": "Ras activation revisited: role of GEF and GAP systems.",
            "journal": "Biological chemistry",
            "date": "2015",
            "authors": "Hennig A, Markwart R, Esparza-Franco MA, Ladds G, Rubio I",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25781681",
                    "url": "https://glygen.org/publication/PubMed/25781681"
                }
            ]
        },
        {
            "title": "The Key Role of Calmodulin in KRAS-Driven Adenocarcinomas.",
            "journal": "Molecular cancer research : MCR",
            "date": "2015",
            "authors": "Nussinov R, Muratcioglu S, Tsai CJ, Jang H, Gursoy A, Keskin O",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26085527",
                    "url": "https://glygen.org/publication/PubMed/26085527"
                }
            ]
        },
        {
            "title": "ATAD2 overexpression links to enrichment of B-MYB-translational signatures and development of aggressive endometrial carcinoma.",
            "journal": "Oncotarget",
            "date": "2015",
            "authors": "Krakstad C, Tangen IL, Hoivik EA, Halle MK, Berg A, Werner HM, Raeder MB, Kusonmano K, Zou JX, Oyan AM, Stefansson I, Trovik J, Kalland KH, Chen HW, Salvesen HB",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-8866910",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26308378",
                    "url": "https://glygen.org/publication/PubMed/26308378"
                }
            ]
        },
        {
            "title": "KIT exon 10 variant (c.1621 A > C) single nucleotide polymorphism as predictor of GIST patient outcome.",
            "journal": "BMC cancer",
            "date": "2015",
            "authors": "Brahmi M, Alberti L, Dufresne A, Ray-Coquard I, Cassier P, Meeus P, Decouvelaere AV, Ranchere-Vince D, Blay JY",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26498480",
                    "url": "https://glygen.org/publication/PubMed/26498480"
                }
            ]
        },
        {
            "title": "EGFR Is Regulated by TFAP2C in Luminal Breast Cancer and Is a Target for Vandetanib.",
            "journal": "Molecular cancer therapeutics",
            "date": "2016",
            "authors": "De Andrade JP, Park JM, Gu VW, Woodfield GW, Kulak MV, Lorenzen AW, Wu VT, Van Dorin SE, Spanheimer PM, Weigel RJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-8866910",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26832794",
                    "url": "https://glygen.org/publication/PubMed/26832794"
                }
            ]
        },
        {
            "title": "RACK1 overexpression is linked to acquired imatinib resistance in gastrointestinal stromal tumor.",
            "journal": "Oncotarget",
            "date": "2016",
            "authors": "Gao X, Xue A, Fang Y, Shu P, Ling J, Hou Y, Shen K, Qin J, Sun Y, Qin X",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26893362",
                    "url": "https://glygen.org/publication/PubMed/26893362"
                }
            ]
        },
        {
            "title": "p.(L576P) -KIT mutation in GIST: Favorable prognosis and sensitive to imatinib?",
            "journal": "Cancer biology & therapy",
            "date": "2016",
            "authors": "Noujaim J, Gonzalez D, Thway K, Jones RL, Judson I",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26942271",
                    "url": "https://glygen.org/publication/PubMed/26942271"
                }
            ]
        },
        {
            "title": "A Case of Sinonasal Melanoma With Unusual Primary Exon 17 KIT D820G Mutation.",
            "journal": "Applied immunohistochemistry & molecular morphology : AIMM",
            "date": "2016",
            "authors": "Pilozzi E, Bartolazzi A, Fochetti F, Duranti E, Scarpino S, Valeriani M, Moriconi P, Ruco L",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27153441",
                    "url": "https://glygen.org/publication/PubMed/27153441"
                }
            ]
        },
        {
            "title": "The human tyrosine kinase Kit and its gatekeeper mutant T670I, show different kinetic properties: Implications for drug design.",
            "journal": "Bioorganic & medicinal chemistry",
            "date": "2016",
            "authors": "Kissova M, Maga G, Crespan E",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669926",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669926"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27527414",
                    "url": "https://glygen.org/publication/PubMed/27527414"
                }
            ]
        },
        {
            "title": "Receptor tyrosine kinase (c-Kit) inhibitors: a potential therapeutic target in cancer cells.",
            "journal": "Drug design, development and therapy",
            "date": "2016",
            "authors": "Abbaspour Babaei M, Kamalidehghan B, Saleem M, Huri HZ, Ahmadipour F",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27536065",
                    "url": "https://glygen.org/publication/PubMed/27536065"
                }
            ]
        },
        {
            "title": "Comparative study on driver mutations in primary and metastatic melanomas at a single Japanese institute: A clue for intra- and inter-tumor heterogeneity.",
            "journal": "Journal of dermatological science",
            "date": "2017",
            "authors": "Kaji T, Yamasaki O, Takata M, Otsuka M, Hamada T, Morizane S, Asagoe K, Yanai H, Hirai Y, Umemura H, Iwatsuki K",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27771229",
                    "url": "https://glygen.org/publication/PubMed/27771229"
                }
            ]
        },
        {
            "title": "A variant c-KIT mutation, D816H, fundamental to the sequential development of an ovarian mixed germ cell tumor and systemic mastocytosis with chronic myelomonocytic leukemia.",
            "journal": "Pediatric blood & cancer",
            "date": "2017",
            "authors": "Mitchell SG, Bunting ST, Saxe D, Olson T, Keller FG",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27781377",
                    "url": "https://glygen.org/publication/PubMed/27781377"
                }
            ]
        },
        {
            "title": "Oncogenic signaling by Kit tyrosine kinase occurs selectively on the Golgi apparatus in gastrointestinal stromal tumors.",
            "journal": "Oncogene",
            "date": "2017",
            "authors": "Obata Y, Horikawa K, Takahashi T, Akieda Y, Tsujimoto M, Fletcher JA, Esumi H, Nishida T, Abe R",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "28192400",
                    "url": "https://glygen.org/publication/PubMed/28192400"
                }
            ]
        },
        {
            "title": "Analysis of a panel of druggable gene mutations and of ALK and PD-L1 expression in a series of thymic epithelial tumors (TETs).",
            "journal": "Lung cancer (Amsterdam, Netherlands)",
            "date": "2017",
            "authors": "Tiseo M, Damato A, Longo L, Barbieri F, Bertolini F, Stefani A, Migaldi M, Gnetti L, Camisa R, Bordi P, Buti S, Rossi G",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "28212996",
                    "url": "https://glygen.org/publication/PubMed/28212996"
                }
            ]
        },
        {
            "title": "The clinical and molecular diversity of mast cell leukemia with or without associated hematologic neoplasm.",
            "journal": "Haematologica",
            "date": "2017",
            "authors": "Jawhar M, Schwaab J, Meggendorfer M, Naumann N, Horny HP, Sotlar K, Haferlach T, Schmitt K, Fabarius A, Valent P, Hofmann WK, Cross NCP, Metzgeroth G, Reiter A",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "28255023",
                    "url": "https://glygen.org/publication/PubMed/28255023"
                }
            ]
        },
        {
            "title": "M-COPA suppresses endolysosomal Kit-Akt oncogenic signalling through inhibiting the secretory pathway in neoplastic mast cells.",
            "journal": "PloS one",
            "date": "2017",
            "authors": "Hara Y, Obata Y, Horikawa K, Tasaki Y, Suzuki K, Murata T, Shiina I, Abe R",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "28403213",
                    "url": "https://glygen.org/publication/PubMed/28403213"
                }
            ]
        },
        {
            "title": "Novel Insights into the Treatment of Imatinib-Resistant Gastrointestinal Stromal Tumors.",
            "journal": "Targeted oncology",
            "date": "2017",
            "authors": "Serrano C, George S, Valverde C, Olivares D, Garcia-Valverde A, Suarez C, Morales-Barrera R, Carles J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669917",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669917"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "28478525",
                    "url": "https://glygen.org/publication/PubMed/28478525"
                }
            ]
        },
        {
            "title": "A phase II trial of regorafenib in patients with metastatic and/or a unresectable gastrointestinal stromal tumor harboring secondary mutations of exon 17.",
            "journal": "Oncotarget",
            "date": "2017",
            "authors": "Yeh CN, Chen MH, Chen YY, Yang CY, Yen CC, Tzen CY, Chen LT, Chen JS",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669929",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669929"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "28487491",
                    "url": "https://glygen.org/publication/PubMed/28487491"
                }
            ]
        },
        {
            "title": "D816V mutation in the KIT gene activation loop has greater cell-proliferative and anti-apoptotic ability than N822K mutation in core-binding factor acute myeloid leukemia.",
            "journal": "Experimental hematology",
            "date": "2017",
            "authors": "Omori I, Yamaguchi H, Miyake K, Miyake N, Kitano T, Inokuchi K",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "28506695",
                    "url": "https://glygen.org/publication/PubMed/28506695"
                }
            ]
        },
        {
            "title": "KIT(D816V) Induces SRC-Mediated Tyrosine Phosphorylation of MITF and Altered Transcription Program in Melanoma.",
            "journal": "Molecular cancer research : MCR",
            "date": "2017",
            "authors": "Phung B, Kazi JU, Lundby A, Bergsteinsdottir K, Sun J, Goding CR, Jonsson G, Olsen JV, Steingrimsson E, Ronnstrand L",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "28584020",
                    "url": "https://glygen.org/publication/PubMed/28584020"
                }
            ]
        },
        {
            "title": "D816 mutation of the KIT gene in core binding factor acute myeloid leukemia is associated with poorer prognosis than other KIT gene mutations.",
            "journal": "Annals of hematology",
            "date": "2017",
            "authors": "Yui S, Kurosawa S, Yamaguchi H, Kanamori H, Ueki T, Uoshima N, Mizuno I, Shono K, Usuki K, Chiba S, Nakamura Y, Yanada M, Kanda J, Tajika K, Gomi S, Fukunaga K, Wakita S, Ryotokuji T, Fukuda T, Inokuchi K",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "28762080",
                    "url": "https://glygen.org/publication/PubMed/28762080"
                }
            ]
        },
        {
            "title": "Targeting Ras with Macromolecules.",
            "journal": "Cold Spring Harbor perspectives in medicine",
            "date": "2018",
            "authors": "Pei D, Chen K, Liao H",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "28778966",
                    "url": "https://glygen.org/publication/PubMed/28778966"
                }
            ]
        },
        {
            "title": "Highly Aggressive de novo Aleukemic Variant of Mast Cell Leukemia Without KIT D816V Mutation.",
            "journal": "Annals of laboratory medicine",
            "date": "2017",
            "authors": "Suh MC, Ham JY, Park TI, Moon JH, Suh JS",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "28840997",
                    "url": "https://glygen.org/publication/PubMed/28840997"
                }
            ]
        },
        {
            "title": "Molecular and functional characterization of a new 3' end KIT juxtamembrane deletion in a duodenal GIST treated with neoadjuvant Imatinib.",
            "journal": "Oncotarget",
            "date": "2017",
            "authors": "Perfetti V, Laurini E, Aulic S, Fermeglia M, Riboni R, Lucioni M, Dallera E, Delfanti S, Pugliese L, Latteri FS, Pietrabissa A, Pricl S",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "28915580",
                    "url": "https://glygen.org/publication/PubMed/28915580"
                }
            ]
        },
        {
            "title": "Direct engagement of the PI3K pathway by mutant KIT dominates oncogenic signaling in gastrointestinal stromal tumor.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2017",
            "authors": "Bosbach B, Rossi F, Yozgat Y, Loo J, Zhang JQ, Berrozpe G, Warpinski K, Ehlers I, Veach D, Kwok A, Manova K, Antonescu CR, DeMatteo RP, Besmer P",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "28923937",
                    "url": "https://glygen.org/publication/PubMed/28923937"
                }
            ]
        },
        {
            "title": "A precision therapy against cancers driven by KIT/PDGFRA mutations.",
            "journal": "Science translational medicine",
            "date": "2017",
            "authors": "Evans EK, Gardino AK, Kim JL, Hodous BL, Shutes A, Davis A, Zhu XJ, Schmidt-Kittler O, Wilson D, Wilson K, DiPietro L, Zhang Y, Brooijmans N, LaBranche TP, Wozniak A, Gebreyohannes YK, Schoffski P, Heinrich MC, DeAngelo DJ, Miller S, Wolf B, Kohl N, Guzi T, Lydon N, Boral A, Lengauer C",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669921",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669921"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29093181",
                    "url": "https://glygen.org/publication/PubMed/29093181"
                }
            ]
        },
        {
            "title": "KIT D816V- chronic myelomonocytic leukemia progressing to KIT D816V+ associated to mast cell leukemia responding to allogeneic hematopoietic cell transplantation.",
            "journal": "Annals of hematology",
            "date": "2018",
            "authors": "Prats-Martin C, Jimenez-Guerrero P, Morales-Camacho RM, Caballero-Velazquez T, Vargas MT, Perez O, Montero I, Falantes J, Burillo-Sanz S, Carrillo E, Borrero JJ, Bernal R, Perez-Simon JA",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29151134",
                    "url": "https://glygen.org/publication/PubMed/29151134"
                }
            ]
        },
        {
            "title": "Characterization of CD34(+) hematopoietic cells in systemic mastocytosis: Potential role in disease dissemination.",
            "journal": "Allergy",
            "date": "2018",
            "authors": "Mayado A, Teodosio C, Dasilva-Freire N, Jara-Acevedo M, Garcia-Montero AC, Alvarez-Twose I, Sanchez-Munoz L, Matito A, Caldas C, Munoz-Gonzalez JI, Henriques A, Sanchez-Gallego JI, Escribano L, Orfao A",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29331029",
                    "url": "https://glygen.org/publication/PubMed/29331029"
                }
            ]
        },
        {
            "title": "Regorafenib regresses an imatinib-resistant recurrent gastrointestinal stromal tumor (GIST) with a mutation in exons 11 and 17 of c-kit in a patient-derived orthotopic xenograft (PDOX) nude mouse model.",
            "journal": "Cell cycle (Georgetown, Tex.)",
            "date": "2018",
            "authors": "Miyake K, Kawaguchi K, Kiyuna T, Miyake M, Igarashi K, Zhang Z, Murakami T, Li Y, Nelson SD, Elliott I, Russell T, Singh A, Hiroshima Y, Momiyama M, Matsuyama R, Chishima T, Endo I, Eilber FC, Hoffman RM",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669929",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669929"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29334307",
                    "url": "https://glygen.org/publication/PubMed/29334307"
                }
            ]
        },
        {
            "title": "Discovery of a highly selective KIT kinase primary V559D mutant inhibitor for gastrointestinal stromal tumors (GISTs).",
            "journal": "Oncotarget",
            "date": "2017",
            "authors": "Yu K, Liu X, Jiang Z, Hu C, Zou F, Chen C, Ge J, Wu J, Liu X, Wang A, Wang W, Wang W, Qi Z, Wang B, Wang L, Yan H, Wang J, Ren T, Tang J, Liu Q, Liu J",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29340041",
                    "url": "https://glygen.org/publication/PubMed/29340041"
                }
            ]
        },
        {
            "title": "A change in structural integrity of c-Kit mutant D816V causes constitutive signaling.",
            "journal": "Mutation research",
            "date": "2018-03",
            "authors": "Raghav Pawan Kumar, Singh Ajay Kumar, Gangenahalli Gurudutta",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29482074",
                    "url": "https://glygen.org/publication/PubMed/29482074"
                }
            ]
        },
        {
            "title": "KIT D816V Positive Acute Mast Cell Leukemia Associated with Normal Karyotype Acute Myeloid Leukemia.",
            "journal": "Case reports in hematology",
            "date": "2018",
            "authors": "Lopes M, Teixeira MDA, Casais C, Mesquita V, Seabra P, Cabral R, Palla-Garcia J, Lau C, Rodrigues J, Jara-Acevedo M, Freitas I, Vizcaino JR, Coutinho J, Escribano L, Orfao A, Lima M",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29670776",
                    "url": "https://glygen.org/publication/PubMed/29670776"
                }
            ]
        },
        {
            "title": "Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and alpha-1B-Glycoprotein.",
            "journal": "Analytical chemistry",
            "date": "2018",
            "authors": "Sun S, Hu Y, Jia L, Eshghi ST, Liu Y, Shah P, Zhang H",
            "evidence": [
                {
                    "database": "UniCarbKB",
                    "id": "P10721",
                    "url": ""
                },
                {
                    "database": "GlyConnect",
                    "id": "1492",
                    "url": "https://glyconnect.expasy.org/browser/proteins/1492"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29671580",
                    "url": "https://glygen.org/publication/PubMed/29671580"
                }
            ]
        },
        {
            "title": "The role of small molecule Kit protein-tyrosine kinase inhibitors in the treatment of neoplastic disorders.",
            "journal": "Pharmacological research",
            "date": "2018",
            "authors": "Roskoski R Jr",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29704617",
                    "url": "https://glygen.org/publication/PubMed/29704617"
                }
            ]
        },
        {
            "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.",
            "journal": "Analytical chemistry",
            "date": "2018",
            "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H",
            "evidence": [
                {
                    "database": "UniCarbKB",
                    "id": "P10721",
                    "url": ""
                },
                {
                    "database": "GlyConnect",
                    "id": "1492",
                    "url": "https://glyconnect.expasy.org/browser/proteins/1492"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29741879",
                    "url": "https://glygen.org/publication/PubMed/29741879"
                }
            ]
        },
        {
            "title": "Structural and clinical consequences of activation loop mutations in class III receptor tyrosine kinases.",
            "journal": "Pharmacology & therapeutics",
            "date": "2018",
            "authors": "Klug LR, Kent JD, Heinrich MC",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29964125",
                    "url": "https://glygen.org/publication/PubMed/29964125"
                }
            ]
        },
        {
            "title": "BPR1J373, a novel multitargeted kinase inhibitor, effectively suppresses the growth of gastrointestinal stromal tumor.",
            "journal": "Cancer science",
            "date": "2018-11",
            "authors": "Tsai Hui-Jen, Jiaang Weir-Torn, Shih Neng-Yao, Fletcher Jonathan A, Lin Ming-Jon, Yang Ming-Yu, Chen Chiung-Tong, Hsu Tsu-An John, Wu Chun-Chieh, Lin Hui-You, Chen Li-Tzong",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "30142229",
                    "url": "https://glygen.org/publication/PubMed/30142229"
                }
            ]
        },
        {
            "title": "LMTK3 is essential for oncogenic KIT expression in KIT-mutant GIST and melanoma.",
            "journal": "Oncogene",
            "date": "2019",
            "authors": "Klug LR, Bannon AE, Javidi-Sharifi N, Town A, Fleming WH, VanSlyke JK, Musil LS, Fletcher JA, Tyner JW, Heinrich MC",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "30242244",
                    "url": "https://glygen.org/publication/PubMed/30242244"
                }
            ]
        },
        {
            "title": "Robust Activity of Avapritinib, Potent and Highly Selective Inhibitor of Mutated KIT, in Patient-derived Xenograft Models of Gastrointestinal Stromal Tumors.",
            "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
            "date": "2019",
            "authors": "Gebreyohannes YK, Wozniak A, Zhai ME, Wellens J, Cornillie J, Vanleeuw U, Evans E, Gardino AK, Lengauer C, Debiec-Rychter M, Sciot R, Schoffski P",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669921",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669921"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "30274985",
                    "url": "https://glygen.org/publication/PubMed/30274985"
                }
            ]
        },
        {
            "title": "Complementary activity of tyrosine kinase inhibitors against secondary kit mutations in imatinib-resistant gastrointestinal stromal tumours.",
            "journal": "British journal of cancer",
            "date": "2019",
            "authors": "Serrano C, Marino-Enriquez A, Tao DL, Ketzer J, Eilers G, Zhu M, Yu C, Mannan AM, Rubin BP, Demetri GD, Raut CP, Presnell A, McKinley A, Heinrich MC, Czaplinski JT, Sicinska E, Bauer S, George S, Fletcher JA",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "30792533",
                    "url": "https://glygen.org/publication/PubMed/30792533"
                }
            ]
        },
        {
            "title": "Secondary KIT mutations: the GIST of drug resistance and sensitivity.",
            "journal": "British journal of cancer",
            "date": "2019",
            "authors": "Napolitano A, Vincenzi B",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669917",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669917"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "30792534",
                    "url": "https://glygen.org/publication/PubMed/30792534"
                }
            ]
        },
        {
            "title": "Ripretinib (DCC-2618) Is a Switch Control Kinase Inhibitor of a Broad Spectrum of Oncogenic and Drug-Resistant KIT and PDGFRA Variants.",
            "journal": "Cancer cell",
            "date": "2019",
            "authors": "Smith BD, Kaufman MD, Lu WP, Gupta A, Leary CB, Wise SC, Rutkoski TJ, Ahn YM, Al-Ani G, Bulfer SL, Caldwell TM, Chun L, Ensinger CL, Hood MM, McKinley A, Patt WC, Ruiz-Soto R, Su Y, Telikepalli H, Town A, Turner BA, Vogeti L, Vogeti S, Yates K, Janku F, Abdul Razak AR, Rosen O, Heinrich MC, Flynn DL",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "31085175",
                    "url": "https://glygen.org/publication/PubMed/31085175"
                }
            ]
        },
        {
            "title": "The structural basis for Ras activation of PI3Kalpha lipid kinase.",
            "journal": "Physical chemistry chemical physics : PCCP",
            "date": "2019",
            "authors": "Zhang M, Jang H, Nussinov R",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "31135801",
                    "url": "https://glygen.org/publication/PubMed/31135801"
                }
            ]
        },
        {
            "title": "Comparison of effects of midostaurin, crenolanib, quizartinib, gilteritinib, sorafenib and BLU-285 on oncogenic mutants of KIT, CBL and FLT3 in haematological malignancies.",
            "journal": "British journal of haematology",
            "date": "2019",
            "authors": "Weisberg E, Meng C, Case AE, Sattler M, Tiv HL, Gokhale PC, Buhrlage SJ, Liu X, Yang J, Wang J, Gray N, Stone RM, Adamia S, Dubreuil P, Letard S, Griffin JD",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669921",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669921"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "31309543",
                    "url": "https://glygen.org/publication/PubMed/31309543"
                }
            ]
        },
        {
            "title": "Phase I Study of Rapid Alternation of Sunitinib and Regorafenib for the Treatment of Tyrosine Kinase Inhibitor Refractory Gastrointestinal Stromal Tumors.",
            "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
            "date": "2019",
            "authors": "Serrano C, Leal A, Kuang Y, Morgan JA, Barysauskas CM, Phallen J, Triplett O, Marino-Enriquez A, Wagner AJ, Demetri GD, Velculescu VE, Paweletz CP, Fletcher JA, George S",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669929",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669929"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "31471313",
                    "url": "https://glygen.org/publication/PubMed/31471313"
                }
            ]
        },
        {
            "title": "N822K- or V560G-mutated KIT activation preferentially occurs in lipid rafts of the Golgi apparatus in leukemia cells.",
            "journal": "Cell communication and signaling : CCS",
            "date": "2019-09-04",
            "authors": "Obata Yuuki, Hara Yasushi, Shiina Isamu, Murata Takatsugu, Tasaki Yasutaka, Suzuki Kyohei, Ito Keiichi, Tsugawa Shou, Yamawaki Kouhei, Takahashi Tsuyoshi, Okamoto Koji, Nishida Toshirou, Abe Ryo",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "31484543",
                    "url": "https://glygen.org/publication/PubMed/31484543"
                }
            ]
        },
        {
            "title": "Phosphoproteomic Landscaping Identifies Non-canonical cKIT Signaling in Polycythemia Vera Erythroid Progenitors.",
            "journal": "Frontiers in oncology",
            "date": "2019",
            "authors": "Federici Giulia, Varricchio Lilian, Martelli Fabrizio, Falchi Mario, Picconi Orietta, Francescangeli Federica, Contavalli Paola, Girelli Gabriella, Tafuri Agostino, Petricoin Emanuel F, Mazzarini Maria, Zeuner Ann, Migliaccio Anna Rita",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "31824842",
                    "url": "https://glygen.org/publication/PubMed/31824842"
                }
            ]
        },
        {
            "title": "TAS-116 inhibits oncogenic KIT signalling on the Golgi in both imatinib-na\u00efve and imatinib-resistant gastrointestinal stromal tumours.",
            "journal": "British journal of cancer",
            "date": "2020-03",
            "authors": "Saito Yurina, Takahashi Tsuyoshi, Obata Yuuki, Nishida Toshirou, Ohkubo Shuichi, Nakagawa Fumio, Serada Satoshi, Fujimoto Minoru, Ohkawara Tomoharu, Nishigaki Takahiko, Sugase Takahito, Koh Masahiro, Ishida Tomo, Tanaka Koji, Miyazaki Yasuhiro, Makino Tomoki, Kurokawa Yukinori, Nakajima Kiyokazu, Yamasaki Makoto, Hirota Seiichi, Naka Tetsuji, Mori Masaki, Doki Yuichiro",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "31857719",
                    "url": "https://glygen.org/publication/PubMed/31857719"
                }
            ]
        },
        {
            "title": "A shift of dynamic equilibrium between the KIT active and inactive states causes drug resistance.",
            "journal": "Proteins",
            "date": "2020-11",
            "authors": "Srikakulam Sanjay K, Bastys Tomas, Kalinina Olga V",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "32530065",
                    "url": "https://glygen.org/publication/PubMed/32530065"
                }
            ]
        },
        {
            "title": "New drugs in gastrointestinal stromal tumors.",
            "journal": "Current opinion in oncology",
            "date": "2020",
            "authors": "Martin-Broto J, Moura DS",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669921",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669921"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "32541319",
                    "url": "https://glygen.org/publication/PubMed/32541319"
                }
            ]
        },
        {
            "title": "PDGFRA, KIT, and KDR Gene Amplification in Glioblastoma: Heterogeneity and Clinical Significance.",
            "journal": "Neuromolecular medicine",
            "date": "2023-09",
            "authors": "Carlotto Bianca Soares, Trevisan Patricia, Provenzi Valentina Oliveira, Soares Fabiano Pasqualotto, Rosa Rafael Fabiano Machado, Varella-Garcia Marileila, Zen Paulo Ricardo Gazzola",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_000213",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000213"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "37610648",
                    "url": "https://glygen.org/publication/PubMed/37610648"
                }
            ]
        },
        {
            "title": "Golgi retention and oncogenic KIT signaling via PLC\u03b32-PKD2-PI4KIII\u03b2 activation in gastrointestinal stromal tumor cells.",
            "journal": "Cell reports",
            "date": "2023-09-26",
            "authors": "Obata Yuuki, Kurokawa Kazuo, Tojima Takuro, Natsume Miyuki, Shiina Isamu, Takahashi Tsuyoshi, Abe Ryo, Nakano Akihiko, Nishida Toshirou",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_000213",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000213"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "37616163",
                    "url": "https://glygen.org/publication/PubMed/37616163"
                }
            ]
        },
        {
            "title": "KIT Mutations and Other Genetic Defects in Mastocytosis: Implications for Disease Pathology and Targeted Therapies.",
            "journal": "Immunology and allergy clinics of North America",
            "date": "2023-11",
            "authors": "Chantran Yannick, Valent Peter, Arock Michel",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_000213",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000213"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "37758404",
                    "url": "https://glygen.org/publication/PubMed/37758404"
                }
            ]
        },
        {
            "title": "Novel somatic Missense Mutations in Exon 11 of the KIT Gene are Detected in Melanoma.",
            "journal": "Asian Pacific journal of cancer prevention : APJCP",
            "date": "2023-09-01",
            "authors": "Palkina Nadezhda, Tyumentseva Anna, Ruksha Tatiana",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_000213",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000213"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "37774052",
                    "url": "https://glygen.org/publication/PubMed/37774052"
                }
            ]
        },
        {
            "title": "CREB Is Indispensable to KIT Function in Human Skin Mast Cells-A Positive Feedback Loop between CREB and KIT Orchestrates Skin Mast Cell Fate.",
            "journal": "Cells",
            "date": "2023-12-24",
            "authors": "Bal G\u00fcrkan, Schneikert Jean, Li Zhuoran, Franke Kristin, Tripathi Shiva Raj, Zuberbier Torsten, Babina Magda",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_000213",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000213"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "38201246",
                    "url": "https://glygen.org/publication/PubMed/38201246"
                }
            ]
        },
        {
            "title": "Intrinsic GTPase activity distinguishes normal and oncogenic ras p21 molecules.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "1984",
            "authors": "Gibbs JB, Sigal IS, Poe M, Scolnick EM",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "6148751",
                    "url": "https://glygen.org/publication/PubMed/6148751"
                }
            ]
        },
        {
            "title": "Complementary DNA cloning and characterization of truncated form of c-kit in human colon carcinoma cells.",
            "journal": "Cancer Res.",
            "date": "1994",
            "authors": "Toyota M, Hinoda Y, Itoh F, Takaoka A, Imai K, Yachi A",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7505199",
                    "url": "https://glygen.org/publication/PubMed/7505199"
                }
            ]
        },
        {
            "title": "Characterization of the promoter region of the human c-kit proto-oncogene.",
            "journal": "Jpn. J. Cancer Res.",
            "date": "1993",
            "authors": "Yamamoto K, Tojo A, Aoki N, Shibuya M",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7506248",
                    "url": "https://glygen.org/publication/PubMed/7506248"
                }
            ]
        },
        {
            "title": "Expression of the Kit and KitA receptor isoforms in human acute myelogenous leukemia.",
            "journal": "Blood",
            "date": "1994",
            "authors": "Piao X, Curtis JE, Minkin S, Minden MD, Bernstein A",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7506952",
                    "url": "https://glygen.org/publication/PubMed/7506952"
                }
            ]
        },
        {
            "title": "Tyrosine residue 719 of the c-kit receptor is essential for binding of the P85 subunit of phosphatidylinositol (PI) 3-kinase and for c-kit-associated PI 3-kinase activity in COS-1 cells.",
            "journal": "The Journal of biological chemistry",
            "date": "1994",
            "authors": "Serve H, Hsu YC, Besmer P",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721-1",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721-1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7509796",
                    "url": "https://glygen.org/publication/PubMed/7509796"
                }
            ]
        },
        {
            "title": "Ligand-independent activation of c-kit receptor tyrosine kinase in a murine mastocytoma cell line P-815 generated by a point mutation.",
            "journal": "Blood",
            "date": "1994",
            "authors": "Tsujimura T, Furitsu T, Morimoto M, Isozaki K, Nomura S, Matsuzawa Y, Kitamura Y, Kanakura Y",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669933",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669933"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7513208",
                    "url": "https://glygen.org/publication/PubMed/7513208"
                }
            ]
        },
        {
            "title": "Modulation of Kit/stem cell factor receptor-induced signaling by protein kinase C.",
            "journal": "The Journal of biological chemistry",
            "date": "1994",
            "authors": "Blume-Jensen P, Ronnstrand L, Gout I, Waterfield MD, Heldin CH",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433559",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433559"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7520444",
                    "url": "https://glygen.org/publication/PubMed/7520444"
                }
            ]
        },
        {
            "title": "The ubiquitously expressed Syp phosphatase interacts with c-kit and Grb2 in hematopoietic cells.",
            "journal": "The Journal of biological chemistry",
            "date": "1994",
            "authors": "Tauchi T, Feng GS, Marshall MS, Shen R, Mantel C, Pawson T, Broxmeyer HE",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7523381",
                    "url": "https://glygen.org/publication/PubMed/7523381"
                }
            ]
        },
        {
            "title": "Tec kinase associates with c-kit and is tyrosine phosphorylated and activated following stem cell factor binding.",
            "journal": "Molecular and cellular biology",
            "date": "1994",
            "authors": "Tang B, Mano H, Yi T, Ihle JN",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7526158",
                    "url": "https://glygen.org/publication/PubMed/7526158"
                }
            ]
        },
        {
            "title": "Constitutively activating mutations of c-kit receptor tyrosine kinase confer factor-independent growth and tumorigenicity of factor-dependent hematopoietic cell lines.",
            "journal": "Blood",
            "date": "1995",
            "authors": "Kitayama H, Kanakura Y, Furitsu T, Tsujimura T, Oritani K, Ikeda H, Sugahara H, Mitsui H, Kanayama Y, Kitamura Y, et al.",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669935",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669935"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7530509",
                    "url": "https://glygen.org/publication/PubMed/7530509"
                }
            ]
        },
        {
            "title": "The MATK tyrosine kinase interacts in a specific and SH2-dependent manner with c-Kit.",
            "journal": "The Journal of biological chemistry",
            "date": "1995",
            "authors": "Jhun BH, Rivnay B, Price D, Avraham H",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7536744",
                    "url": "https://glygen.org/publication/PubMed/7536744"
                }
            ]
        },
        {
            "title": "Formation of signal transfer complexes between stem cell and platelet-derived growth factor receptors and SH2 domain proteins in vitro.",
            "journal": "Biochemistry",
            "date": "1995-05-02",
            "authors": "Herbst R, Shearman M S, Jallal B, Schlessinger J, Ullrich A",
            "evidence": [
                {
                    "database": "iPTMnet",
                    "id": "P10721",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7537096",
                    "url": "https://glygen.org/publication/PubMed/7537096"
                }
            ]
        },
        {
            "title": "Identification of the major phosphorylation sites for protein kinase C in kit/stem cell factor receptor in vitro and in intact cells.",
            "journal": "The Journal of biological chemistry",
            "date": "1995",
            "authors": "Blume-Jensen P, Wernstedt C, Heldin CH, Ronnstrand L",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433559",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433559"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721-1",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721-1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7539802",
                    "url": "https://glygen.org/publication/PubMed/7539802"
                }
            ]
        },
        {
            "title": "Protein kinase B (c-Akt) in phosphatidylinositol-3-OH kinase signal transduction.",
            "journal": "Nature",
            "date": "1995",
            "authors": "Burgering BM, Coffer PJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1257604",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7637810",
                    "url": "https://glygen.org/publication/PubMed/7637810"
                }
            ]
        },
        {
            "title": "Soluble c-kit proteins and antireceptor monoclonal antibodies confine the binding site of the stem cell factor.",
            "journal": "The Journal of biological chemistry",
            "date": "1993",
            "authors": "Blechman JM, Lev S, Brizzi MF, Leitner O, Pegoraro L, Givol D, Yarden Y",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7680037",
                    "url": "https://glygen.org/publication/PubMed/7680037"
                }
            ]
        },
        {
            "title": "Association of hematopoietic cell phosphatase with c-Kit after stimulation with c-Kit ligand.",
            "journal": "Molecular and cellular biology",
            "date": "1993",
            "authors": "Yi T, Ihle JN",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433559",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433559"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7684496",
                    "url": "https://glygen.org/publication/PubMed/7684496"
                }
            ]
        },
        {
            "title": "Novel mutations of the KIT (mast/stem cell growth factor receptor) proto-oncogene in human piebaldism.",
            "journal": "The Journal of investigative dermatology",
            "date": "1993",
            "authors": "Spritz RA, Holmes SA, Itin P, Kuster W",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7687267",
                    "url": "https://glygen.org/publication/PubMed/7687267"
                }
            ]
        },
        {
            "title": "Identification of mutations in the coding sequence of the proto-oncogene c-kit in a human mast cell leukemia cell line causing ligand-independent activation of c-kit product.",
            "journal": "The Journal of clinical investigation",
            "date": "1993",
            "authors": "Furitsu T, Tsujimura T, Tono T, Ikeda H, Kitayama H, Koshimizu U, Sugahara H, Butterfield JH, Ashman LK, Kanayama Y, et al.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-9669933",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669933"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7691885",
                    "url": "https://glygen.org/publication/PubMed/7691885"
                }
            ]
        },
        {
            "title": "Phosphoinositide 3-kinase inhibition spares actin assembly in activating platelets but reverses platelet aggregation.",
            "journal": "The Journal of biological chemistry",
            "date": "1995",
            "authors": "Kovacsovics TJ, Bachelot C, Toker A, Vlahos CJ, Duckworth B, Cantley LC, Hartwig JH",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1257604",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7744773",
                    "url": "https://glygen.org/publication/PubMed/7744773"
                }
            ]
        },
        {
            "title": "Identification of the guanine nucleotide dissociation stimulator for Ral as a putative effector molecule of R-ras, H-ras, K-ras, and Rap.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "1994",
            "authors": "Spaargaren M, Bischoff JR",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7809086",
                    "url": "https://glygen.org/publication/PubMed/7809086"
                }
            ]
        },
        {
            "title": "Transcriptional regulation of estrogen receptor in breast carcinomas.",
            "journal": "Molecular and cellular biology",
            "date": "1995",
            "authors": "deConinck EC, McPherson LA, Weigel RJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-8866910",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7891714",
                    "url": "https://glygen.org/publication/PubMed/7891714"
                }
            ]
        },
        {
            "title": "ralGDS family members interact with the effector loop of ras p21.",
            "journal": "Molecular and cellular biology",
            "date": "1994",
            "authors": "Kikuchi A, Demo SD, Ye ZH, Chen YW, Williams LT",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7935463",
                    "url": "https://glygen.org/publication/PubMed/7935463"
                }
            ]
        },
        {
            "title": "Activated Ras interacts with the Ral guanine nucleotide dissociation stimulator.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "1994",
            "authors": "Hofer F, Fields S, Schneider C, Martin GS",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "7972015",
                    "url": "https://glygen.org/publication/PubMed/7972015"
                }
            ]
        },
        {
            "title": "Phosphatidylinositol-3-OH kinase as a direct target of Ras.",
            "journal": "Nature",
            "date": "1994",
            "authors": "Rodriguez-Viciana P, Warne PH, Dhand R, Vanhaesebroeck B, Gout I, Fry MJ, Waterfield MD, Downward J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8052307",
                    "url": "https://glygen.org/publication/PubMed/8052307"
                }
            ]
        },
        {
            "title": "Growth factors induce nuclear translocation of MAP kinases (p42mapk and p44mapk) but not of their activator MAP kinase kinase (p45mapkk) in fibroblasts.",
            "journal": "The Journal of cell biology",
            "date": "1993",
            "authors": "Lenormand P, Sardet C, Pages G, L'Allemain G, Brunet A, Pouyssegur J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8394845",
                    "url": "https://glygen.org/publication/PubMed/8394845"
                }
            ]
        },
        {
            "title": "Human Sos1: a guanine nucleotide exchange factor for Ras that binds to GRB2.",
            "journal": "Science (New York, N.Y.)",
            "date": "1993",
            "authors": "Chardin P, Camonis JH, Gale NW, van Aelst L, Schlessinger J, Wigler MH, Bar-Sagi D",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8493579",
                    "url": "https://glygen.org/publication/PubMed/8493579"
                }
            ]
        },
        {
            "title": "JAK2 is associated with the c-kit proto-oncogene product and is phosphorylated in response to stem cell factor.",
            "journal": "Blood",
            "date": "1996",
            "authors": "Weiler SR, Mou S, DeBerry CS, Keller JR, Ruscetti FW, Ferris DK, Longo DL, Linnekin D",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8611693",
                    "url": "https://glygen.org/publication/PubMed/8611693"
                }
            ]
        },
        {
            "title": "Human stem cell factor dimer forms a complex with two molecules of the extracellular domain of its receptor, Kit.",
            "journal": "The Journal of biological chemistry",
            "date": "1996",
            "authors": "Philo JS, Wen J, Wypych J, Schwartz MG, Mendiaz EA, Langley KE",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8636116",
                    "url": "https://glygen.org/publication/PubMed/8636116"
                }
            ]
        },
        {
            "title": "Rac GTPase interacts specifically with phosphatidylinositol 3-kinase.",
            "journal": "The Biochemical journal",
            "date": "1996",
            "authors": "Bokoch GM, Vlahos CJ, Wang Y, Knaus UG, Traynor-Kaplan AE",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1257604",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8645157",
                    "url": "https://glygen.org/publication/PubMed/8645157"
                }
            ]
        },
        {
            "title": "Grap is a novel SH3-SH2-SH3 adaptor protein that couples tyrosine kinases to the Ras pathway.",
            "journal": "The Journal of biological chemistry",
            "date": "1996",
            "authors": "Feng GS, Ouyang YB, Hu DP, Shi ZQ, Gentz R, Ni J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8647802",
                    "url": "https://glygen.org/publication/PubMed/8647802"
                }
            ]
        },
        {
            "title": "Wortmannin inactivates phosphoinositide 3-kinase by covalent modification of Lys-802, a residue involved in the phosphate transfer reaction.",
            "journal": "Molecular and cellular biology",
            "date": "1996",
            "authors": "Wymann MP, Bulgarelli-Leva G, Zvelebil MJ, Pirola L, Vanhaesebroeck B, Waterfield MD, Panayotou G",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-2219530",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8657148",
                    "url": "https://glygen.org/publication/PubMed/8657148"
                }
            ]
        },
        {
            "title": "Activation of phosphoinositide 3-kinase by interaction with Ras and by point mutation.",
            "journal": "The EMBO journal",
            "date": "1996",
            "authors": "Rodriguez-Viciana P, Warne PH, Vanhaesebroeck B, Waterfield MD, Downward J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8665852",
                    "url": "https://glygen.org/publication/PubMed/8665852"
                }
            ]
        },
        {
            "title": "A 12-bp deletion (7818del12) in the c-kit protooncogene in a large Italian kindred with piebaldism.",
            "journal": "Human mutation",
            "date": "1995",
            "authors": "Riva P, Milani N, Gandolfi P, Larizza L",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8680409",
                    "url": "https://glygen.org/publication/PubMed/8680409"
                }
            ]
        },
        {
            "title": "Structure-function relationships of stem cell factor: an analysis based on a series of human-murine stem cell factor chimera and the mapping of a neutralizing monoclonal antibody.",
            "journal": "Blood",
            "date": "1996",
            "authors": "Matous JV, Langley K, Kaushansky K",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8695790",
                    "url": "https://glygen.org/publication/PubMed/8695790"
                }
            ]
        },
        {
            "title": "RalGDS-like factor (Rlf) is a novel Ras and Rap 1A-associating protein.",
            "journal": "Oncogene",
            "date": "1996",
            "authors": "Wolthuis RM, Bauer B, van 't Veer LJ, de Vries-Smits AM, Cool RH, Spaargaren M, Wittinghofer A, Burgering BM, Bos JL",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8710374",
                    "url": "https://glygen.org/publication/PubMed/8710374"
                }
            ]
        },
        {
            "title": "Epitope mapping and immunoneutralization of recombinant human stem-cell factor.",
            "journal": "European journal of biochemistry",
            "date": "1996",
            "authors": "Mendiaz EA, Chang DG, Boone TC, Grant JR, Wypych J, Aguero B, Egrie JC, Langley KE",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8774734",
                    "url": "https://glygen.org/publication/PubMed/8774734"
                }
            ]
        },
        {
            "title": "A family of AP-2 proteins regulates c-erbB-2 expression in mammary carcinoma.",
            "journal": "Oncogene",
            "date": "1996",
            "authors": "Bosher JM, Totty NF, Hsuan JJ, Williams T, Hurst HC",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-8866910",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8895516",
                    "url": "https://glygen.org/publication/PubMed/8895516"
                }
            ]
        },
        {
            "title": "Identification of a novel RalGDS-related protein as a candidate effector for Ras and Rap1.",
            "journal": "The Journal of biological chemistry",
            "date": "1996",
            "authors": "Peterson SN, Trabalzini L, Brtva TR, Fischer T, Altschuler DL, Martelli P, Lapetina EG, Der CJ, White GC 2nd",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8939933",
                    "url": "https://glygen.org/publication/PubMed/8939933"
                }
            ]
        },
        {
            "title": "Discrete protein interactions with the Grb2/c-Cbl complex in SCF- and TPO-mediated myeloid cell proliferation.",
            "journal": "Oncogene",
            "date": "1996",
            "authors": "Brizzi MF, Dentelli P, Lanfrancone L, Rosso A, Pelicci PG, Pegoraro L",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8950973",
                    "url": "https://glygen.org/publication/PubMed/8950973"
                }
            ]
        },
        {
            "title": "Phosphotyrosine-dependent activation of Rac-1 GDP/GTP exchange by the vav proto-oncogene product.",
            "journal": "Nature",
            "date": "1997",
            "authors": "Crespo P, Schuebel KE, Ostrom AA, Gutkind JS, Bustelo XR",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8990121",
                    "url": "https://glygen.org/publication/PubMed/8990121"
                }
            ]
        },
        {
            "title": "Sequence analysis of two genomic regions containing the KIT and the FMS receptor tyrosine kinase genes.",
            "journal": "Genomics",
            "date": "1997",
            "authors": "Andre C, Hampe A, Lachaume P, Martin E, Wang X P, Manus V, Hu W X, Galibert F",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9027509",
                    "url": "https://glygen.org/publication/PubMed/9027509"
                }
            ]
        },
        {
            "title": "A new c-kit mutation in a case of aggressive mast cell disease.",
            "journal": "British journal of haematology",
            "date": "1997",
            "authors": "Pignon JM, Giraudier S, Duquesnoy P, Jouault H, Imbert M, Vainchenker W, Vernant JP, Tulliez M",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9029028",
                    "url": "https://glygen.org/publication/PubMed/9029028"
                }
            ]
        },
        {
            "title": "Direct association of Csk homologous kinase (CHK) with the diphosphorylated site Tyr568/570 of the activated c-KIT in megakaryocytes.",
            "journal": "The Journal of biological chemistry",
            "date": "1997",
            "authors": "Price DJ, Rivnay B, Fu Y, Jiang S, Avraham S, Avraham H",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721-1",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721-1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9038210",
                    "url": "https://glygen.org/publication/PubMed/9038210"
                }
            ]
        },
        {
            "title": "Kit receptor dimerization is driven by bivalent binding of stem cell factor.",
            "journal": "The Journal of biological chemistry",
            "date": "1997",
            "authors": "Lemmon MA, Pinchasi D, Zhou M, Lax I, Schlessinger J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9045650",
                    "url": "https://glygen.org/publication/PubMed/9045650"
                }
            ]
        },
        {
            "title": "Activation of Jak2 catalytic activity requires phosphorylation of Y1007 in the kinase activation loop.",
            "journal": "Molecular and cellular biology",
            "date": "1997",
            "authors": "Feng J, Witthuhn BA, Matsuda T, Kohlhuber F, Kerr IM, Ihle JN",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9111318",
                    "url": "https://glygen.org/publication/PubMed/9111318"
                }
            ]
        },
        {
            "title": "Transcription factor AP-2 controls transcription of the human transforming growth factor-alpha gene.",
            "journal": "The Journal of biological chemistry",
            "date": "1997",
            "authors": "Wang D, Shin TH, Kudlow JE",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-8866910",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9162057",
                    "url": "https://glygen.org/publication/PubMed/9162057"
                }
            ]
        },
        {
            "title": "Regulation of the human chorionic gonadotropin alpha- and beta-subunit promoters by AP-2.",
            "journal": "The Journal of biological chemistry",
            "date": "1997",
            "authors": "Johnson W, Albanese C, Handwerger S, Williams T, Pestell RG, Jameson JL",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-8866910",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9182571",
                    "url": "https://glygen.org/publication/PubMed/9182571"
                }
            ]
        },
        {
            "title": "Chymase cleavage of stem cell factor yields a bioactive, soluble product.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "1997",
            "authors": "Longley BJ, Tyrrell L, Ma Y, Williams DA, Halaban R, Langley K, Lu HS, Schechter NM",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9256427",
                    "url": "https://glygen.org/publication/PubMed/9256427"
                }
            ]
        },
        {
            "title": "Lyn associates with the juxtamembrane region of c-Kit and is activated by stem cell factor in hematopoietic cell lines and normal progenitor cells.",
            "journal": "J. Biol. Chem.",
            "date": "1997",
            "authors": "Linnekin D, DeBerry CS, Mou S",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9341198",
                    "url": "https://glygen.org/publication/PubMed/9341198"
                }
            ]
        },
        {
            "title": "Stat1 associates with c-kit and is activated in response to stem cell factor.",
            "journal": "The Biochemical journal",
            "date": "1997",
            "authors": "Deberry C, Mou S, Linnekin D",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9355737",
                    "url": "https://glygen.org/publication/PubMed/9355737"
                }
            ]
        },
        {
            "title": "Gain-of-function mutations of c-kit in human gastrointestinal stromal tumors.",
            "journal": "Science (New York, N.Y.)",
            "date": "1998",
            "authors": "Hirota S, Isozaki K, Moriyama Y, Hashimoto K, Nishida T, Ishiguro S, Kawano K, Hanada M, Kurata A, Takeda M, Muhammad Tunio G, Matsuzawa Y, Kanakura Y, Shinomura Y, Kitamura Y",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9438854",
                    "url": "https://glygen.org/publication/PubMed/9438854"
                }
            ]
        },
        {
            "title": "Analysis of c-kit receptor dimerization by fluorescence resonance energy transfer.",
            "journal": "Blood",
            "date": "1998",
            "authors": "Broudy VC, Lin NL, Buhring HJ, Komatsu N, Kavanagh TJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9446650",
                    "url": "https://glygen.org/publication/PubMed/9446650"
                }
            ]
        },
        {
            "title": "Piebaldism with deafness: molecular evidence for an expanded syndrome.",
            "journal": "American journal of medical genetics",
            "date": "1998",
            "authors": "Spritz RA, Beighton P",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9450866",
                    "url": "https://glygen.org/publication/PubMed/9450866"
                }
            ]
        },
        {
            "title": "SHP-1 binds and negatively modulates the c-Kit receptor by interaction with tyrosine 569 in the c-Kit juxtamembrane domain.",
            "journal": "Molecular and cellular biology",
            "date": "1998",
            "authors": "Kozlowski M, Larose L, Lee F, Le DM, Rottapel R, Siminovitch KA",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433559",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433559"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721-1",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721-1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9528781",
                    "url": "https://glygen.org/publication/PubMed/9528781"
                }
            ]
        },
        {
            "title": "Phosphorylation of the MAP kinase ERK2 promotes its homodimerization and nuclear translocation.",
            "journal": "Cell",
            "date": "1998",
            "authors": "Khokhlatchev AV, Canagarajah B, Wilsbacher J, Robinson M, Atkinson M, Goldsmith E, Cobb MH",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9604935",
                    "url": "https://glygen.org/publication/PubMed/9604935"
                }
            ]
        },
        {
            "title": "c-kit activating mutations and mast cell proliferation in human leukemia.",
            "journal": "Blood",
            "date": "1998",
            "authors": "Beghini A, Larizza L, Cairoli R, Morra E",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9657776",
                    "url": "https://glygen.org/publication/PubMed/9657776"
                }
            ]
        },
        {
            "title": "Loss of AP-2 results in downregulation of c-KIT and enhancement of melanoma tumorigenicity and metastasis.",
            "journal": "The EMBO journal",
            "date": "1998",
            "authors": "Huang S, Jean D, Luca M, Tainsky MA, Bar-Eli M",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-8866910",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9687504",
                    "url": "https://glygen.org/publication/PubMed/9687504"
                }
            ]
        },
        {
            "title": "Familial gastrointestinal stromal tumours with germline mutation of the KIT gene.",
            "journal": "Nature genetics",
            "date": "1998",
            "authors": "Nishida T, Hirota S, Taniguchi M, Hashimoto K, Isozaki K, Nakamura H, Kanakura Y, Tanaka T, Takabayashi A, Matsuda H, Kitamura Y",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9697690",
                    "url": "https://glygen.org/publication/PubMed/9697690"
                }
            ]
        },
        {
            "title": "A novel KIT gene missense mutation in a Japanese family with piebaldism.",
            "journal": "The Journal of investigative dermatology",
            "date": "1998",
            "authors": "Nomura K, Hatayama I, Narita T, Kaneko T, Shiraishi M",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9699740",
                    "url": "https://glygen.org/publication/PubMed/9699740"
                }
            ]
        },
        {
            "title": "Phosphoinositide-3-OH kinase-dependent regulation of glycogen synthase kinase 3 and protein kinase B/AKT by the integrin-linked kinase.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "1998",
            "authors": "Delcommenne M, Tan C, Gray V, Rue L, Woodgett J, Dedhar S",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1257604",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9736715",
                    "url": "https://glygen.org/publication/PubMed/9736715"
                }
            ]
        },
        {
            "title": "Lck associates with and is activated by Kit in a small cell lung cancer cell line: inhibition of SCF-mediated growth by the Src family kinase inhibitor PP1.",
            "journal": "Cancer research",
            "date": "1998",
            "authors": "Krystal GW, DeBerry CS, Linnekin D, Litz J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-9670439",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9788619",
                    "url": "https://glygen.org/publication/PubMed/9788619"
                }
            ]
        },
        {
            "title": "Kit signaling through PI 3-kinase and Src kinase pathways: an essential role for Rac1 and JNK activation in mast cell proliferation.",
            "journal": "The EMBO journal",
            "date": "1998",
            "authors": "Timokhina I, Kissel H, Stella G, Besmer P",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                },
                {
                    "database": "iPTMnet",
                    "id": "P10721-1",
                    "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10721-1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9799234",
                    "url": "https://glygen.org/publication/PubMed/9799234"
                }
            ]
        },
        {
            "title": "Clinical correlates of the presence of the Asp816Val c-kit mutation in the peripheral blood mononuclear cells of patients with mastocytosis.",
            "journal": "Cancer",
            "date": "1998",
            "authors": "Worobec AS, Semere T, Nagata H, Metcalfe DD",
            "evidence": [
                {
                    "database": "Entrez",
                    "id": "3815",
                    "url": "https://www.ncbi.nlm.nih.gov/gene/3815"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9827716",
                    "url": "https://glygen.org/publication/PubMed/9827716"
                }
            ]
        },
        {
            "title": "Expression of AP-2 transcription factors in human breast cancer correlates with the regulation of multiple growth factor signalling pathways.",
            "journal": "Cancer research",
            "date": "1998",
            "authors": "Turner BC, Zhang J, Gumbs AA, Maher MG, Kaplan L, Carter D, Glazer PM, Hurst HC, Haffty BG, Williams T",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-8866910",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9850080",
                    "url": "https://glygen.org/publication/PubMed/9850080"
                }
            ]
        },
        {
            "title": "Gads is a novel SH2 and SH3 domain-containing adaptor protein that binds to tyrosine-phosphorylated Shc.",
            "journal": "Oncogene",
            "date": "1998",
            "authors": "Liu SK, McGlade CJ",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1433557",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9872323",
                    "url": "https://glygen.org/publication/PubMed/9872323"
                }
            ]
        },
        {
            "title": "Role of phosphatidylinositol 3,4,5-trisphosphate in regulating the activity and localization of 3-phosphoinositide-dependent protein kinase-1.",
            "journal": "The Biochemical journal",
            "date": "1999",
            "authors": "Currie RA, Walker KS, Gray A, Deak M, Casamayor A, Downes CP, Cohen P, Alessi DR, Lucocq J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-1257604",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9895304",
                    "url": "https://glygen.org/publication/PubMed/9895304"
                }
            ]
        },
        {
            "title": "Nuclear translocation of p42/p44 mitogen-activated protein kinase is required for growth factor-induced gene expression and cell cycle entry.",
            "journal": "The EMBO journal",
            "date": "1999",
            "authors": "Brunet A, Roux D, Lenormand P, Dowd S, Keyse S, Pouyssegur J",
            "evidence": [
                {
                    "database": "Reactome",
                    "id": "R-HSA-5673001",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9927426",
                    "url": "https://glygen.org/publication/PubMed/9927426"
                }
            ]
        },
        {
            "title": "Activating and dominant inactivating c-KIT catalytic domain mutations in distinct clinical forms of human mastocytosis.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "1999",
            "authors": "Longley BJ Jr, Metcalfe DD, Tharp M, Wang X, Tyrrell L, Lu SZ, Heitjan D, Ma Y",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9990072",
                    "url": "https://glygen.org/publication/PubMed/9990072"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "hsa:3815",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:3815",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-HSA-1257604",
            "name": "PIP3 activates AKT signaling",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1257604",
            "resource": "Reactome",
            "description": "PIP3 activates AKT signaling"
        },
        {
            "id": "R-HSA-1433557",
            "name": "Signaling by SCF-KIT",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433557",
            "resource": "Reactome",
            "description": "Signaling by SCF-KIT"
        },
        {
            "id": "R-HSA-1433559",
            "name": "Regulation of KIT signaling",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433559",
            "resource": "Reactome",
            "description": "Regulation of KIT signaling"
        },
        {
            "id": "R-HSA-2219530",
            "name": "Constitutive Signaling by Aberrant PI3K in Cancer",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2219530",
            "resource": "Reactome",
            "description": "Constitutive Signaling by Aberrant PI3K in Cancer"
        },
        {
            "id": "R-HSA-5673001",
            "name": "RAF/MAP kinase cascade",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5673001",
            "resource": "Reactome",
            "description": "RAF/MAP kinase cascade"
        },
        {
            "id": "R-HSA-6811558",
            "name": "PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811558",
            "resource": "Reactome",
            "description": "PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling"
        },
        {
            "id": "R-HSA-8866910",
            "name": "TFAP2 (AP-2) family regulates transcription of growth factors and their receptors",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8866910",
            "resource": "Reactome",
            "description": "TFAP2 (AP-2) family regulates transcription of growth factors and their receptors"
        },
        {
            "id": "R-HSA-9669914",
            "name": "Dasatinib-resistant KIT mutants",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669914",
            "resource": "Reactome",
            "description": "Dasatinib-resistant KIT mutants"
        },
        {
            "id": "R-HSA-9669917",
            "name": "Imatinib-resistant KIT mutants",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669917",
            "resource": "Reactome",
            "description": "Imatinib-resistant KIT mutants"
        },
        {
            "id": "R-HSA-9669921",
            "name": "KIT mutants bind TKIs",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669921",
            "resource": "Reactome",
            "description": "KIT mutants bind TKIs"
        },
        {
            "id": "R-HSA-9669924",
            "name": "Masitinib-resistant KIT mutants",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669924",
            "resource": "Reactome",
            "description": "Masitinib-resistant KIT mutants"
        },
        {
            "id": "R-HSA-9669926",
            "name": "Nilotinib-resistant KIT mutants",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669926",
            "resource": "Reactome",
            "description": "Nilotinib-resistant KIT mutants"
        },
        {
            "id": "R-HSA-9669929",
            "name": "Regorafenib-resistant KIT mutants",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669929",
            "resource": "Reactome",
            "description": "Regorafenib-resistant KIT mutants"
        },
        {
            "id": "R-HSA-9669933",
            "name": "Signaling by kinase domain mutants of KIT",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669933",
            "resource": "Reactome",
            "description": "Signaling by kinase domain mutants of KIT"
        },
        {
            "id": "R-HSA-9669934",
            "name": "Sunitinib-resistant KIT mutants",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669934",
            "resource": "Reactome",
            "description": "Sunitinib-resistant KIT mutants"
        },
        {
            "id": "R-HSA-9669935",
            "name": "Signaling by juxtamembrane domain KIT mutants",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669935",
            "resource": "Reactome",
            "description": "Signaling by juxtamembrane domain KIT mutants"
        },
        {
            "id": "R-HSA-9669936",
            "name": "Sorafenib-resistant KIT mutants",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669936",
            "resource": "Reactome",
            "description": "Sorafenib-resistant KIT mutants"
        },
        {
            "id": "R-HSA-9670439",
            "name": "Signaling by phosphorylated juxtamembrane, extracellular and kinase domain KIT mutants",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670439",
            "resource": "Reactome",
            "description": "Signaling by phosphorylated juxtamembrane, extracellular and kinase domain KIT mutants"
        },
        {
            "id": "R-HSA-9680187",
            "name": "Signaling by extracellular domain mutants of KIT",
            "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680187",
            "resource": "Reactome",
            "description": "Signaling by extracellular domain mutants of KIT"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "P05532-1",
            "protein_name": "Mast/stem cell growth factor receptor Kit",
            "gene_name": "Kit",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MRGARGAWDLLCVLLVLLRGQTATSQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIQAHTLFTPLLIGFVVAAGAMGIIVMVLTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGACTVGGPTLVITEYCCYGDLLNFLRRKRDSFIFSKQEEQAEAALYKNLLHSTEPSCDSSNEYMDMKPGVSYVVPTKTDKRRSARIDSYIERDVTPAIMEDDELALDLDDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIRNDSNYVVKGNARLPVKWMAPESIFSCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMVSPEHAPAEMYDVMKTCWDADPLKRPTFKQVVQLIEKQISDSTKHIYSNLANCNPNPENPVVVDHSVRVNSVGSSASSTQPLLVHEDA",
                "length": 979
            },
            "evidence": [
                {
                    "id": "45916777",
                    "url": "http://www.informatics.jax.org/homology/45916777",
                    "database": "MGI"
                }
            ],
            "common_name": "Mouse"
        },
        {
            "uniprot_canonical_ac": "Q63116-1",
            "protein_name": "Mast/stem cell growth factor receptor",
            "gene_name": "Kit",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MRGARGAWDLLCVLLVLLRGQTGTSQPSASPGEPSPPSIQPAQSELIVEAGDTIRLTCTDPAFVKWTFEILDVRIENKQSEWIREKAEATHTGKYTCVSGSGLRSSIYVFVRDPAVLFLVGLPLFGKEDNDALVRCPLTDPQVSNYSLIECDGKSLPTDLKFVPNPKAGITIKNVKRAYHRLCIRCAAQREGKWMRSDKFTLKVRAAIKAIPVVSVPETSHLLKEGDTFTVICTIKDVSTSVDSMWIKLNPQPQSKAQVKRNSWHQGDFNYERQETLTISSARVNDSGVFMCYANNTFGSANVTTTLKVVEKGFINIFPVKNTTVFVTDGENVDLVVEFEAYPKPEHQQWIYMNRTPTNRGEDYVKSDNQSNIRYVNELRLTRLKGTEGGTYTFLVSNSDVSASVTFDVYVNTKPEILTYDRLMNGRLQCVAAGFPEPTIDWYFCTGAEQRCTVPVPPVDVQIQNASVSPFGKLVVQSSIDSSVFRHNGTVECKASNAVGKSSAFFNFAFKGNSKEQIQPHTLFTPLLIGFVVTAGLMGIIVMVLAYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGACTVGGPTLVITEYCCYGDLLNFLRRKRDSFIFSKQEEQADAALYKNLLHSKESSCDSSNEYMDMKPGVSYVVPTKTDKRRSARIDSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIRNDSNYVVKGNARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAAMYEVMKTCWDADPLKRPTFKQVVQLIEKQISDSSKHIYSNLANCNPNPENPVVVDHSVRVNSVGSSTSSTQPLLVHEDA",
                "length": 978
            },
            "evidence": [
                {
                    "id": "45916777",
                    "url": "http://www.informatics.jax.org/homology/45916777",
                    "database": "MGI"
                }
            ],
            "common_name": "Rat"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Biological Process",
                "total": 76,
                "go_terms": [
                    {
                        "name": "Fc receptor signaling pathway",
                        "id": "GO:0038093",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038093",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "phosphorylation",
                        "id": "GO:0016310",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016310",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "Kit signaling pathway",
                        "id": "GO:0038109",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038109",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of macromolecule metabolic process",
                        "id": "GO:0010604",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010604",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of nitrogen compound metabolic process",
                        "id": "GO:0051173",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051173",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of primary metabolic process",
                        "id": "GO:0080090",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0080090",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of response to stimulus",
                        "id": "GO:0048584",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048584",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cell adhesion",
                        "id": "GO:0007155",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007155",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "axon guidance",
                        "id": "GO:0007411",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007411",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "myeloid progenitor cell differentiation",
                        "id": "GO:0002318",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002318",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of small intestine smooth muscle contraction",
                        "id": "GO:1904349",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904349",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "immature B cell differentiation",
                        "id": "GO:0002327",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002327",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "embryonic hemopoiesis",
                        "id": "GO:0035162",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035162",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "inflammatory response",
                        "id": "GO:0006954",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "signal transduction",
                        "id": "GO:0007165",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "spermatogenesis",
                        "id": "GO:0007283",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007283",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "visual learning",
                        "id": "GO:0008542",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008542",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of phospholipase C activity",
                        "id": "GO:0010863",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010863",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of cell migration",
                        "id": "GO:0030335",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030335",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "intracellular signal transduction",
                        "id": "GO:0035556",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035556",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of cell population proliferation",
                        "id": "GO:0042127",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042127",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of MAPK cascade",
                        "id": "GO:0043410",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043410",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "stem cell differentiation",
                        "id": "GO:0048863",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048863",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "detection of mechanical stimulus involved in sensory perception of sound",
                        "id": "GO:0050910",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050910",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of DNA-binding transcription factor activity",
                        "id": "GO:0051091",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051091",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction",
                        "id": "GO:0051897",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051897",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "spermatid development",
                        "id": "GO:0007286",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007286",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "actin cytoskeleton organization",
                        "id": "GO:0030036",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030036",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "erythrocyte differentiation",
                        "id": "GO:0030218",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030218",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "male gonad development",
                        "id": "GO:0008584",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008584",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of Notch signaling pathway",
                        "id": "GO:0045747",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045747",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "response to cadmium ion",
                        "id": "GO:0046686",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046686",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "protein autophosphorylation",
                        "id": "GO:0046777",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046777",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "lamellipodium assembly",
                        "id": "GO:0030032",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030032",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cell chemotaxis",
                        "id": "GO:0060326",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060326",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "hemopoiesis",
                        "id": "GO:0030097",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030097",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "B cell differentiation",
                        "id": "GO:0030183",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030183",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of cell shape",
                        "id": "GO:0008360",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008360",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "stem cell population maintenance",
                        "id": "GO:0019827",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019827",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "megakaryocyte development",
                        "id": "GO:0035855",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035855",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "ovarian follicle development",
                        "id": "GO:0001541",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001541",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of pseudopodium assembly",
                        "id": "GO:0031274",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031274",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "negative regulation of programmed cell death",
                        "id": "GO:0043069",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043069",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of receptor signaling pathway via JAK-STAT",
                        "id": "GO:0046427",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046427",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "glycosphingolipid metabolic process",
                        "id": "GO:0006687",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006687",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "digestive tract development",
                        "id": "GO:0048565",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048565",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "hematopoietic progenitor cell differentiation",
                        "id": "GO:0002244",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002244",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "pigmentation",
                        "id": "GO:0043473",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043473",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "somatic stem cell population maintenance",
                        "id": "GO:0035019",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035019",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of tyrosine phosphorylation of STAT protein",
                        "id": "GO:0042531",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042531",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "lymphoid progenitor cell differentiation",
                        "id": "GO:0002320",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002320",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cytokine-mediated signaling pathway",
                        "id": "GO:0019221",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019221",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "ectopic germ cell programmed cell death",
                        "id": "GO:0035234",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035234",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "tongue development",
                        "id": "GO:0043586",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043586",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "germ cell migration",
                        "id": "GO:0008354",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008354",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "erythropoietin-mediated signaling pathway",
                        "id": "GO:0038162",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038162",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of long-term neuronal synaptic plasticity",
                        "id": "GO:0048170",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048170",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "mast cell differentiation",
                        "id": "GO:0060374",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060374",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "mast cell proliferation",
                        "id": "GO:0070662",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070662",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "melanocyte migration",
                        "id": "GO:0097324",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097324",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "melanocyte adhesion",
                        "id": "GO:0097326",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097326",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of pyloric antrum smooth muscle contraction",
                        "id": "GO:0120072",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0120072",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of bile acid metabolic process",
                        "id": "GO:1904251",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904251",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of colon smooth muscle contraction",
                        "id": "GO:1904343",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904343",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of mast cell cytokine production",
                        "id": "GO:0032765",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032765",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "T cell differentiation",
                        "id": "GO:0030217",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030217",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of vascular associated smooth muscle cell differentiation",
                        "id": "GO:1905065",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905065",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "melanocyte differentiation",
                        "id": "GO:0030318",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030318",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "hematopoietic stem cell migration",
                        "id": "GO:0035701",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035701",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of dendritic cell cytokine production",
                        "id": "GO:0002732",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002732",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "mast cell degranulation",
                        "id": "GO:0043303",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043303",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "mast cell chemotaxis",
                        "id": "GO:0002551",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002551",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "epithelial cell proliferation",
                        "id": "GO:0050673",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050673",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of mast cell proliferation",
                        "id": "GO:0070668",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070668",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "negative regulation of reproductive process",
                        "id": "GO:2000242",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000242",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "negative regulation of developmental process",
                        "id": "GO:0051093",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051093",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 10,
                "go_terms": [
                    {
                        "name": "ATP binding",
                        "id": "GO:0005524",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "metal ion binding",
                        "id": "GO:0046872",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "transmembrane receptor protein tyrosine kinase activity",
                        "id": "GO:0004714",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004714",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cytokine binding",
                        "id": "GO:0019955",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019955",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "protease binding",
                        "id": "GO:0002020",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002020",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "protein tyrosine kinase activity",
                        "id": "GO:0004713",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004713",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "growth factor binding",
                        "id": "GO:0019838",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019838",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "protein homodimerization activity",
                        "id": "GO:0042803",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "SH2 domain binding",
                        "id": "GO:0042169",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042169",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "stem cell factor receptor activity",
                        "id": "GO:0005020",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005020",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 8,
                "go_terms": [
                    {
                        "name": "plasma membrane",
                        "id": "GO:0005886",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "fibrillar center",
                        "id": "GO:0001650",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001650",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "extracellular space",
                        "id": "GO:0005615",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cell-cell junction",
                        "id": "GO:0005911",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005911",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "receptor complex",
                        "id": "GO:0043235",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043235",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "external side of plasma membrane",
                        "id": "GO:0009897",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "acrosomal vesicle",
                        "id": "GO:0001669",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001669",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cytoplasmic side of plasma membrane",
                        "id": "GO:0009898",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009898",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "P10721",
                                "url": "https://www.uniprot.org/uniprot/P10721"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [
        {
            "name": "mast/stem cell growth factor receptor Kit N-glycosylated 1 (human)",
            "definition": "A mast/stem cell growth factor receptor Kit (human) that has been N-glycosylated at the residue equivalent to Asn-130 of the amino acid sequence represented by UniProtKB:P10721-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:P10721-1, Asn-130, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]",
            "evidence": [
                {
                    "id": "PR:000054793",
                    "database": "PRO",
                    "url": "https://proconsortium.org/app/entry/PR:000054793"
                }
            ]
        }
    ],
    "site_annotation": [
        {
            "start_pos": 130,
            "end_pos": 132,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 145,
            "end_pos": 147,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 283,
            "end_pos": 285,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 293,
            "end_pos": 295,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 300,
            "end_pos": 302,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 320,
            "end_pos": 322,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 352,
            "end_pos": 354,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 367,
            "end_pos": 369,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 463,
            "end_pos": 465,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 486,
            "end_pos": 488,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 819,
            "end_pos": 821,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 941,
            "end_pos": 943,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [
        {
            "annotation": "Autophosphorylated on tyrosine residues. KITLG/SCF binding enhances autophosphorylation. Isoform 1 shows low levels of tyrosine phosphorylation in the absence of added KITLG/SCF (in vitro). Kinase activity is down-regulated by phosphorylation on serine residues by protein kinase C family members. Phosphorylation at Tyr-568 is required for interaction with PTPN11/SHP-2, CRK (isoform Crk-II) and members of the SRC tyrosine-protein kinase family. Phosphorylation at Tyr-570 is required for interaction with PTPN6/SHP-1. Phosphorylation at Tyr-703, Tyr-823 and Tyr-936 is important for interaction with GRB2. Phosphorylation at Tyr-721 is important for interaction with PIK3R1. Phosphorylation at Tyr-823 and Tyr-936 is important for interaction with GRB7.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "10377264",
                    "url": "https://glygen.org/publication/PubMed/10377264"
                },
                {
                    "database": "PubMed",
                    "id": "9038210",
                    "url": "https://glygen.org/publication/PubMed/9038210"
                },
                {
                    "database": "PubMed",
                    "id": "20147452",
                    "url": "https://glygen.org/publication/PubMed/20147452"
                },
                {
                    "database": "PubMed",
                    "id": "19265199",
                    "url": "https://glygen.org/publication/PubMed/19265199"
                },
                {
                    "database": "PubMed",
                    "id": "21030588",
                    "url": "https://glygen.org/publication/PubMed/21030588"
                },
                {
                    "database": "PubMed",
                    "id": "12824176",
                    "url": "https://glygen.org/publication/PubMed/12824176"
                }
            ]
        },
        {
            "annotation": "Ubiquitinated by SOCS6. KIT is rapidly ubiquitinated after autophosphorylation induced by KITLG/SCF binding, leading to internalization and degradation.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "P10721",
                    "url": "https://www.uniprot.org/uniprot/P10721"
                },
                {
                    "database": "PubMed",
                    "id": "17904548",
                    "url": "https://glygen.org/publication/PubMed/17904548"
                },
                {
                    "database": "PubMed",
                    "id": "19265199",
                    "url": "https://glygen.org/publication/PubMed/19265199"
                }
            ]
        }
    ],
    "interactions": [],
    "reactions": [
        {
            "id": "10596",
            "name": "",
            "equation": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]",
            "summary": "",
            "cellular_location": "",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "Q9WUD9-1",
                "P57760-1",
                "P35739-1",
                "F1LYY7-1",
                "A0A8I6GCV6-1",
                "Q63132-1",
                "Q63117-1",
                "Q5U2X5-1",
                "Q63474-1",
                "Q4V8A3-1",
                "O08680-1",
                "O35346-1",
                "P54757-1",
                "P54758-1",
                "P54759-1",
                "P70600-1",
                "Q00495-1",
                "Q03351-1",
                "Q04589-1",
                "P06494-1",
                "P09759-1",
                "P29321-1",
                "P32577-1",
                "Q6XUX2-1",
                "Q62662-1",
                "Q62799-1",
                "Q62844-1",
                "Q62956-1",
                "Q63184-1",
                "Q63470-1",
                "Q498D6-1",
                "Q01621-1",
                "Q6P6U0-1",
                "Q63604-1",
                "P09760-1",
                "Q01986-1",
                "Q62862-1",
                "Q63572-1",
                "Q07014-1",
                "Q4KSH7-1",
                "G3V9H8-1",
                "P15127-1",
                "O08775-1",
                "P53767-1",
                "Q05030-1",
                "P55146-1",
                "Q64725-1",
                "Q63802-1",
                "Q64716-1",
                "P09215-1",
                "Q62689-1",
                "F1LM93-1",
                "P36506-1",
                "P20786-1",
                "P24062-1",
                "Q924U5-1",
                "Q63272-1",
                "B2RYC7-1",
                "P41243-1",
                "M0RDA4-1",
                "Q62838-1",
                "Q63116-1",
                "A0A8I6AM23-1",
                "P50545-1",
                "P57097-1",
                "P97523-1",
                "Q91ZT1-1",
                "D4A7W7-1",
                "F1LVI0-1",
                "E9PSY0-1",
                "A0A0G2K6M9-1",
                "F1LSN4-1",
                "F1MAJ0-1",
                "A0A0R4J8U1-1",
                "A0A8I6A5T6-1",
                "D3ZDS3-1",
                "D4ADZ5-1",
                "F1LSG7-1",
                "F1LRZ0-1",
                "D3ZBN3-1",
                "F1M0N1-1",
                "G3V6K6-1",
                "D3ZD03-1",
                "D3ZZK3-1",
                "E9PT20-1",
                "D4A584-1",
                "D3ZDH4-1",
                "A0A8I5ZVE3-1",
                "A0A8I6AWX7-1",
                "Q4KM97-1",
                "Q501W1-1",
                "B5DFD6-1",
                "Q5FVG7-1",
                "D3ZCD0-1",
                "A0A8I5ZP97-1",
                "A0A0G2JW59-1",
                "B1WC09-1",
                "Q01134-1",
                "P11980-1",
                "G3V783-1",
                "D3ZJI4-1",
                "Q4KSH6-1",
                "M0R7E7-1",
                "Q925D6-1",
                "Q9UM73-1",
                "O15146-1",
                "P42679-1",
                "P08922-1",
                "P07947-1",
                "Q12866-1",
                "P00519-1",
                "Q07912-1",
                "P42684-1",
                "Q9UF33-1",
                "P10721-1",
                "P08069-1",
                "P06239-1",
                "P04626-1",
                "P51451-1",
                "Q06187-1",
                "P51813-1",
                "Q9UIG0-1",
                "P49760-1",
                "P49761-4",
                "Q9HAZ1-1",
                "P49759-1",
                "P07333-1",
                "Q5JZY3-1",
                "Q6XUX3-1",
                "P00533-1",
                "Q9Y463-1",
                "P29317-1",
                "Q9NR20-1",
                "Q13627-1",
                "P54760-1",
                "P41240-1",
                "Q16832-1",
                "Q15375-1",
                "P29323-1",
                "P22455-1",
                "P16591-1",
                "P29322-1",
                "P54756-1",
                "P29320-1",
                "Q08345-1",
                "Q92630-1",
                "P54753-1",
                "Q15303-1",
                "P21860-1",
                "Q14289-1",
                "O43781-1",
                "P54764-1",
                "P19525-1",
                "P21709-1",
                "P54762-1",
                "P22607-1",
                "P21802-1",
                "P52333-1",
                "P11362-1",
                "P42685-1",
                "P06213-1",
                "P14616-1",
                "Q05655-1",
                "Q08881-1",
                "P07332-1",
                "P08631-1",
                "P29376-1",
                "Q05397-1",
                "O60674-1",
                "P23458-1",
                "P36888-1",
                "P09769-1",
                "P06241-1",
                "P43405-1",
                "P07948-1",
                "P46734-1",
                "P45985-1",
                "Q02750-1",
                "P52564-1",
                "O14733-1",
                "Q13163-1",
                "Q16288-1",
                "P36507-1",
                "Q16620-1",
                "P08581-1",
                "P04629-1",
                "Q14680-1",
                "Q01974-1",
                "P09619-1",
                "P07949-1",
                "Q504Y2-1",
                "P34925-1",
                "P16234-1",
                "Q13882-1",
                "Q04912-1",
                "O43353-1",
                "Q06418-1",
                "P30530-1",
                "Q96KB5-1",
                "Q15569-1",
                "Q96S53-1",
                "Q6J9G0-1",
                "P42680-1",
                "P35916-2",
                "P0C1S8-1",
                "P17948-1",
                "P29597-1",
                "P42681-1",
                "P35590-1",
                "Q13470-1",
                "P33981-1",
                "P30291-1",
                "P12931-1",
                "P35968-1",
                "P43403-1",
                "O75716-1",
                "Q02763-1",
                "Q9H3Y6-1",
                "P35790-1",
                "P14618-1",
                "P24604-1",
                "Q9Z188-1",
                "P35969-1",
                "P52332-1",
                "P08923-1",
                "Q00342-1",
                "Q62120-1",
                "Q4JIM5-1",
                "P97504-1",
                "P42682-1",
                "Q60629-1",
                "O54967-1",
                "P00520-1",
                "P97793-1",
                "P16277-1",
                "O35491-1",
                "O35492-1",
                "O35493-1",
                "Q9Z277-1",
                "P35991-1",
                "P22518-1",
                "Q8BYG9-1",
                "P54754-1",
                "P54761-1",
                "Q6XUX1-1",
                "Q62371-1",
                "Q60750-1",
                "Q61527-1",
                "Q62413-1",
                "Q61214-1",
                "Q61772-1",
                "Q61851-1",
                "Q922Y0-1",
                "Q922K9-1",
                "O09127-1",
                "P16092-1",
                "Q03142-1",
                "P29319-1",
                "Q01279-1",
                "P70424-1",
                "P21803-1",
                "Q8CBF3-1",
                "P41241-1",
                "Q03963-1",
                "Q8BI55-1",
                "P54763-3",
                "P16879-1",
                "P09581-1",
                "P34152-3",
                "P14234-1",
                "P39688-1",
                "Q03146-1",
                "Q03145-1",
                "Q61526-1",
                "P70451-1",
                "Q5U4C9-1",
                "Q9QVP9-1",
                "Q03137-1",
                "Q60751-1",
                "Q62137-1",
                "P28867-1",
                "P25911-1",
                "P48025-1",
                "Q9WTL4-1",
                "P41242-1",
                "P05532-1",
                "P06240-1",
                "P08103-1",
                "P15208-1",
                "Q03526-1",
                "Q9WVS7-1",
                "P70236-1",
                "P31938-1",
                "P47809-1",
                "Q61846-1",
                "Q60805-1",
                "Q63932-1",
                "O09110-1",
                "P26618-1",
                "Q8CE90-1",
                "P16056-1",
                "P05622-1",
                "P15209-1",
                "Q6VNS1-1",
                "Q61006-1",
                "Q3UFB7-1",
                "Q5RJI4-1",
                "Q9JJ78-1",
                "P58801-1",
                "Q8VCT9-1",
                "O70146-1",
                "Q62190-1",
                "Q62270-1",
                "P35546-1",
                "P35761-1",
                "Q9Z138-1",
                "Q9R117-1",
                "O88697-1",
                "P05480-2",
                "Q01887-1",
                "Q02858-1",
                "Q06806-1",
                "Q00993-1",
                "Q64434-1",
                "Q6J9G1-1",
                "Q99ML2-1",
                "Q78DX7-1",
                "P55144-1",
                "P43404-1",
                "P35917-1",
                "P47810-1",
                "P35918-1",
                "Q04736-1",
                "Q66JT0-1",
                "O54804-1",
                "P52480-1",
                "P14680-1",
                "P21965-1",
                "P22216-1",
                "P32490-1",
                "P06784-1",
                "P08018-1",
                "P32350-1",
                "P32491-1",
                "P54199-1",
                "Q54G28-1",
                "Q54N73-1",
                "Q54R58-1",
                "P18160-1",
                "P18161-1",
                "Q54BC9-1",
                "Q54I36-1",
                "Q54QV3-1",
                "Q552C6-1",
                "Q55CL6-1",
                "Q75JK0-1",
                "Q76NV1-1",
                "Q23977-1",
                "P18475-1",
                "P13368-1",
                "Q24145-1",
                "Q24488-1",
                "Q27324-1",
                "P08630-1",
                "P00522-1",
                "P00528-1",
                "P04412-1",
                "Q9V422-1",
                "Q9V6K3-1",
                "Q9V9J3-1",
                "Q9VBW3-1",
                "P09208-1",
                "P49762-1",
                "P83102-1",
                "Q24324-1",
                "Q9VPC0-1",
                "P49657-1",
                "P54350-1",
                "P18106-4",
                "Q07407-1",
                "Q09147-1",
                "Q24592-1",
                "Q9I7F7-1",
                "Q9V3D5-1",
                "Q9VZI2-1",
                "Q8INJ8-1",
                "Q7KJ08-1",
                "Q9VJ04-1",
                "E1JHB7-1",
                "Q9VE06-1",
                "O61444-1",
                "O62602-1",
                "Q9VZA8-1",
                "Q7KT06-1"
            ],
            "evidence": [
                {
                    "id": "10596",
                    "database": "Rhea",
                    "url": "https://www.rhea-db.org/rhea/10596"
                }
            ]
        },
        {
            "id": "R-HSA-1433410",
            "name": "SOCS1 as a regulator of KIT signaling",
            "equation": "",
            "summary": "SOCS1 has been identified as a KIT binding partner from the yeast two-hybrid system (Sepulveda et al, 1999). SOCS1 expression is induced upon KIT activation. It associates with KIT via its SH2 domain. SOCS1 does not inhibit KIT kinase activity directly, instead it binds to GRB2 and VAV1, and selectively inhibits SCF-induced proliferation, while not effecting survival signal (Sepulveda et al, 1999). It has been proposed that SOCS1 may interrupt signal transduction pathways downstream of JAK2 (Sepulveda et al, 1999).",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1433410",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433410"
                }
            ]
        },
        {
            "id": "R-HSA-1433418",
            "name": "Phosphorylation of JAK2",
            "equation": "",
            "summary": "SCF induces rapid and transient autophosphorylation of JAK2 bound to c-KIT. JAKs bound to activated, dimerized receptors cross-phosphorylate and thereby activate each other. Multiple phosphorylation sites have been identified in JAK2 (tyrosines 221, 570, 868, 966, 972, 1007 and 1008 ). Phosphorylation of tyrosine 1007 is essential for kinase activity (Feng et al 1997, Argetsinger et al. 2004, 2010). Tyrosine 1007 is in the activation loop and phosphorylation allows access of the catalytic loop to the ATP in the ATP binding domain. Of all the predicted phoshorylation sites only the critical tyrosine 1007 is represented in the reaction.",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "O60674-1",
                "P06241-1",
                "P10721-1",
                "P06239-1",
                "P07947-1",
                "P07948-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1433418",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433418"
                }
            ]
        },
        {
            "id": "R-HSA-1433423",
            "name": "PTP-RO interacts with p-c-Kit complex",
            "equation": "",
            "summary": "Tyrosine phosphatase PTPRO associates constitutively with c-Kit independently of SCF stimulation. PTPRO undergoes phosphorylation upon SCF stimulation. The PTPRO binding site on c-Kit and the molecular mechanism by which c-Kit signaling is regulated by PTPRO have not been determined.",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1",
                "Q92729-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1433423",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433423"
                }
            ]
        },
        {
            "id": "R-HSA-1433428",
            "name": "GRB2 is indirectly recruited to p-KIT through SHP2",
            "equation": "",
            "summary": "GRB2 can be recruited indirectly to KIT through SHP2 (Tauchi et al. 1994). Y279, Y304, Y546 and Y584 (usually referred to as Y542 and Y580 in literature based on the SHP2 short isoform) are the potential sites of SHP2 tyrosyl phosphorylation and that Y546 is the major GRB2 binding site (Feng, et al. 1993, Araki, et al. 2003). This brings Grb2:SOS1 into proximity with the plasma membrane, where it can activate Ras.",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P06241-1",
                "P10721-1",
                "P06239-1",
                "P07947-1",
                "P07948-1",
                "Q06124-2"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1433428",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433428"
                }
            ]
        },
        {
            "id": "R-HSA-1433451",
            "name": "JAK2 binds to p-KIT",
            "equation": "",
            "summary": "Janus kinase 2 (JAK2) plays an important role in SCF-induced proliferation (Radosevic et al. 2004). JAK2 was observed to pre-associate with KIT, with increased association after SCF stimulation of KIT (Weiler et al. 1996).",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "O60674-1",
                "P06241-1",
                "P10721-1",
                "P06239-1",
                "P07947-1",
                "P07948-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1433451",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433451"
                }
            ]
        },
        {
            "id": "R-HSA-1433454",
            "name": "Phosphorylation of GAB2 by SFKs",
            "equation": "",
            "summary": "GAB2 bound to GRB2 on KIT is then phosphorylated on a number of tyrosine residues through the action of Src family kinases (SFKs).",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P06241-1",
                "P10721-1",
                "P06239-1",
                "P07947-1",
                "P07948-1",
                "Q06124-2"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1433454",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433454"
                }
            ]
        },
        {
            "id": "R-HSA-1433456",
            "name": "Recruitment of STATs",
            "equation": "",
            "summary": "Activation of KIT mediates the recruitment of and association with STAT1alpha, STAT3, STAT5A and STAT5B (Deberry et al. 1997, Brizzi et al. 1999, R\u00f6nnstrand 2004).",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "O60674-1",
                "P06241-1",
                "P10721-1",
                "P06239-1",
                "P07947-1",
                "P07948-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1433456",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433456"
                }
            ]
        },
        {
            "id": "R-HSA-1433471",
            "name": "Activation of RAS by p-KIT bound SOS1",
            "equation": "",
            "summary": "Once recruited to the membrane in response to c-Kit stimulation, Son of sevenless (SOS1) activates the small GTPase protein RAS. SOS1 is a dual specificity guanine nucleotide exchange factor (GEF) that regulates both Ras and Rho family GTPases. SOS1 activates RAS by binding, which induces a  conformational change that causes the exchange of GDP for GTP. RAS proteins are membrane-bound GTPases that regulate crucial cellular processes such as growth, proliferation and differentiation. Active RAS-GTP stimulates multiple effector proteins such as RAF-1, which induce a variety of cellular responses including initiation of mitogen activated protein kinase (MAPK) cascade signaling.",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P01111-1",
                "P10721-1",
                "P01112-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1433471",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433471"
                }
            ]
        },
        {
            "id": "R-HSA-1433488",
            "name": "Phosphorylation of SHP2 by SFKs",
            "equation": "",
            "summary": "Following association with KIT, Tauchi et al. had observed phosphorylation of SHP2 (Tauchi et al. 1994). Tyrosine residues Y546 and Y584 (usually referred to as Y542 and Y580 in literature based on the  short isoform) are the major sites of SHP2 tyrosyl phosphorylation. Src family kinases (SFKs) are candidates for this phosphorylation (Araki et al. 2003). The phosphorylated tyrosine residues on SHP2 can recruit the adapter protein GRB2 (Tauchi et al. 1994), but it is unclear whether GRB2 binding to SHP2 is important for KIT mediated SHP2 signaling or whether the effect of SHP2 on the RAS/ERK pathway goes through its catalytic activity.",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P06241-1",
                "P10721-1",
                "P06239-1",
                "P07947-1",
                "P07948-1",
                "Q06124-2"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1433488",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433488"
                }
            ]
        },
        {
            "id": "R-HSA-1433501",
            "name": "Interaction of other adapter proteins with p-KIT",
            "equation": "",
            "summary": "Adapter proteins GADS, GRAP, GRB7 and GRB10 interact with activated KIT (Liu & McGlade 1998, Feng et al. 1996, Th\u00f6mmes et al. 1999, Jahn et al. 2002).",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1433501",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433501"
                }
            ]
        },
        {
            "id": "R-HSA-1433506",
            "name": "Phosphorylation of APS",
            "equation": "",
            "summary": "APS bound to KIT is phosphorylated by tyrosine kinases in response to SCF stimulation (Wollberg et al, 2003). The C-terminal tyrosine 629 may be the target site of phosphorylation in APS (Wakioka et al, 1999).",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P06241-1",
                "P10721-1",
                "P06239-1",
                "P07947-1",
                "P07948-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1433506",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433506"
                }
            ]
        },
        {
            "id": "R-HSA-1433508",
            "name": "PKC alpha interacts with and phosphorylates KIT",
            "equation": "",
            "summary": "Protein kinase C (PKC) alpha phosphorylates and regulates the activity of several receptor tyrosine kinases  including KIT. PKC alpha is involved in a negative feedback loop regulating SCF induced proliferation by phosphorylating and inhibiting the kinase activity of KIT (Blume-Jensen et al. 1994, 1995). PKC alpha phosphorylates KIT on S741 and S746 of the kinase insert (Blume-Jensen et al. 1995). This serine phosphorylation inhibits KIT kinase activity and reduces the capacity of multiple SH2 containing signaling components to associate with KIT (Linnekin 1999).",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [
                "R-HSA-197662",
                "R-HSA-58196"
            ],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1",
                "P17252-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1433508",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433508"
                }
            ]
        },
        {
            "id": "R-HSA-1433514",
            "name": "Synthesis of PIP3 from PIP2 by PI3K",
            "equation": "",
            "summary": "PI3 kinases catalyze the production of phosphatidylinositol-3, 4, 5-triphosphate (PIP3) by phosphorylating phosphatidylinositol-4, 5-bisphosphate (PIP2). PIP3 bound to the inner lipid bilayer of the plasma membrane promotes the recruitment and activation of AKT. Active AKT subsequently phosphorylates the pro-apoptotic factor BAD at Ser136. Phosphorylated BAD binds 14-3-3 proteins, sequestering BAD from interaction with the anti-apoptotic molecule BCL-XL and leaving BCL-Xl free to inhibit BAX-triggered apoptosis. In this way, AKT-mediated BAD phosphorylation promotes cell survival. The alternative route for c-Kit mediated survival is through AKT-mediated phosphorylation and inactivation of the forkhead transcription factor (FoxO3a) (Engstrom et al, 2003; Lennartson et al, 2005).",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P42336-1",
                "P06241-1",
                "P10721-1",
                "P06239-1",
                "P07947-1",
                "P07948-1",
                "Q06124-2"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1433514",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433514"
                }
            ]
        },
        {
            "id": "R-HSA-1433542",
            "name": "Phosphorylation and activation of VAV1",
            "equation": "",
            "summary": "The Src and PI3-kinase signaling pathways converge to activate Rac1 and JNK after c-Kit activation, promoting mast cell proliferation but not for suppression of apoptosis (Timokhina et al. 1998). PI3K and Src are considered mediators of c-Kit induced  Rac1 activation via the guanine nucleotide exchange factor (GEF) VAV1. Stimulation of c-Kit receptor results in rapid tyrosine phosphorylation of VAV1 (Timokhina et al. 1998). <br>VAV1 exists in an auto-inhibitory state folded in such a way as to inhibit the GEF activity of its Dbl homology domain (DH) domain. PI3K is thought to modulate the activation of VAV1 by influencing its degree of tyrosine phosphorylation and its recruitment to membrane. VAV1 is recruited to membrane by binding to PtdIns(3,4,5)P3 (PIP3) and this interaction relieves an intramolecular interaction between pleckstrin homology (PH) and DH domains, thus facilitating tyrosine phosphorylation on Y174 and so further opening of the DH/PH domains, binding of Rac-GDP and catalysis (Welch et al, 2003). In VAV1, tyrosine 174 (Y174) binds to the DH domain and inhibits its GEF activity. Src kinases phosphorylate this Y174 and this causes the tyrosine to move away from the DH domain thereby reliving the auto-inhibition.",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [
                "R-HSA-195066"
            ],
            "output_participant_list": [],
            "enzyme_list": [
                "P06241-1",
                "P10721-1",
                "P06239-1",
                "P07947-1",
                "P07948-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1433542",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1433542"
                }
            ]
        },
        {
            "id": "R-HSA-1470009",
            "name": "Phosphorylation of STATs",
            "equation": "",
            "summary": "JAK2 activation results in the phosphorylation and activation of STAT1alpha, STAT3, STAT5A and STAT5B (Deberry et al. 1997, Brizzi et al. 1999, Ning et al. 2001, Ronnstrand 2004). STAT family members can be activated by JAK kinases, receptor tyrosine kinases or SFKs. LYN kinase has been identified to have role in SCF-induced phosphorylation of STAT3 (Shivakrupa & Linnekin 2005).",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "O60674-1",
                "P06241-1",
                "P10721-1",
                "P06239-1",
                "P07947-1",
                "P07948-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1470009",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1470009"
                }
            ]
        },
        {
            "id": "R-HSA-1470010",
            "name": "Dimerization of STATs",
            "equation": "",
            "summary": "Phosphorylation on tyrosine residues immediately distal to the SH2 domain induces STATs homo- or heterodimerization through phosphotyrosine-SH2 interactions.",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "O60674-1",
                "P06241-1",
                "P10721-1",
                "P06239-1",
                "P07947-1",
                "P07948-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1470010",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1470010"
                }
            ]
        },
        {
            "id": "R-HSA-1470011",
            "name": "Downregulation of c-Kit signaling by SOCS6",
            "equation": "",
            "summary": "SOCS6 protein interacts with the phosphorylated Y568 in the juxtamembrane domain of c-Kit following SCF-stimulated tyrosine phosphorylation. Binding of SOCS6 to Y568 may mask this docking site for Src family kinases and this may inhibit the phosphorylation of p38 and ERK. This negatively regulates c-Kit receptor proliferation signal but not SCF-induced chemotaxis (Bayle et al. 2004, Zadjali et al 2011). Binding of SOCS6 mediates recruitment of elongin B and C to form a ubiquitin E3 ligase complex that leads to ubiquitination of KIT and its degradation (Zadjali et al 2011).",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1470011",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1470011"
                }
            ]
        },
        {
            "id": "R-HSA-1470012",
            "name": "Disassociation and translocation of STATs to the nucleus",
            "equation": "",
            "summary": "After dimerization STAT dimers release from the receptor complex and migrate to the nucleus for DNA binding. STAT5s/STAT1alpha heterodimeric complexes specifically recognize beta-casein promoter region (PIE) (Brizzi et al. 1999). c-Kit dependent JAK/STAT activation is associated with the growth and differentiation of fetal liver haematopoietic progenitor cells (R\u00f6nnstrand 2004, Reber et al. 2006).",
            "cellular_location": "cytosol, extracellular region, nucleoplasm, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "O60674-1",
                "P06241-1",
                "P10721-1",
                "P06239-1",
                "P07947-1",
                "P07948-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1470012",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1470012"
                }
            ]
        },
        {
            "id": "R-HSA-1472121",
            "name": "Phosphorylation of p-KIT on Y900 by Src kinases",
            "equation": "",
            "summary": "Src family of tyrosine kinases phosphorylate KIT on Y900 located in the second part of the tyrosine kinase domain. This phosphorylated tyrosine acts as a docking site for p85alpha regulatory subunit of PI3K and the adapter protein CRKII. CRKII does not interact directly with KIT but is recruited indirectly by binding to p85alpha subunit of PI3K. Thus, in this case the p85 subunit acts as an adapter between KIT and CRKII, and not to recruit PI3-kinase. (Lennartsson et al. 2003).",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P06241-1",
                "P10721-1",
                "P06239-1",
                "P07947-1",
                "P07948-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1472121",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1472121"
                }
            ]
        },
        {
            "id": "R-HSA-1562640",
            "name": "LNK binds to p-KIT and inhibit downstream signaling",
            "equation": "",
            "summary": "The adaptor protein LNK with its SH2 domain binds to the juxtamembrane domain (amino acids 544-577) of KIT on Y568 and inhibit the downstream signalling (Gueller et al. 2008).",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1562640",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1562640"
                }
            ]
        },
        {
            "id": "R-HSA-1562641",
            "name": "Indirect recruitment of PI3K to KIT via p(Y)-GAB2",
            "equation": "",
            "summary": "Phosphorylated GAB2 recruits the p85 subunit of the PI3K complex and activates the PI3K/AKT pathway. This is one of two mechanisms described for the recruitment of PI3K to KIT.",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P42336-1",
                "P06241-1",
                "P10721-1",
                "P06239-1",
                "P07947-1",
                "P07948-1",
                "Q06124-2"
            ],
            "evidence": [
                {
                    "id": "R-HSA-1562641",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1562641"
                }
            ]
        },
        {
            "id": "R-HSA-205205",
            "name": "Interaction of Src family kinases with p-KIT",
            "equation": "",
            "summary": "Binding of SCF to KIT induces the activation and rapid increase in kinase activity of multiple Src family kinases (SFK), including Src, Lck, Tec, Fyn, and Lyn (Timokhina et al. 1998, Krystal et al. 1998, Linnekin et al. 1997, Lennartsson et al. 1999, Tang et al. 1994, Samayawardhena et al. 2007). The tyrosine residues Y568 and Y570 in KIT juxtamembrane region are involved in the association of SFKs (Price et al. 1997). <br>SFKs recruited to KIT induce proliferation and chemotaxis in primary hematopoietic progenitor cells or bone marrow derived mast cells (O'Laughlin-Bunner et al. 2001). SCF activated SFKs also mediate a critical signal for lymphocyte development (Agosti et al. 2004). Timokhina et al. demonstrated that Src kinase and PI3-kinase signaling pathways converge to activate Rac1 and JNK after SCF stimulation in BMMC, promoting cell proliferation (Timokhina et al., 1998, Reber et al. 2006 ).",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P06241-1",
                "P10721-1",
                "P06239-1",
                "P07947-1",
                "P07948-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-205205",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-205205"
                }
            ]
        },
        {
            "id": "R-HSA-205231",
            "name": "Dimerization of KIT upon SCF binding",
            "equation": "",
            "summary": "Binding of the SCF dimer to KIT rapidly triggers KIT dimerization and autophosphorylation. It is thought that one SCF dimer binds simultaneously to two KIT monomers. The fourth Ig-like domain of KIT contains the dimerisation site; deletion of this domain completely abolishes KIT dimerisation and subsequent downstream signaling (Edling et al. 2007, Blechman et al. 1995). KIT dimerization is a crucial initial step in the SCF signal transduction process.",
            "cellular_location": "extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-205231",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-205231"
                }
            ]
        },
        {
            "id": "R-HSA-205234",
            "name": "Indirect recruitment of GAB2 to p-KIT",
            "equation": "",
            "summary": "The scaffolding adapter GAB2 plays a role in KIT dependent PI3K/AKT activation. GAB2 interacts with KIT indirectly via the adapter protein GRB2 which is bound to KIT on phosphorylated Y703 and Y936 (Sun et al. 2008, Yu et al. 2006).",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P06241-1",
                "P10721-1",
                "P06239-1",
                "P07947-1",
                "P07948-1",
                "Q06124-2"
            ],
            "evidence": [
                {
                    "id": "R-HSA-205234",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-205234"
                }
            ]
        },
        {
            "id": "R-HSA-205238",
            "name": "SHP2 interacts with p-KIT",
            "equation": "",
            "summary": "SHP2 is a protein tyrosine phosphatase (PTP) with two NH2-terminal SH2 domains, a PTP domain, a -COOH tail with two tyrosyl phosphorylation sites at Y546 and Y584, and an interposed proline-rich domain. SHP2 binds to activated KIT on tyrosine-568 in the juxtamembrane region, which also constitutes the docking site for a number of other signal transduction molecules, such as SFKs, Csk homologous kinase (CHK), CBL, LNK and Adapter protein with PH and SH2 domains (APS) (Kozlowski et al. 1998, Price et al. 1997, Gueller et al. 2008).",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P06241-1",
                "P10721-1",
                "P06239-1",
                "P07947-1",
                "P07948-1",
                "Q06124-2"
            ],
            "evidence": [
                {
                    "id": "R-HSA-205238",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-205238"
                }
            ]
        },
        {
            "id": "R-HSA-205244",
            "name": "Recruitment of CBL to KIT",
            "equation": "",
            "summary": "The phosphotyrosine residue in APS creates a putative binding site for CBL. CBL is an ubiquitin E3 ligase that attaches ubiquitin to KIT leading to KIT's ubiquitination followed by internalization and degradation. GRB2 in addition to its role in positive signaling via RAS/ERK pathway also mediates negative regulation of KIT by recruiting CBL (Sun et al, 2007). CBL has also been shown to bind directly to both Y568 and Y936 in KIT (Masson et al.  2006). CBL bound to KIT ubiquitinates KIT and targets it to lysosomal degradation (Masson et al. 2006)",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P06241-1",
                "P10721-1",
                "P22681-1",
                "P06239-1",
                "P07947-1",
                "P07948-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-205244",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-205244"
                }
            ]
        },
        {
            "id": "R-HSA-205262",
            "name": "Direct recruitment of PI3K to p-KIT",
            "equation": "",
            "summary": "The regulatory subunit (p85) of PI3K interacts directly with phosphorylated Y721 of KIT via one of its SH2 domains. This binding leads to the activation of the catalytic domain (p110) of PI3K. SCF-induced PI3K recruitment mediates AKT activation through phospholipids at the membrane and to subsequent phosphorylation of the pro-apoptotic factor Bad as well as Fox3a.<br>PI3K activation mediates SCF-induced cell proliferation, survival, differentiation, adhesion, secretion and actin cytoskeletal organization.",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P42336-1",
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-205262",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-205262"
                }
            ]
        },
        {
            "id": "R-HSA-205286",
            "name": "GRB2:SOS interacts with p-KIT",
            "equation": "",
            "summary": "GRB2 is an adapter protein with one SH2 domain and two SH3 domains.  It exists in part as a preformed complex with the RAS GDP/GTP exchanger SOS. GRB2 with its SH2 domain binds directly to activated KIT on autophosphorylated sites Y703 and Y936 (Thommes et al. 1999). GRB2 can also be recruited indirectly to KIT by binding KIT downstream signal transduction molecules such as SHP 2, SHC1, GAB1 and GAB2 (R\u00f6nnstrand 2004, Linnekin 1999). GRB2:SOS complex bound to KIT then activates the small GTPase protein RAS. It should be noted that not all GRB2 interactions with KIT involve an activation of RAS; GRB2 can also act as an adapter protein for recruiting both GAB2 (Sun et al. 2008) and CBL (Sun et al. 2007) to KIT.",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-205286",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-205286"
                }
            ]
        },
        {
            "id": "R-HSA-205289",
            "name": "Autophosphorylation of KIT",
            "equation": "",
            "summary": "The cytoplasmic domain of KIT contains a bipartite kinase domain separated by 77 residues. The first part of the catalytic domain contains the ATP binding region while the second part contains an activation loop. Both parts of the domain have a number of possible autophosphorylation sites. In contrast to many other tyrosine kinases, autophosphorylation of the activation loop does not seem to be involved in the activation of the kinase activity nor it is required for full kinase activity (DiNitto et al. 2010). Instead, phosphorylation sites in the juxtamembrane region are important for activation of the kinase activity. The dimerized KIT acts as both enzyme and substrate for itself and autophosphorylates these specific tyrosine residues with in the kinases domains in trans as well as tyrosine residues outside the kinase domain. The resulting phosphotyrosine residues serve as docking sites for a number of signal transduction molecules containing Src-homology 2 (SH2) and phosphotyrosine-binding (PTB) domains. A majority of the autophosphorylation sites reside outside the kinase domain.",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1",
                "P17252-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-205289",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-205289"
                }
            ]
        },
        {
            "id": "R-HSA-205306",
            "name": "Interaction of SHP1 and KIT",
            "equation": "",
            "summary": "The protein tyrosine phosphatase SHP-1 negatively regulates KIT signaling through binding to phosphorylated Y570. It is unclear whether SHP1 directly dephosphorylates KIT or elicits dephosphorylation of the receptor indirectly by dephosphorylating and inhibiting cytosolic PTKs that act on KIT. SHP-1 may also compete with and displace SFKs or other proteins that dock to phosphorylated Y570 (Kozlowski et al, 1998).",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1",
                "P29350-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-205306",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-205306"
                }
            ]
        },
        {
            "id": "R-HSA-205319",
            "name": "Interaction of APS and p-KIT",
            "equation": "",
            "summary": "APS adapter protein has been identified as a KIT binding partner using yeast two-hybrid screening. APS contains a PH domain and an SH2 domain. The SH2 domain interacts with c-Kit phosphotyrosine residues Y568 and Y936 (Wollberg et al. 2003).",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P06241-1",
                "P10721-1",
                "P06239-1",
                "P07947-1",
                "P07948-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-205319",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-205319"
                }
            ]
        },
        {
            "id": "R-HSA-205321",
            "name": "Interaction of KIT and sSCF",
            "equation": "",
            "summary": "Two human isoforms of KIT have been identified, resulting from alternative splicing. They are characterized by the presence or absence of a tetrapeptide sequence (GNNK 510-513 aa) in the extracellular part of the juxtamembrane region and designated GNNK+ (Kit) or GNNK- (KitA) (Piao et al. 1994). The isoforms are co-expressed in most tisuues, with the GNNK- form predominating (Reith et al. 1991). No difference in ligand affinity was observed (Caruana et al. 1999). <br>KIT belongs to the type III tyrosine kinase receptor family, with five extracellular immunoglobulin (Ig)-like domains, a single transmembrane region, an inhibitory cytoplasmic juxtamembrane domain, and a split cytoplasmic kinase domain separated by a kinase insert segment and a cytoplasmic tail (Mol et al. 2003). <br>Signaling by KIT occurs following SCF binding. SCF homodimers binds to the first three Ig-like domains of KIT in the regions between aa L104-D122 and R146-D153 (Mendiaz et al. 1996, Matous et al. 1996) which leads to dimerization which is further stabilized  by Ig-like domains 3-4 (Yuzawa et al., 2007).",
            "cellular_location": "extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-205321",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-205321"
                }
            ]
        },
        {
            "id": "R-HSA-205328",
            "name": "Interaction of other tyrosine kinases with p-KIT",
            "equation": "",
            "summary": "Cytoplasmic tyrosine kinases such as CHK1 (Csk homologous kinase or MATK), FER and FES associate with p-KIT upon SCF stimulation (Price et al, 19997; Jhun et al, 1995; Craig AW, Greer PA, 2002). TEC has been demonstrated to associate with KIT constitutively and is activated by ligand stimulation (Tang et a l. 1994).",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1",
                "O14757-1",
                "P07332-1",
                "P42680-1",
                "P16591-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-205328",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-205328"
                }
            ]
        },
        {
            "id": "R-HSA-2316434",
            "name": "PI3K phosphorylates PIP2 to PIP3",
            "equation": "",
            "summary": "A number of different extracellular signals converge on PI3K activation. PI3K can be activated downstream of receptor tyrosine kinases (RTKs) such as FGFR (Ong et al. 2001, Eswarakumar et al. 2005), KIT (Chian et al. 2001, Ronnstrand 2004, Reber et al. 2006), PDGF (Coughlin et al. 1989, Fantl et al. 1992, Heldin et al. 1998), insulin receptor IGF1R (Hadari et al. 1992, Kooijman et al. 1995), and EGFR and its family members (Rodrigues et al. 2000, Jackson et al. 2004, Kainulainen et al. 2000, Junttila et al. 2009). Other proteins, such as CD28 (Pages et al. 1996, Koyasu 2003, Kane and Weiss, 2003) and TRAT1 (Bruyns et al. 1998, Koyasu 2003, Kolsch et al. 2006), can also trigger PI3K activity.<br><br>In unstimulated cells, PI3K class IA exists as an inactive heterodimer of a p85 regulatory subunit (encoded by PIK3R1, PIK3R2 or PIK3R3) and a p110 catalytic subunit (encoded by PIK3CA, PIK3CB or PIK3CD). Binding of the iSH2 domain of the p85 regulatory subunit to the ABD and C2 domains of the p110 catalytic subunit both stabilizes p110 and inhibits its catalytic activity. This inhibition is relieved when the SH2 domains of p85 bind phosphorylated tyrosines on activated RTKs or their adaptor proteins. Binding to membrane-associated receptors brings activated PI3K in proximity to its membrane-localized substrate, PIP2 (Mandelker et al. 2009, Burke et al. 2011).",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P22455-1",
                "P16234-1",
                "P42336-1",
                "Q9NWZ3-1",
                "P00533-1",
                "P04626-1",
                "P06241-1",
                "P10721-1",
                "P12931-1",
                "P63000-1",
                "P06239-1",
                "Q06124-2",
                "Q9Y4K3-1",
                "P36888-1",
                "P09619-1",
                "P42338-1",
                "O00329-1",
                "P08581-1",
                "Q01638-1",
                "P51617-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-2316434",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2316434"
                }
            ]
        },
        {
            "id": "R-HSA-2400009",
            "name": "PI3K inhibitors block PI3K catalytic activity",
            "equation": "",
            "summary": "A variety of inhibitors capable of blocking the phosphoinositide kinase activity of PI3K have been developed. These inhibitors display differential selectivity and inhibit kinase activity of their substrates by distinct mechanisms. For example, the first-generation PI3K inhibitor wortmannin (Wymann et al. 1996) covalently and irreversibly binds all classes of PI3K enzymes, as well as other kinases including mTOR, at a residue critical for catalytic activity. Although wortmannin is precluded from in vivo and clinical use due to its toxicity, it has proven to be a useful tool for in vitro laboratory studies. Newer inhibitors, such as BEZ235, are currently being investigated in Phase I clinical trials. BEZ235 is a dual pan-class I PI3K/mTOR inhibitor that blocks kinase activity by binding competitively to the ATP-binding pocket of these enzymes (Serra et al. 2008, Maira et al. 2008). BGT226 (Chang et al. 2011) and XL765 (Prasad et al. 2011) also inhibits both PI3K class I enzymes and mTOR. Other inhibitors in clinical trials, such as BKM120 (Maira et al. 2012), GDC0941 (Folkes et al. 2008, Junttila et al. 2009) and XL147 (Chakrabarty et al. 2012), are specific for class I PI3Ks and exhibit no activity against mTOR. Current research aims to identify isoform-specific PI3K inhibitors. Small molecule inhibitors that selectively inhibit PIK3CA (p110alpha), e.g. PIK-75 and A66, were used to study the role of p110alpha in signaling and growth of tumor cells (Knight et al. 2006, Sun et al. 2010, Jamieson et al. 2011, Utermark et al. 2012). The PIK3CB (p110beta) specific inhibitor TGX221 has been used in in vitro models of vascular injury (Jackson et al. 2005), and the TGX221 derivative KIN-193 has been shown to block AKT activity and tumor growth in mice with p110beta activation or PTEN loss (Ni et al. 2012). CAL-101 is a PIK3CD (p110delta) specific inhibitor that is being clinically investigated as a therapeutic for lymphoid malignancies (Herman et al. 2010). It is hoped that, in the future, more specific inhibitors, such as those targeting selective PI3K isoforms, will provide optimum treatment while minimizing unwanted side effects. For a recent review, please refer to Liu et al. 2009.",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P22455-1",
                "P16234-1",
                "P42336-1",
                "P00533-1",
                "P04626-1",
                "P06241-1",
                "P10721-1",
                "P12931-1",
                "P63000-1",
                "P06239-1",
                "Q06124-2",
                "P36888-1",
                "P09619-1",
                "P42338-1",
                "O00329-1",
                "P08581-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-2400009",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2400009"
                }
            ]
        },
        {
            "id": "R-HSA-5672965",
            "name": "RAS GEFs promote RAS nucleotide exchange",
            "equation": "",
            "summary": "The human genome is predicted to encode 27 RAS guanine nucleotide exchange factors (GEFs) that promote the exchange of GDP for GTP on membrane-associated RAS in response to RAS-MAPK pathway activation by growth factors, hormones, cytokines and other stimuli (reviewed in Cherfils and Zeghouf, 2013; Cargnello and Roux, 2011).  Nucleotide exchange stimulates a conformational change in RAS to facilitate its interaction with RAF, ultimately promoting the phosphorylation of downstream effectors MAPK3 and MAPK1 (also known as ERK1 and ERK2) (reviewed in Cseh et al, 2014; Vigil et al, 2010).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P01111-1",
                "P07949-1",
                "P22455-1",
                "P52333-1",
                "P16234-1",
                "O60674-1",
                "Q9UQM7-1",
                "P00533-1",
                "P04626-1",
                "P06241-1",
                "P10721-1",
                "Q13554-1",
                "Q02763-1",
                "P01112-1",
                "P36888-1",
                "P09619-1",
                "P18433-5",
                "Q05397-1",
                "Q13557-1",
                "P08581-1",
                "P23458-1",
                "Q13555-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-5672965",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5672965"
                }
            ]
        },
        {
            "id": "R-HSA-8864698",
            "name": "KIT gene expression is stimulated by TFAP2A,(TFAP2B) homodimers",
            "equation": "",
            "summary": "Binding of AP-2 alpha (TFAP2A) dimer to the KIT gene promoter stimulates KIT transcription. AP-2 beta (TFAP2B) may also stimulate KIT transcription. TFAP2A and KIT levels are frequently reduced in metastatic melanoma (Huang et al. 1998).",
            "cellular_location": "nucleoplasm, plasma membrane",
            "input_participant_list": [
                "R-HSA-8864691"
            ],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-8864698",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8864698"
                }
            ]
        },
        {
            "id": "R-HSA-9669854",
            "name": "KIT binds type II TKIs",
            "equation": "",
            "summary": "KIT can be bound and inhibited by class II tyrosine kinase inhibitors including imatinib, sunitinib, regorafenib  and others. Type II inhibitors bind to the inactive conformation of the kinase and prevent its activation (reviewed in Roskoski, 2018; Abbaspour Babaei et al, 2016; Klug et al, 2018).",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9669854",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669854"
                }
            ]
        },
        {
            "id": "R-HSA-9669855",
            "name": "Dasatinib-resistant KIT mutants do not bind dasatinib",
            "equation": "",
            "summary": "KIT receptors bearing mutations in the ATP-binding pocket are resistant to treatment with dasatinib (Schittenhelm et al, 2006; Serrano et al, 2019).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9669855",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669855"
                }
            ]
        },
        {
            "id": "R-HSA-9669859",
            "name": "Imatinib-resistant KIT mutants do not bind imatinib",
            "equation": "",
            "summary": "Although most exon 11 mutations in the KIT receptor are senstive to inhibition with imatinib, many secondary mutations confer resistance to the drug. These mutations, which generally occur in exon 13 and 14, encoding the ATP-binding pocket or exon 17 and 18, encoding the activation loop, favor the active form of the receptor and are resistant to imatinib (Frost et al, 2002; Ma et al, 2002; Chen et al, 2004; Foster et al, 2004;Tamborini et al, 2006; Gajiwala et al, 2008; Maclean et al, 2008; Garner et al, 2014; Serrano et al, 2017; Serrano et al, 2019; reviewed in Roskoski et al, 2018; Napolitano and Vincenzi, 2019; Klug et al, 2018; Corless et al, 2011).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9669859",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669859"
                }
            ]
        },
        {
            "id": "R-HSA-9669863",
            "name": "Masitinib-resistant KIT mutants do not bind masitinib",
            "equation": "",
            "summary": "Activated KIT receptors with oncogenic mutations in the ATP-binding cleft and the activation loop of the kinase are resistant to inhibition with masitinib (Serrano et al, 2019).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9669863",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669863"
                }
            ]
        },
        {
            "id": "R-HSA-9669868",
            "name": "Nilotinib-resistant KIT mutants do not bind nilotinib",
            "equation": "",
            "summary": "A number of secondary mutations that arise in mutated KIT receptors confer resistance to nilotinib. This is particularly true for the 'gate-keeper' mutation T760I that increases the affinity of the receptor for ATP, rendering it less susceptible to ATP-competitive inhibitors (Kissova et al, 2016; Serrano et al, 2019; Guo et al, 2007; Roberts et al, 2007; reviewed in Klug et al, 2018; Roskoski, 2018).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9669868",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669868"
                }
            ]
        },
        {
            "id": "R-HSA-9669870",
            "name": "Regorafenib-resistant KIT mutants do not bind regorafenib",
            "equation": "",
            "summary": "Regorafenib is used as a secondary therapeutic in cases of imatinib-resistant cancers with KIT mutations. Its effectiveness depends on the position of the secondary mutation. Regorafenib is effective in imatinib-resistant tumors carrying secondary mutations in exon 14 (gatekeeper) and most secondary mutations encoded by exons 17 and 18 (activation loop) (Yeh et al, 2017; Miyake et al, 2018; Serrano et al, 2019a,b; reviewed in Roskoski, 2018; Klug et al, 2018).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9669870",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669870"
                }
            ]
        },
        {
            "id": "R-HSA-9669874",
            "name": "Sorafenib-resistant KIT mutants do not bind sorafenib",
            "equation": "",
            "summary": "KIT receptors with mutations at residue D816 are resistant to inhibition by sorafenib, while other activation loop mutations show variable sensitivity (Guida et al, 2007; Heinrich et al, 2012; Serrano et al, 2019).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9669874",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669874"
                }
            ]
        },
        {
            "id": "R-HSA-9669878",
            "name": "Sunitinib-resistant KIT mutants do not bind sunitinib",
            "equation": "",
            "summary": "Sunitinib is an approved therapeutic for the treatment of KIT mutant cancers. Sunitinib is effective against KIT primary mutations and against secondary mutations in the ATP-binding domain encoded by exon 13 and exon 14, but less effective against activation loop mutations encoded by exon 17 and 18, which show resistance to the drug (Nishida et al, 2009; Serrano et al, 2017; Serrano et al, 2019; Gajiwala et al, 2008; Garner et al, 2014; Roskoski, 2018)",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9669878",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669878"
                }
            ]
        },
        {
            "id": "R-HSA-9669890",
            "name": "Constitutive phosphorylation of kinase domain KIT mutants",
            "equation": "",
            "summary": "Activating kinase domain mutants of KIT are constitutively active in the absence of ligand and can be tyrosine phosphorylated in the absence of dimerization (Furitsu et al, 1993; Hirota et al, 1998; Tsujimura et al, 1994). These mutations, which are encoded in exons 13, 14 and 17, are present at low frequency in AML, myeloma and germ cell tumors, as well as myeloproliferative disorders and mastocytosis, and occur as primary oe secondary resistance mutations in imatinib-treated gastrointestinal stromal tumors (reviewed in Antonescu, 2006; Roskoski, 2018; Corless et al, 2011).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9669890",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669890"
                }
            ]
        },
        {
            "id": "R-HSA-9669893",
            "name": "KIT binds type I TKIs",
            "equation": "",
            "summary": "KIT can be bound and inhibited by class I tyrosine kinase inhibitors including dovitinib and midostaurin, among others. Type I inhibitors bind in the ATP binding site of the active conformation and prevent activation of the kinase (reviewed in Roskoski, 2018; Abbbaspour Babaei et al, 2016).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9669893",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669893"
                }
            ]
        },
        {
            "id": "R-HSA-9669898",
            "name": "KIT mutants bind type I TKIs",
            "equation": "",
            "summary": "Dovitinib inhibits the growth of primary exon 11 mutations in GIST cell lines, with IC50 values of less than 500. Dovitinib is also active against the exon 13 mutation K654A and the exon 14 mutation T670I, but is inactive against mutations in exon 17 and 18, encoding the KIT activation loop (Serrano et al, 2019). Midostaurin inhibits the activity of KIT receptors with mutations in the juxtamembrane domain as well as those in the ATP-binding cleft and activation loop domains (Growney et al, 2005; Gleixner et al, 2006; Gotlib et al, 2016; Weisberg et al, 2019; Gebreyohannes et al, 2019). Avapritinib is a more selective KIT inhibitor that is active against activation loop mutants (Evans et al, 2017; Weisberg et al, 2019).",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9669898",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669898"
                }
            ]
        },
        {
            "id": "R-HSA-9669900",
            "name": "KIT mutants bind type II TKIs",
            "equation": "",
            "summary": "Imatinib and other type II TKIs bind to the inactive form of KIT at a hydrophobic pocket near the ATP binding cleft that is not present in the active form of the receptor (Liu and Gray, 2006; Zhang et al, 2009; reviewed in Roskoski, 2018; Klug et al, 2018). Sensitivity of KIT mutants to type II inhibitors varies.  Many juxtamembrane domain mutants, which favor the non-autoinhibited, DFG out inactive state, bind imatinib and other type II TKIs (Garner et al, 2014; Serrano et al, 2017; Debiec-Rychter et al, 2004; Serrano et al, 2019; reviewed in Roskoski, 2018; Klug et al, 2018; Corless et al, 2011). Primary extracellular mutations in KIT are only partially sensitive to imatinib (Debiec-Rychter et al, 2004; reviewed in Corless et al, 2011).",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9669900",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669900"
                }
            ]
        },
        {
            "id": "R-HSA-9669906",
            "name": "Ligand-independent dimerization of KIT juxtamembrane domain mutants",
            "equation": "",
            "summary": "Mutations of exon 11 of KIT are common initiating events in the onset of gastrointestinal stromal tumors (GIST), and also occur at lower frequency in other cancers (reviewed in Lasota and Miettinen, 2006; Roskoski, 2018). Mutations in exon 11 disrupt the juxtamembrane region of the protein that plays an autoinhibitory role by inserting into the kinase site, disrupting the activated structure (Ma et al, 1999; Chan et al, 2003; Mol et al, 2004; reviewed by Roskoski, 2018; Yuzawa et al, 2007). Mutations in exon 11 include point mutations as well as small deletions, insertions and indels, and result in proteins that can dimerize in a ligand-independent fashion, resulting in constitutive activation of the protein (Tsujimura et al, 1994; Kitayama et al, 1995; Hirota et al, 1998; Furitsu et al, 1993).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9669906",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669906"
                }
            ]
        },
        {
            "id": "R-HSA-9669911",
            "name": "Phosphorylation of juxtamembrane domain KIT mutants",
            "equation": "",
            "summary": "Juxtamembrane mutations in KIT lead to constitutive, ligand-independent autophosphorylation of receptor, activating downstream signaling (Hirota et al, 1998; Kitayama et al, 1995; Tsujimura et al, 1994; Furitsu et al, 1993; reviewed in Roskoski, 2018).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9669911",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9669911"
                }
            ]
        },
        {
            "id": "R-HSA-9670412",
            "name": "Phosphorylation of STATs downstream of KIT mutants",
            "equation": "",
            "summary": "Extracellular- , juxtamembrane- and kinase-domain mutants of KIT have been shown to activate the  STAT pathway, as assessed by STAT phosphorylation.  The biological relevance of each STAT isoform varies between tumor types (Brizzi et al, 1999; Ning et al, 2001; Frost et al, 2002; Growney et al, 2005; Hara et al, 2017; Obata et al, 2017; Duensing et al, 2004; Bauer et al, 2007; Deberry et al, 1997; Ronnstrand, 2004; reviewed in Lennartsson and Roonstrand, 2012).",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "O60674-1",
                "P06241-1",
                "P10721-1",
                "P06239-1",
                "P07947-1",
                "P07948-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9670412",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670412"
                }
            ]
        },
        {
            "id": "R-HSA-9670413",
            "name": "JAK2 binds to p-KIT mutants",
            "equation": "",
            "summary": "Activation of STAT signaling has been observed downstream of a number of oncogenic KIT mutants, both juxtamembrane and kinase domain mutants, although the biological relevance or each STAT isoform varies between tumor types (Brizzi et al, 1999; Ning et al, 2001; Frost et al, 2002; Growney et al, 2005; Hana et al, 2017; Obata et al, 2017; Duensing et al, 2004; Bauer et al, 2007; Deberry et al, 1997; Ronnstrand, 2004). Although the pathway details haven't been examined in all cases, this likely occurs through the recruitment of JAK2 and SRC family kinases, as is the case for the wild type receptor (reviewed in Lennartsson and Roonstrand, 2012).",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "O60674-1",
                "P06241-1",
                "P10721-1",
                "P06239-1",
                "P07947-1",
                "P07948-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9670413",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670413"
                }
            ]
        },
        {
            "id": "R-HSA-9670414",
            "name": "KIT mutants bind SFKs",
            "equation": "",
            "summary": "Signaling downstream of KIT mutants occurs in part through SRC family kinases, as is the case for the wild-type receptor (Paronetto et al, 2004; Krystal et al, 1998; Schittenhelm et al, 2006; Tatton et al, 2003; Timokhina et al, 1998; reviewed in Lanneartsson and Roonstrand, 2012). The dependence of different KIT mutants on SRC family signaling varies, however, with mutants such as the common D816V showing less requirement for SFK-mediated signaling (Sun et al, 2009).",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P06241-1",
                "P10721-1",
                "P06239-1",
                "P07947-1",
                "P07948-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9670414",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670414"
                }
            ]
        },
        {
            "id": "R-HSA-9670416",
            "name": "Recruitment of STATs by KIT mutants",
            "equation": "",
            "summary": "Extracellular- , juxtamembrane- and kinase-domain mutants of KIT have been shown to signal through the STAT pathway, although the biological relevance or each STAT isoform varies between tumor types (Brizzi et al, 1999; Ning et al, 2001; Frost et al, 2002; Growney et al, 2005; Hara et al, 2017; Obata et al, 2017; Duensing et al, 2004; Bauer et al, 2007; Deberry et al, 1997; Ronnstrand, 2004). Although the pathway details haven't been examined in all cases, STAT pathway activation likely occurs through the recruitment of JAK2 and SRC family kinases, as is the case for the wild type receptor (reviewed in Lennartsson and Roonstrand, 2012).",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "O60674-1",
                "P06241-1",
                "P10721-1",
                "P06239-1",
                "P07947-1",
                "P07948-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9670416",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670416"
                }
            ]
        },
        {
            "id": "R-HSA-9670417",
            "name": "Dimerization of STATs downstream of KIT mutants",
            "equation": "",
            "summary": "Activation of STAT signaling suggests that STATs dimerize downstream of activating KIT mutations as is the case with the wild-type receptor, although this hasn't been directly demonstrated in all cases (Brizzi et al, 1999; Ning et al, 2001; Frost et al, 2002; Growney et al, 2005; Hara et al, 2017; Obata et al, 2017; Duensing et al, 2004; Bauer et al, 2007; Deberry et al, 1997; Ronnstrand, 2004; reviewed in Lennartsson and Roonstrand, 2012).",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "O60674-1",
                "P06241-1",
                "P10721-1",
                "P06239-1",
                "P07947-1",
                "P07948-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9670417",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670417"
                }
            ]
        },
        {
            "id": "R-HSA-9670418",
            "name": "Phosphorylation of JAK2 downstream of KIT mutants",
            "equation": "",
            "summary": "Although the details haven't been examined in detail in all cases, phosphorylation of JAK2 likely occurs downstream of oncogenic mutations of KIT, as is the case for the wild-type receptor (Brizzi et al, 1999; Ning et al, 2001; Hirota et al, 1998; reviewed in Lennartsson and Roonstrand, 2012).; ;",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "O60674-1",
                "P06241-1",
                "P10721-1",
                "P06239-1",
                "P07947-1",
                "P07948-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9670418",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670418"
                }
            ]
        },
        {
            "id": "R-HSA-9670426",
            "name": "Disassociation and translocation of STATs to the nucleus downstream of KIT mutants",
            "equation": "",
            "summary": "STATs are assumed to dissociate from the receptor and translocate to the nucleus downstream of activated KIT receptors to propagate STAT-dependent signaling (Brizzi et al, 1999; Ning et al, 2001; Frost et al, 2002; Growney et al, 2005; Hara et al, 2017; Obata et al, 2017; Duensing et al, 2004; Bauer et al, 2007; Deberry et al, 1997; Ronnstrand, 2004; reviewed in Lennartsson and Roonstrand, 2012).",
            "cellular_location": "cytosol, nucleoplasm, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "O60674-1",
                "P06241-1",
                "P10721-1",
                "P06239-1",
                "P07947-1",
                "P07948-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9670426",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670426"
                }
            ]
        },
        {
            "id": "R-HSA-9670428",
            "name": "KIT mutants bind GRB2-SOS",
            "equation": "",
            "summary": "A number of activating extracellular-, juxtamembrane- and kinase-domain KIT mutants are believed to signal through the RAS/MAP kinase cascade, as assessed by the presence of phospho-ERK1 and 2 (also known as MAPK3 and MAPK1). Although the pathway has not been studied in detail, signaling downstream of KIT mutants likely involves recruitment of GRB2:SOS1, as is the case for the wild-type receptor  Frost et al, 2002; Garner et al, 2014; Monsel et al, 2010; Obata et al, 2017; Chi et al, 2010; Ran et al, 2015; Serrano et al, 2015; Zhu et al, 2007; reviewed in Abbaspour Babaei et al, 2016; Lennartsson and Roonstrand, 2012).",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9670428",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670428"
                }
            ]
        },
        {
            "id": "R-HSA-9670431",
            "name": "Phosphorylated KIT mutants bind PI3K",
            "equation": "",
            "summary": "PI3K-mediated signaling has been demonstrated downstream of a number of oncogenic KIT mutants, including extracellular, juxtamembrane and kinase domain mutants (Kemmer et al, 2004; Nakai et al, 2005; Hara et al, 2017; Obata et al, 2017; Duensing et al, 2004; Tarn et al, 2006; Rossi et al, 2006; Bauer et al, 2007; Bosbach et al, 2017; Zhu et al, 2007). In this pathway, KIT mutants are shown directly recruiting PI3K; pathway activation may also involve indirect recruitment through GRB2:GAB2, as in the wild-type pathway (reviewed in Lennnartsson and Roonstrand, 2012; Corless et al, 2011).",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P42336-1",
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9670431",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670431"
                }
            ]
        },
        {
            "id": "R-HSA-9670433",
            "name": "KIT mutants:PI3K catalyze synthesis of PIP3",
            "equation": "",
            "summary": "PI3K/AKT signaling is initiated downstream of KIT juxtamembrane and kinase domain mutants, as assessed by the presence of phosphorylated AKT in Western analysis (Kemmer et al, 2004; Nakai et al, 2005; Duensing et al, 2004; Tarn et al, 2006; Rossi et al, 2006; Bauer et al, 2007; Bosbach et al, 2017; Zhu et sl, 2007; Serrano et al, 2019; reviewed in Lennartsson and Roonstrand, 2012).",
            "cellular_location": "cytosol, extracellular region, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P42336-1",
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9670433",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670433"
                }
            ]
        },
        {
            "id": "R-HSA-9670436",
            "name": "p-KIT mutants:GRB2:SOS catalyzes nucleotide exchange on RAS",
            "equation": "",
            "summary": "Activation of the MAP kinase signaling pathway downstream of oncogenic KIT mutants, as evidenced by the presence of phosphorylated ERK proteins, likely depends on the SOS-mediated nucleotide exchange of GDP for GTP on RAS, as is the case for the wild-type receptor (Frost et al, 2002; Chi et al, 2010; Garner et al, 2014; Monsel et al, 2010; Obata et al, 2017; reviewed in Abbaspour Babaei et al, 2016; Lennartsson and Roonstrand, 2012).",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P01111-1",
                "P10721-1",
                "P01112-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9670436",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670436"
                }
            ]
        },
        {
            "id": "R-HSA-9680242",
            "name": "Ligand-independent dimerization of KIT extracellular domain mutants",
            "equation": "",
            "summary": "Kit mutations in exon 8 and 9 affect the fifth Ig-like domain of the extracellular region, which is known to play an important role in dimer stabilization. Mutations in this region support ligand-independent dimerization of the receptor, leading to constitutive activation (Bodemer et al, 2010; Cammenga et al, 2005; Yuzawa et al, 2007; reviewed in Lennartsson and Roonstrand, 2012; Corless et al, 2011 ).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9680242",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680242"
                }
            ]
        },
        {
            "id": "R-HSA-9680248",
            "name": "Phosphorylation of extracellular domain KIT mutants",
            "equation": "",
            "summary": "Mutations occurring in the fifth Ig-like extracellular domain of KIT (encoded by exon 8 and 9) are insertions, deletions and duplications affecting codons 502-504 (reviewed in Lennartsson and Roonstrand, 2012; Corless et al, 2011). These variants support ligand-independent autophosphorylation and activation of the receptor dimers (Bodemer et al, 2010; Cammenga et al, 2005).",
            "cellular_location": "plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9680248",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9680248"
                }
            ]
        },
        {
            "id": "R-HSA-9681375",
            "name": "KIT binds ripretinib",
            "equation": "",
            "summary": "Ripretinib is a example of a switch pocket inhibitor, a new type of class II tyrosine kinase inhibitors that is being developed for use against activation and drug resistant mutations in PDGFR and KIT (reviewed in Martin-Broto and Moura, 2020). Switch pocket inhibitors are type II tyrosine kinase inhibitors that force the activation loop (AL) into an inactive conformation, and are therefore active against AL mutants of KIT that are otherwise only sensitive to type I TKIs. Ripretinib is active against mutations affecting extracellular, juxtamembrane, ATP-binding pocket and activation loop domains and is thus the first inhibitor with pan-KIT inhibitory activity. Ripretinib has been successfully studied in TKI-refractory GIST (Smith et al, 2019).",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9681375",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9681375"
                }
            ]
        },
        {
            "id": "R-HSA-9681382",
            "name": "KIT mutants bind ripretinib",
            "equation": "",
            "summary": "Ripretinib is a example of a switch pocket inhibitor, a new type of class II tyrosine kinase inhibitors that is being developed for use against activation and drug resistant mutations in PDGFR and KIT (reviewed in Martin-Broto and Moura, 2020). Switch pocket inhibitors are type II tyrosine kinase inhibitors that force the activation loop (AL) into an inactive conformation, and are therefore active against AL mutants of KIT that are otherwise only sensitive to type I TKIs. Ripretinib is active against mutations affecting extracellular, juxtamembrane, ATP-binding pocket and activation loop domains and is thus the first inhibitor with pan-KIT inhibitory activity. Ripretinib has been successfully studied in TKI-refractory GIST (Smith et al, 2019).",
            "cellular_location": "cytosol, plasma membrane",
            "input_participant_list": [],
            "output_participant_list": [],
            "enzyme_list": [
                "P10721-1"
            ],
            "evidence": [
                {
                    "id": "R-HSA-9681382",
                    "database": "Reactome",
                    "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9681382"
                }
            ]
        }
    ],
    "reaction_participants": [
        {
            "participant_id": "R-HSA-195066",
            "participant_name": "VAV1 [cytosol]",
            "crossref": [
                {
                    "id": "P15498",
                    "database": "UniProt",
                    "url": ""
                },
                {
                    "id": "6NF1",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P15498",
                    "database": "Pharos - Targets",
                    "url": ""
                },
                {
                    "id": "6NFA",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSG00000141968",
                    "database": "OpenTargets",
                    "url": ""
                },
                {
                    "id": "P15498",
                    "database": "PRO",
                    "url": ""
                },
                {
                    "id": "P15498",
                    "database": "ZINC target",
                    "url": ""
                },
                {
                    "id": "HMDBP10969",
                    "database": "HMDB Protein",
                    "url": ""
                },
                {
                    "id": "VAV_HUMAN",
                    "database": "ZINC - Substances",
                    "url": ""
                },
                {
                    "id": "3BJI",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "NP_001245136.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "NP_005419.2",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "3KY9",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "6NEW",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2CRH",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2LCT",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2MC1",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2ROR",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P15498",
                    "database": "GeneCards",
                    "url": ""
                },
                {
                    "id": "VAV_HUMAN",
                    "database": "ZINC - Predictions - Purchasable",
                    "url": ""
                },
                {
                    "id": "ENSP00000469450",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSG00000141968",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENST00000596764",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000472929",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENST00000602142",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSG00000141968-VAV1",
                    "database": "HPA",
                    "url": ""
                }
            ]
        },
        {
            "participant_id": "R-HSA-197662",
            "participant_name": "KIT [plasma membrane]",
            "crossref": [
                {
                    "id": "P10721",
                    "database": "UniProt",
                    "url": ""
                },
                {
                    "id": "NP_001087241.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "NP_000213.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "ENSG00000157404-KIT",
                    "database": "HPA",
                    "url": ""
                },
                {
                    "id": "6XVA",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2VIF",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P10721",
                    "database": "PRO",
                    "url": ""
                },
                {
                    "id": "6XV9",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSG00000157404",
                    "database": "OpenTargets",
                    "url": ""
                },
                {
                    "id": "KIT_HUMAN",
                    "database": "ZINC - Predictions - Purchasable",
                    "url": ""
                },
                {
                    "id": "2IUH",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4HVS",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P10721",
                    "database": "ZINC target",
                    "url": ""
                },
                {
                    "id": "KIT_HUMAN",
                    "database": "ZINC - World Drugs",
                    "url": ""
                },
                {
                    "id": "3G0F",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7KHG",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "3G0E",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "6XVB",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7ZW8",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4K9E",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7KHK",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "7KHJ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2E9W",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "6KLA",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2EC8",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "KIT_HUMAN",
                    "database": "ZINC - Biogenic",
                    "url": ""
                },
                {
                    "id": "6MOB",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "KIT_HUMAN",
                    "database": "ZINC - FDA approved",
                    "url": ""
                },
                {
                    "id": "KIT_HUMAN",
                    "database": "ZINC - Investigational",
                    "url": ""
                },
                {
                    "id": "16308",
                    "database": "Orphanet",
                    "url": ""
                },
                {
                    "id": "6ITT",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1T45",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1T46",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "6ITV",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENST00000288135",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000288135",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENSP00000509450",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "ENST00000687295",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "6GQM",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1PKG",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "6HH1",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSG00000157404",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "KIT_HUMAN",
                    "database": "ZINC - Substances",
                    "url": ""
                },
                {
                    "id": "P10721",
                    "database": "Pharos - Targets",
                    "url": ""
                },
                {
                    "id": "6GQJ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "6GQK",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "2.7.10.1",
                    "database": "IntEnz",
                    "url": ""
                },
                {
                    "id": "6GQL",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "1805",
                    "database": "Guide to Pharmacology - Targets",
                    "url": ""
                },
                {
                    "id": "4PGZ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "8DFM",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "8DFP",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "HMDBP01513",
                    "database": "HMDB Protein",
                    "url": ""
                },
                {
                    "id": "8DFQ",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4U0I",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P10721",
                    "database": "GeneCards",
                    "url": ""
                },
                {
                    "id": "4K94",
                    "database": "PDB",
                    "url": ""
                }
            ]
        },
        {
            "participant_id": "R-HSA-58196",
            "participant_name": "PRKCA [cytosol]",
            "crossref": [
                {
                    "id": "P17252",
                    "database": "UniProt",
                    "url": ""
                },
                {
                    "id": "P17252",
                    "database": "Pharos - Targets",
                    "url": ""
                },
                {
                    "id": "KPCA_HUMAN",
                    "database": "ZINC - Biogenic",
                    "url": ""
                },
                {
                    "id": "P17252",
                    "database": "PRO",
                    "url": ""
                },
                {
                    "id": "3IW4",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "HMDBP01180",
                    "database": "HMDB Protein",
                    "url": ""
                },
                {
                    "id": "2ELI",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "ENSG00000154229-PRKCA",
                    "database": "HPA",
                    "url": ""
                },
                {
                    "id": "ENSP00000408695",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "NP_002728.1",
                    "database": "RefSeq",
                    "url": ""
                },
                {
                    "id": "1482",
                    "database": "Guide to Pharmacology - Targets",
                    "url": ""
                },
                {
                    "id": "ENSG00000154229",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "KPCA_HUMAN",
                    "database": "ZINC - FDA approved",
                    "url": ""
                },
                {
                    "id": "ENST00000413366",
                    "database": "Ensembl",
                    "url": ""
                },
                {
                    "id": "KPCA_HUMAN",
                    "database": "ZINC - Substances",
                    "url": ""
                },
                {
                    "id": "4RA4",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "4DNL",
                    "database": "PDB",
                    "url": ""
                },
                {
                    "id": "P17252",
                    "database": "ZINC target",
                    "url": ""
                },
                {
                    "id": "ENSG00000154229",
                    "database": "OpenTargets",
                    "url": ""
                },
                {
                    "id": "P17252",
                    "database": "GeneCards",
                    "url": ""
                },
                {
                    "id": "KPCA_HUMAN",
                    "database": "ZINC - Predictions - Purchasable",
                    "url": ""
                },
                {
                    "id": "2.7.11.13",
                    "database": "IntEnz",
                    "url": ""
                },
                {
                    "id": "KPCA_HUMAN",
                    "database": "ZINC - World Drugs",
                    "url": ""
                },
                {
                    "id": "KPCA_HUMAN",
                    "database": "ZINC - Investigational",
                    "url": ""
                }
            ]
        },
        {
            "participant_id": "R-HSA-8864691",
            "participant_name": "KIT Gene [nucleoplasm]",
            "crossref": [
                {
                    "id": "ENSG00000157404",
                    "database": "ENSEMBL",
                    "url": ""
                }
            ]
        }
    ],
    "reaction_enzymes": [
        {
            "uniprot_ac": "A0A0G2JW59",
            "gene_name": "Flt3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A0G2JW59",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0G2JW59"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A0G2JW59",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0G2JW59"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A0G2K6M9",
            "gene_name": "Btk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A0G2K6M9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0G2K6M9"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A0G2K6M9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0G2K6M9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A0R4J8U1",
            "gene_name": "Zap70",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A0R4J8U1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0R4J8U1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A0R4J8U1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A0R4J8U1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I5ZP97",
            "gene_name": "Dyrk1b",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A8I5ZP97",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I5ZP97"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I5ZP97",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I5ZP97"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I5ZVE3",
            "gene_name": "Ephb3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A8I5ZVE3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I5ZVE3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I5ZVE3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I5ZVE3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I6A5T6",
            "gene_name": "Mst1r",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A8I6A5T6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6A5T6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I6A5T6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6A5T6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I6AM23",
            "gene_name": "Jak1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A8I6AM23",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6AM23"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I6AM23",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6AM23"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I6AWX7",
            "gene_name": "Dyrk4",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A8I6AWX7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6AWX7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I6AWX7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6AWX7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "A0A8I6GCV6",
            "gene_name": "Ltk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "A0A8I6GCV6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6GCV6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "A0A8I6GCV6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/A0A8I6GCV6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "B1WC09",
            "gene_name": "Ddr2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "B1WC09",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/B1WC09"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "B1WC09",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/B1WC09"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "B2RYC7",
            "gene_name": "Tec",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "B2RYC7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/B2RYC7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "B2RYC7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/B2RYC7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "B5DFD6",
            "gene_name": "Tie1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "B5DFD6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/B5DFD6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "B5DFD6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/B5DFD6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZBN3",
            "gene_name": "Epha2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D3ZBN3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZBN3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZBN3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZBN3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZCD0",
            "gene_name": "Tek",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D3ZCD0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZCD0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZCD0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZCD0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZD03",
            "gene_name": "Tyk2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D3ZD03",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZD03"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZD03",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZD03"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZDH4",
            "gene_name": "Epha1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D3ZDH4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZDH4"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZDH4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZDH4"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZDS3",
            "gene_name": "Ptk6",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D3ZDS3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZDS3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZDS3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZDS3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZJI4",
            "gene_name": "Tnk1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D3ZJI4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZJI4"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZJI4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZJI4"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D3ZZK3",
            "gene_name": "Epha4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D3ZZK3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZZK3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D3ZZK3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D3ZZK3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D4A584",
            "gene_name": "Fes",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D4A584",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4A584"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D4A584",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4A584"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D4A7W7",
            "gene_name": "Itk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D4A7W7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4A7W7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D4A7W7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4A7W7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "D4ADZ5",
            "gene_name": "Wee2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "D4ADZ5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4ADZ5"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "D4ADZ5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/D4ADZ5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "E1JHB7",
            "gene_name": "Pvr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "E1JHB7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/E1JHB7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "E9PSY0",
            "gene_name": "Axl",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "E9PSY0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/E9PSY0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "E9PSY0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/E9PSY0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "E9PT20",
            "gene_name": "Abl1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "E9PT20",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/E9PT20"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "E9PT20",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/E9PT20"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1LM93",
            "gene_name": "Yes1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "F1LM93",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LM93"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1LM93",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LM93"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1LRZ0",
            "gene_name": "Alk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "F1LRZ0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LRZ0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1LRZ0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LRZ0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1LSG7",
            "gene_name": "Fgfr2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "F1LSG7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LSG7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1LSG7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LSG7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1LSN4",
            "gene_name": "Fgfr3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "F1LSN4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LSN4"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1LSN4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LSN4"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1LVI0",
            "gene_name": "Bmx",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "F1LVI0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LVI0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1LVI0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LVI0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1LYY7",
            "gene_name": "Dyrk2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "F1LYY7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LYY7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1LYY7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1LYY7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1M0N1",
            "gene_name": "Abl2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "F1M0N1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1M0N1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1M0N1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1M0N1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "F1MAJ0",
            "gene_name": "Ephb2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "F1MAJ0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1MAJ0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "F1MAJ0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/F1MAJ0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "G3V6K6",
            "gene_name": "Egfr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "G3V6K6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V6K6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "G3V6K6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V6K6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "G3V783",
            "gene_name": "Ripk2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "G3V783",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V783"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "G3V783",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V783"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "G3V783",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V783"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "G3V783",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V783"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "G3V9H8",
            "gene_name": "Ret",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "G3V9H8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V9H8"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "G3V9H8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/G3V9H8"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "M0R7E7",
            "gene_name": "Map2k3",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "M0R7E7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/M0R7E7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "M0R7E7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/M0R7E7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "M0RDA4",
            "gene_name": "Ephb4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "M0RDA4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/M0RDA4"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "M0RDA4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/M0RDA4"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O00329",
            "gene_name": "PIK3CD",
            "activity": [
                {
                    "ec_number": "2.7.1.153",
                    "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).",
                    "evidence": [
                        {
                            "id": "O00329",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O00329"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.153",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O00329",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O00329"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.137",
                    "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).",
                    "evidence": [
                        {
                            "id": "O00329",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O00329"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.137",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O00329",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O00329"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O08680",
            "gene_name": "Epha3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O08680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O08680"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O08680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O08680"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O08775",
            "gene_name": "Kdr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O08775",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O08775"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O08775",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O08775"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O09110",
            "gene_name": "Map2k3",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O09110",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O09110"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O09110",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O09110"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O09127",
            "gene_name": "Epha8",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O09127",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O09127"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O09127",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O09127"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O14733",
            "gene_name": "MAP2K7",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O14733",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O14733"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O14733",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O14733"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O14757",
            "gene_name": "CHEK1",
            "activity": [
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O14757",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O14757"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O14757",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O14757"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O15146",
            "gene_name": "MUSK",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O15146",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O15146"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O15146",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O15146"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O35346",
            "gene_name": "Ptk2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O35346",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O35346"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O35346",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O35346"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O35491",
            "gene_name": "Clk2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O35491",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O35491"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O35491",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O35491"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O35492",
            "gene_name": "Clk3",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O35492",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O35492"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O35492",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O35492"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O35493",
            "gene_name": "Clk4",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O35493",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O35493"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O35493",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O35493"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O43353",
            "gene_name": "RIPK2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O43353",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O43353"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O43353",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O43353"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O43353",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O43353"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O43781",
            "gene_name": "DYRK3",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O43781",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O43781"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O43781",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O43781"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O54804",
            "gene_name": "Chka",
            "activity": [
                {
                    "ec_number": "2.7.1.32",
                    "activity": "ATP + choline = ADP + H(+) + phosphocholine.",
                    "evidence": [
                        {
                            "id": "O54804",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O54804"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.82",
                    "activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.",
                    "evidence": [
                        {
                            "id": "O54804",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O54804"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.32",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O54804",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O54804"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.82",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O54804",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O54804"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O54967",
            "gene_name": "Tnk2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O54967",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O54967"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O54967",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O54967"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O54967",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O54967"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O54967",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O54967"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O60674",
            "gene_name": "JAK2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O60674",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O60674"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O60674",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O60674"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O61444",
            "gene_name": "Mkk4",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O61444",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O61444"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O61444",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O61444"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O62602",
            "gene_name": "lic",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O62602",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O62602"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O62602",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O62602"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O70146",
            "gene_name": "Tesk1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O70146",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O70146"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O70146",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O70146"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O75716",
            "gene_name": "STK16",
            "activity": [
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O75716",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O75716"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O75716",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O75716"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O75716",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O75716"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "O88697",
            "gene_name": "Stk16",
            "activity": [
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "O88697",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O88697"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "O88697",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O88697"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "O88697",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/O88697"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P00519",
            "gene_name": "ABL1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P00519",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00519"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P00519",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00519"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P00520",
            "gene_name": "Abl1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P00520",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00520"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P00520",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00520"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P00522",
            "gene_name": "Abl",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P00522",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00522"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P00522",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00522"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P00528",
            "gene_name": "Src64B",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P00528",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00528"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P00528",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00528"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P00533",
            "gene_name": "EGFR",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P00533",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00533"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P00533",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P00533"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P01111",
            "gene_name": "NRAS",
            "activity": [
                {
                    "ec_number": "3.6.5.2",
                    "activity": "GTP + H2O = GDP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "P01111",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P01111"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.5.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P01111",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P01111"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P01112",
            "gene_name": "HRAS",
            "activity": [
                {
                    "ec_number": "3.6.5.2",
                    "activity": "GTP + H2O = GDP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "P01112",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P01112"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.5.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P01112",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P01112"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P04412",
            "gene_name": "Egfr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P04412",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P04412"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P04412",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P04412"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P04626",
            "gene_name": "ERBB2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P04626",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P04626"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P04626",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P04626"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P04629",
            "gene_name": "NTRK1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P04629",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P04629"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P04629",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P04629"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P05480",
            "gene_name": "Src",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P05480",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P05480"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P05480",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P05480"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P05532",
            "gene_name": "Kit",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P05532",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P05532"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P05532",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P05532"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P05622",
            "gene_name": "Pdgfrb",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P05622",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P05622"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P05622",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P05622"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P06213",
            "gene_name": "INSR",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P06213",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06213"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P06213",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06213"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P06239",
            "gene_name": "LCK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P06239",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06239"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P06239",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06239"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P06240",
            "gene_name": "Lck",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P06240",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06240"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P06240",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06240"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P06241",
            "gene_name": "FYN",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P06241",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06241"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P06241",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06241"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P06494",
            "gene_name": "Erbb2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P06494",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06494"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P06494",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06494"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P06784",
            "gene_name": "STE7",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P06784",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06784"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P06784",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P06784"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P07332",
            "gene_name": "FES",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P07332",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07332"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P07332",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07332"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P07333",
            "gene_name": "CSF1R",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P07333",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07333"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P07333",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07333"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P07947",
            "gene_name": "YES1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P07947",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07947"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P07947",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07947"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P07948",
            "gene_name": "LYN",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P07948",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07948"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P07948",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07948"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P07949",
            "gene_name": "RET",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P07949",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07949"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P07949",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P07949"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08018",
            "gene_name": "PBS2",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P08018",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08018"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08018",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08018"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08069",
            "gene_name": "IGF1R",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P08069",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08069"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08069",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08069"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08103",
            "gene_name": "Hck",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P08103",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08103"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08103",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08103"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08581",
            "gene_name": "MET",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P08581",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08581"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08581",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08581"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08630",
            "gene_name": "Btk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P08630",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08630"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08630",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08630"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08631",
            "gene_name": "HCK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P08631",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08631"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08631",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08631"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08922",
            "gene_name": "ROS1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P08922",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08922"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08922",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08922"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P08923",
            "gene_name": "Ltk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P08923",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08923"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P08923",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P08923"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P09208",
            "gene_name": "InR",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P09208",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09208"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P09208",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09208"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P09215",
            "gene_name": "Prkcd",
            "activity": [
                {
                    "ec_number": "2.7.11.13",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P09215",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09215"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P09215",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09215"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P09581",
            "gene_name": "Csf1r",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P09581",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09581"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P09619",
            "gene_name": "PDGFRB",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P09619",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09619"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P09619",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09619"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P09759",
            "gene_name": "Ephb1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P09759",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09759"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P09759",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09759"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P09760",
            "gene_name": "Fer",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P09760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09760"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P09760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09760"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P09769",
            "gene_name": "FGR",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P09769",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09769"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P09769",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P09769"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P0C1S8",
            "gene_name": "WEE2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P0C1S8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P0C1S8"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P0C1S8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P0C1S8"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P10721",
            "gene_name": "KIT",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P10721",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P10721"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P10721",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P10721"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P11362",
            "gene_name": "FGFR1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P11362",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P11362"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P11362",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P11362"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P11980",
            "gene_name": "Pkm",
            "activity": [
                {
                    "ec_number": "2.7.1.40",
                    "activity": "CTP + pyruvate = CDP + H(+) + phosphoenolpyruvate.",
                    "evidence": [
                        {
                            "id": "P11980",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P11980"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.40",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P11980",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P11980"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P11980",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P11980"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P11980",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P11980"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P12931",
            "gene_name": "SRC",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P12931",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P12931"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P12931",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P12931"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P13368",
            "gene_name": "sev",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P13368",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P13368"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P13368",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P13368"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P14234",
            "gene_name": "Fgr",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P14234",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14234"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P14234",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14234"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P14616",
            "gene_name": "INSRR",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P14616",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14616"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P14616",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14616"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P14618",
            "gene_name": "PKM",
            "activity": [
                {
                    "ec_number": "2.7.1.40",
                    "activity": "CTP + pyruvate = CDP + H(+) + phosphoenolpyruvate.",
                    "evidence": [
                        {
                            "id": "P14618",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14618"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.40",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P14618",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14618"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P14618",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14618"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P14618",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14618"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P14680",
            "gene_name": "YAK1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P14680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14680"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P14680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P14680"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P15127",
            "gene_name": "Insr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P15127",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P15127"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P15127",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P15127"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P15208",
            "gene_name": "Insr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P15208",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P15208"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P15208",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P15208"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P15209",
            "gene_name": "Ntrk2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P15209",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P15209"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P15209",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P15209"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P16056",
            "gene_name": "Met",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P16056",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16056"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P16056",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16056"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P16092",
            "gene_name": "Fgfr1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P16092",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16092"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P16092",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16092"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P16234",
            "gene_name": "PDGFRA",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P16234",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16234"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P16234",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16234"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P16277",
            "gene_name": "Blk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P16277",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16277"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P16277",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16277"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P16591",
            "gene_name": "FER",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P16591",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16591"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P16591",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16591"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P16879",
            "gene_name": "Fes",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P16879",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16879"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P16879",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P16879"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P17252",
            "gene_name": "PRKCA",
            "activity": [
                {
                    "ec_number": "2.7.11.13",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P17252",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P17252"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P17252",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P17252"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P17948",
            "gene_name": "FLT1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P17948",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P17948"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P17948",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P17948"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P18106",
            "gene_name": "FER",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P18106",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P18106"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P18106",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P18106"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P18160",
            "gene_name": "splA",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P18160",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P18160"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P18160",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P18160"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P18161",
            "gene_name": "splB",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P18161",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P18161"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P18161",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P18161"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P18433",
            "gene_name": "PTPRA",
            "activity": [
                {
                    "ec_number": "3.1.3.48",
                    "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.",
                    "evidence": [
                        {
                            "id": "P18433",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P18433"
                        }
                    ]
                },
                {
                    "ec_number": "3.1.3.48",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P18433",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P18433"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P18475",
            "gene_name": "tor",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P18475",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P18475"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P18475",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P18475"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P19525",
            "gene_name": "EIF2AK2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P19525",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P19525"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P19525",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P19525"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P19525",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P19525"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P20786",
            "gene_name": "Pdgfra",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P20786",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P20786"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P20786",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P20786"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P21709",
            "gene_name": "EPHA1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P21709",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21709"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P21709",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21709"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P21802",
            "gene_name": "FGFR2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P21802",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21802"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P21802",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21802"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P21803",
            "gene_name": "Fgfr2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P21803",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21803"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P21803",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21803"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P21860",
            "gene_name": "ERBB3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P21860",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21860"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P21860",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21860"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P21965",
            "gene_name": "MCK1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P21965",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21965"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P21965",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P21965"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P22216",
            "gene_name": "RAD53",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P22216",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22216"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P22216",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22216"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P22455",
            "gene_name": "FGFR4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P22455",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22455"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P22455",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22455"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P22518",
            "gene_name": "Clk1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P22518",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22518"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P22518",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22518"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P22607",
            "gene_name": "FGFR3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P22607",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22607"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P22607",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22607"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P22681",
            "gene_name": "CBL",
            "activity": [
                {
                    "ec_number": "2.3.2.27",
                    "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
                    "evidence": [
                        {
                            "id": "P22681",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22681"
                        }
                    ]
                },
                {
                    "ec_number": "2.3.2.27",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P22681",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P22681"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P23458",
            "gene_name": "JAK1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P23458",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P23458"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P23458",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P23458"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P24062",
            "gene_name": "Igf1r",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P24062",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P24062"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P24062",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P24062"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P24604",
            "gene_name": "Tec",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P24604",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P24604"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P24604",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P24604"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P25911",
            "gene_name": "Lyn",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P25911",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P25911"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P25911",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P25911"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P26618",
            "gene_name": "Pdgfra",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P26618",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P26618"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P26618",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P26618"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P28867",
            "gene_name": "Prkcd",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P28867",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P28867"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.13",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P28867",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P28867"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P28867",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P28867"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P29317",
            "gene_name": "EPHA2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P29317",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29317"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P29317",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29317"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P29319",
            "gene_name": "Epha3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P29319",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29319"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P29319",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29319"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P29320",
            "gene_name": "EPHA3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P29320",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29320"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P29320",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29320"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P29321",
            "gene_name": "Epha8",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P29321",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29321"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P29321",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29321"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P29322",
            "gene_name": "EPHA8",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P29322",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29322"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P29322",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29322"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P29323",
            "gene_name": "EPHB2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P29323",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29323"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P29323",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29323"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P29350",
            "gene_name": "PTPN6",
            "activity": [
                {
                    "ec_number": "3.1.3.48",
                    "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.",
                    "evidence": [
                        {
                            "id": "P29350",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29350"
                        }
                    ]
                },
                {
                    "ec_number": "3.1.3.48",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P29350",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29350"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P29376",
            "gene_name": "LTK",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P29376",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29376"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P29376",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29376"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P29597",
            "gene_name": "TYK2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P29597",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29597"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P29597",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P29597"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P30291",
            "gene_name": "WEE1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P30291",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P30291"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P30291",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P30291"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P30530",
            "gene_name": "AXL",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P30530",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P30530"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P30530",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P30530"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P31938",
            "gene_name": "Map2k1",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P31938",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P31938"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P31938",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P31938"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P32350",
            "gene_name": "KNS1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P32350",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P32350"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P32350",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P32350"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P32490",
            "gene_name": "MKK1",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P32490",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P32490"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P32490",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P32490"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P32491",
            "gene_name": "MKK2",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P32491",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P32491"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P32491",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P32491"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P32577",
            "gene_name": "Csk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P32577",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P32577"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P32577",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P32577"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P33981",
            "gene_name": "TTK",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P33981",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P33981"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P33981",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P33981"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P34152",
            "gene_name": "Ptk2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P34152",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P34152"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P34152",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P34152"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P34925",
            "gene_name": "RYK",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P34925",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P34925"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P34925",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P34925"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35546",
            "gene_name": "Ret",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35546",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35546"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35546",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35546"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35590",
            "gene_name": "TIE1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35590",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35590"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35590",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35590"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35739",
            "gene_name": "Ntrk1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35739",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35739"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35739",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35739"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35761",
            "gene_name": "Ttk",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P35761",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35761"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35761",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35761"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35790",
            "gene_name": "CHKA",
            "activity": [
                {
                    "ec_number": "2.7.1.82",
                    "activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.",
                    "evidence": [
                        {
                            "id": "P35790",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35790"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.82",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35790",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35790"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.32",
                    "activity": "ATP + choline = ADP + H(+) + phosphocholine.",
                    "evidence": [
                        {
                            "id": "P35790",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35790"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.32",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35790",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35790"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35916",
            "gene_name": "FLT4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35916",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35916"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35916",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35916"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35917",
            "gene_name": "Flt4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35917",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35917"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35917",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35917"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35918",
            "gene_name": "Kdr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35918",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35918"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35918",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35918"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35968",
            "gene_name": "KDR",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35968",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35968"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35968",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35968"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35969",
            "gene_name": "Flt1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35969",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35969"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35969",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35969"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P35991",
            "gene_name": "Btk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P35991",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35991"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P35991",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P35991"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P36506",
            "gene_name": "Map2k2",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P36506",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P36506"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P36506",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P36506"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P36507",
            "gene_name": "MAP2K2",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P36507",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P36507"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P36507",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P36507"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P36888",
            "gene_name": "FLT3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P36888",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P36888"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P36888",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P36888"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P39688",
            "gene_name": "Fyn",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P39688",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P39688"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P39688",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P39688"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P41240",
            "gene_name": "CSK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P41240",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P41240"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P41240",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P41240"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P41241",
            "gene_name": "Csk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P41241",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P41241"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P41241",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P41241"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P41242",
            "gene_name": "Matk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P41242",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P41242"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P41242",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P41242"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P41243",
            "gene_name": "Matk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P41243",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P41243"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P41243",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P41243"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P42336",
            "gene_name": "PIK3CA",
            "activity": [
                {
                    "ec_number": "2.7.1.153",
                    "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).",
                    "evidence": [
                        {
                            "id": "P42336",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42336"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.153",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42336",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42336"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P42336",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42336"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.137",
                    "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).",
                    "evidence": [
                        {
                            "id": "P42336",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42336"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.137",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42336",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42336"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P42338",
            "gene_name": "PIK3CB",
            "activity": [
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P42338",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42338"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.153",
                    "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).",
                    "evidence": [
                        {
                            "id": "P42338",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42338"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.153",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42338",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42338"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.137",
                    "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).",
                    "evidence": [
                        {
                            "id": "P42338",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42338"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.137",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42338",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42338"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P42679",
            "gene_name": "MATK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P42679",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42679"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42679",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42679"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P42680",
            "gene_name": "TEC",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P42680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42680"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42680"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P42681",
            "gene_name": "TXK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P42681",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42681"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42681",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42681"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P42682",
            "gene_name": "Txk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P42682",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42682"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42682",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42682"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P42684",
            "gene_name": "ABL2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P42684",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42684"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42684",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42684"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P42685",
            "gene_name": "FRK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P42685",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42685"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P42685",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P42685"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P43403",
            "gene_name": "ZAP70",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P43403",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P43403"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P43403",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P43403"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P43404",
            "gene_name": "Zap70",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P43404",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P43404"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P43404",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P43404"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P43405",
            "gene_name": "SYK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P43405",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P43405"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P43405",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P43405"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P45985",
            "gene_name": "MAP2K4",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P45985",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P45985"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P45985",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P45985"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P46734",
            "gene_name": "MAP2K3",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P46734",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P46734"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P46734",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P46734"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P47809",
            "gene_name": "Map2k4",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P47809",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P47809"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P47809",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P47809"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P47810",
            "gene_name": "Wee1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P47810",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P47810"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P47810",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P47810"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P48025",
            "gene_name": "Syk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P48025",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P48025"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P48025",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P48025"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P49657",
            "gene_name": "mnb",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P49657",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49657"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P49657",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49657"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P49759",
            "gene_name": "CLK1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P49759",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49759"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P49759",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49759"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P49760",
            "gene_name": "CLK2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P49760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49760"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P49760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49760"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P49761",
            "gene_name": "CLK3",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P49761",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49761"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P49761",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49761"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P49762",
            "gene_name": "Doa",
            "activity": [
                {
                    "ec_number": "2.7.11.-",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P49762",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49762"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P49762",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49762"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P49762",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P49762"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P50545",
            "gene_name": "Hck",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P50545",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P50545"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P50545",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P50545"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P51451",
            "gene_name": "BLK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P51451",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P51451"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P51451",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P51451"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P51617",
            "gene_name": "IRAK1",
            "activity": [
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P51617",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P51617"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P51617",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P51617"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P51813",
            "gene_name": "BMX",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P51813",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P51813"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P51813",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P51813"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P52332",
            "gene_name": "Jak1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P52332",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52332"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P52332",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52332"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P52333",
            "gene_name": "JAK3",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P52333",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52333"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P52333",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52333"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P52480",
            "gene_name": "Pkm",
            "activity": [
                {
                    "ec_number": "2.7.1.40",
                    "activity": "CTP + pyruvate = CDP + H(+) + phosphoenolpyruvate.",
                    "evidence": [
                        {
                            "id": "P52480",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52480"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.40",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P52480",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52480"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P52480",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52480"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P52480",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52480"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P52564",
            "gene_name": "MAP2K6",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P52564",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52564"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P52564",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P52564"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P53767",
            "gene_name": "Flt1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P53767",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P53767"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P53767",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P53767"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54199",
            "gene_name": "MPS1",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P54199",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54199"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54199",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54199"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54350",
            "gene_name": "Wee1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54350",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54350"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54350",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54350"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54753",
            "gene_name": "EPHB3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54753",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54753"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54753",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54753"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54754",
            "gene_name": "Ephb3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54754",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54754"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54754",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54754"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54756",
            "gene_name": "EPHA5",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54756",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54756"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54756",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54756"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54757",
            "gene_name": "Epha5",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54757",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54757"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54757",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54757"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54758",
            "gene_name": "Epha6",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54758",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54758"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54758",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54758"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54759",
            "gene_name": "Epha7",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54759",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54759"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54759",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54759"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54760",
            "gene_name": "EPHB4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54760"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54760"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54761",
            "gene_name": "Ephb4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54761",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54761"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54761",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54761"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54762",
            "gene_name": "EPHB1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54762",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54762"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54762",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54762"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54763",
            "gene_name": "Ephb2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54763",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54763"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54763",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54763"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P54764",
            "gene_name": "EPHA4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P54764",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54764"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P54764",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P54764"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P55144",
            "gene_name": "Tyro3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P55144",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P55144"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P55144",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P55144"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P55146",
            "gene_name": "Tyro3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P55146",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P55146"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P55146",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P55146"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P57097",
            "gene_name": "Mertk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P57097",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P57097"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P57097",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P57097"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P57760",
            "gene_name": "Stk16",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P57760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P57760"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P57760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P57760"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P57760",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P57760"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P58801",
            "gene_name": "Ripk2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P58801",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P58801"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P58801",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P58801"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P58801",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P58801"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P63000",
            "gene_name": "RAC1",
            "activity": [
                {
                    "ec_number": "3.6.5.2",
                    "activity": "GTP + H2O = GDP + H(+) + phosphate.",
                    "evidence": [
                        {
                            "id": "P63000",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P63000"
                        }
                    ]
                },
                {
                    "ec_number": "3.6.5.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P63000",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P63000"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P70236",
            "gene_name": "Map2k6",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P70236",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P70236"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P70236",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P70236"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P70424",
            "gene_name": "Erbb2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P70424",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P70424"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P70424",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P70424"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P70451",
            "gene_name": "Fer",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P70451",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P70451"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P70451",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P70451"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P70600",
            "gene_name": "Ptk2b",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P70600",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P70600"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P70600",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P70600"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P83102",
            "gene_name": "Dyrk3",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "P83102",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P83102"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P83102",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P83102"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P97504",
            "gene_name": "Bmx",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P97504",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P97504"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P97504",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P97504"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P97523",
            "gene_name": "Met",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P97523",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P97523"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P97523",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P97523"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "P97793",
            "gene_name": "Alk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "P97793",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P97793"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "P97793",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/P97793"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q00342",
            "gene_name": "Flt3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q00342",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q00342"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q00342",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q00342"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q00495",
            "gene_name": "Csf1r",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q00495",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q00495"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q00495",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q00495"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q00993",
            "gene_name": "Axl",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q00993",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q00993"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q00993",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q00993"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q01134",
            "gene_name": "Chka",
            "activity": [
                {
                    "ec_number": "2.7.1.82",
                    "activity": "ATP + ethanolamine = ADP + H(+) + phosphoethanolamine.",
                    "evidence": [
                        {
                            "id": "Q01134",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01134"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.82",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q01134",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01134"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.32",
                    "activity": "ATP + choline = ADP + H(+) + phosphocholine.",
                    "evidence": [
                        {
                            "id": "Q01134",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01134"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.1.32",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q01134",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01134"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q01279",
            "gene_name": "Egfr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q01279",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01279"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q01279",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01279"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q01621",
            "gene_name": "Lck",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q01621",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01621"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q01621",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01621"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q01638",
            "gene_name": "IL1RL1",
            "activity": [
                {
                    "ec_number": "3.2.2.6",
                    "activity": "H2O + NAD(+) = ADP-D-ribose + H(+) + nicotinamide.",
                    "evidence": [
                        {
                            "id": "Q01638",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01638"
                        }
                    ]
                },
                {
                    "ec_number": "3.2.2.6",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q01638",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01638"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q01887",
            "gene_name": "Ryk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q01887",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01887"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q01887",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01887"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q01974",
            "gene_name": "ROR2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q01974",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01974"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q01974",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01974"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q01986",
            "gene_name": "Map2k1",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q01986",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01986"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q01986",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q01986"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q02750",
            "gene_name": "MAP2K1",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q02750",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q02750"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q02750",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q02750"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q02763",
            "gene_name": "TEK",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q02763",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q02763"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q02763",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q02763"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q02858",
            "gene_name": "Tek",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q02858",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q02858"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q02858",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q02858"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q03137",
            "gene_name": "Epha4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q03137",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03137"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q03137",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03137"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q03142",
            "gene_name": "Fgfr4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q03142",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03142"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q03142",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03142"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q03145",
            "gene_name": "Epha2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q03145",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03145"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q03145",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03145"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q03146",
            "gene_name": "Ddr1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q03146",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03146"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q03146",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03146"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q03351",
            "gene_name": "Ntrk3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q03351",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03351"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q03351",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03351"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q03526",
            "gene_name": "Itk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q03526",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03526"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q03526",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03526"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q03963",
            "gene_name": "Eif2ak2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q03963",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03963"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q03963",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03963"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q03963",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q03963"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q04589",
            "gene_name": "Fgfr1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q04589",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q04589"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q04589",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q04589"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q04736",
            "gene_name": "Yes1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q04736",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q04736"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q04736",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q04736"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q04912",
            "gene_name": "MST1R",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q04912",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q04912"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q04912",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q04912"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q05030",
            "gene_name": "Pdgfrb",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q05030",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q05030"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q05030",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q05030"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q05397",
            "gene_name": "PTK2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q05397",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q05397"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q05397",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q05397"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q05655",
            "gene_name": "PRKCD",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q05655",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q05655"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.13",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q05655",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q05655"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.13",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q05655",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q05655"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q06124",
            "gene_name": "PTPN11",
            "activity": [
                {
                    "ec_number": "3.1.3.48",
                    "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.",
                    "evidence": [
                        {
                            "id": "Q06124",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q06124"
                        }
                    ]
                },
                {
                    "ec_number": "3.1.3.48",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q06124",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q06124"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q06187",
            "gene_name": "BTK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q06187",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q06187"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q06187",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q06187"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q06418",
            "gene_name": "TYRO3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q06418",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q06418"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q06418",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q06418"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q06806",
            "gene_name": "Tie1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q06806",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q06806"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q06806",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q06806"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q07014",
            "gene_name": "Lyn",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q07014",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q07014"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q07014",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q07014"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q07407",
            "gene_name": "htl",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q07407",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q07407"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q07407",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q07407"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q07912",
            "gene_name": "TNK2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q07912",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q07912"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q07912",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q07912"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q07912",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q07912"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q07912",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q07912"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q08345",
            "gene_name": "DDR1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q08345",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q08345"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q08345",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q08345"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q08881",
            "gene_name": "ITK",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q08881",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q08881"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q08881",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q08881"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q09147",
            "gene_name": "btl",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q09147",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q09147"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q09147",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q09147"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q12866",
            "gene_name": "MERTK",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q12866",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q12866"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q12866",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q12866"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q13163",
            "gene_name": "MAP2K5",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q13163",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13163"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q13163",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13163"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q13470",
            "gene_name": "TNK1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q13470",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13470"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q13470",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13470"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q13554",
            "gene_name": "CAMK2B",
            "activity": [
                {
                    "ec_number": "2.7.11.17",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q13554",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13554"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.17",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q13554",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13554"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q13555",
            "gene_name": "CAMK2G",
            "activity": [
                {
                    "ec_number": "2.7.11.17",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q13555",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13555"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.17",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q13555",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13555"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q13557",
            "gene_name": "CAMK2D",
            "activity": [
                {
                    "ec_number": "2.7.11.17",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q13557",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13557"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.17",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q13557",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13557"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q13627",
            "gene_name": "DYRK1A",
            "activity": [
                {
                    "ec_number": "2.7.11.23",
                    "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].",
                    "evidence": [
                        {
                            "id": "Q13627",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13627"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q13627",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13627"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.23",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q13627",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13627"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q13627",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13627"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q13882",
            "gene_name": "PTK6",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q13882",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13882"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q13882",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q13882"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q14289",
            "gene_name": "PTK2B",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q14289",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q14289"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q14289",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q14289"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q14680",
            "gene_name": "MELK",
            "activity": [
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q14680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q14680"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q14680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q14680"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q14680",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q14680"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q15303",
            "gene_name": "ERBB4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q15303",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q15303"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q15303",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q15303"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q15375",
            "gene_name": "EPHA7",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q15375",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q15375"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q15375",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q15375"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q15569",
            "gene_name": "TESK1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q15569",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q15569"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q15569",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q15569"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q16288",
            "gene_name": "NTRK3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q16288",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q16288"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q16288",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q16288"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q16620",
            "gene_name": "NTRK2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q16620",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q16620"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q16620",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q16620"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q16832",
            "gene_name": "DDR2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q16832",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q16832"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q16832",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q16832"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q23977",
            "gene_name": "hep",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q23977",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q23977"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q23977",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q23977"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q24145",
            "gene_name": "Shark",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q24145",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q24145"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q24145",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q24145"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q24324",
            "gene_name": "Dsor1",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q24324",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q24324"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q24324",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q24324"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q24488",
            "gene_name": "Ror",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q24488",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q24488"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q24488",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q24488"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q24592",
            "gene_name": "hop",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q24592",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q24592"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q24592",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q24592"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q27324",
            "gene_name": "drl",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q27324",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q27324"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q27324",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q27324"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q3UFB7",
            "gene_name": "Ntrk1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q3UFB7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q3UFB7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q3UFB7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q3UFB7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q498D6",
            "gene_name": "Fgfr4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q498D6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q498D6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q498D6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q498D6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q4JIM5",
            "gene_name": "Abl2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q4JIM5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4JIM5"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q4JIM5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4JIM5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q4KM97",
            "gene_name": "Blk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q4KM97",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4KM97"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q4KM97",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4KM97"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q4KSH6",
            "gene_name": "Map2k4",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q4KSH6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4KSH6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q4KSH6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4KSH6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q4KSH7",
            "gene_name": "Map2k7",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q4KSH7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4KSH7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q4KSH7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4KSH7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q4V8A3",
            "gene_name": "Dyrk3",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q4V8A3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4V8A3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q4V8A3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q4V8A3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q501W1",
            "gene_name": "Txk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q501W1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q501W1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q501W1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q501W1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q504Y2",
            "gene_name": "PKDCC",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q504Y2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q504Y2"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q504Y2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q504Y2"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q54BC9",
            "gene_name": "dyrk2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q54BC9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54BC9"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q54BC9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54BC9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q54G28",
            "gene_name": "",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q54G28",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54G28"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q54G28",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54G28"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q54I36",
            "gene_name": "pyk3",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q54I36",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54I36"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q54I36",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54I36"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q54N73",
            "gene_name": "7tmk1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q54N73",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54N73"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q54N73",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54N73"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q54QV3",
            "gene_name": "yakA",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q54QV3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54QV3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q54QV3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54QV3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q54R58",
            "gene_name": "",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q54R58",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54R58"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q54R58",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q54R58"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q552C6",
            "gene_name": "zak2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q552C6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q552C6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q552C6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q552C6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q55CL6",
            "gene_name": "mekA",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q55CL6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q55CL6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q55CL6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q55CL6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q5FVG7",
            "gene_name": "Srms",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q5FVG7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5FVG7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5FVG7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5FVG7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q5JZY3",
            "gene_name": "EPHA10",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q5JZY3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5JZY3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5JZY3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5JZY3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q5RJI4",
            "gene_name": "Pkdcc",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q5RJI4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5RJI4"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5RJI4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5RJI4"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q5U2X5",
            "gene_name": "Tnk2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q5U2X5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5U2X5"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5U2X5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5U2X5"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q5U2X5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5U2X5"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5U2X5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5U2X5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q5U4C9",
            "gene_name": "Dyrk2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q5U4C9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5U4C9"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q5U4C9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q5U4C9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q60629",
            "gene_name": "Epha5",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q60629",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q60629"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q60629",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q60629"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q60750",
            "gene_name": "Epha1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q60750",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q60750"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q60750",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q60750"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q60751",
            "gene_name": "Igf1r",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q60751",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q60751"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q60751",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q60751"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q60805",
            "gene_name": "Mertk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q60805",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q60805"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q60805",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q60805"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q61006",
            "gene_name": "Musk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q61006",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61006"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q61006",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61006"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q61214",
            "gene_name": "Dyrk1a",
            "activity": [
                {
                    "ec_number": "2.7.11.23",
                    "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].",
                    "evidence": [
                        {
                            "id": "Q61214",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61214"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q61214",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61214"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q61214",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61214"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.23",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q61214",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61214"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q61526",
            "gene_name": "Erbb3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q61526",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61526"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q61526",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61526"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q61527",
            "gene_name": "Erbb4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q61527",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61527"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q61527",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61527"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q61772",
            "gene_name": "Epha7",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q61772",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61772"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q61772",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61772"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q61846",
            "gene_name": "Melk",
            "activity": [
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q61846",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61846"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q61846",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61846"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q61846",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61846"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q61851",
            "gene_name": "Fgfr3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q61851",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61851"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q61851",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q61851"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62120",
            "gene_name": "Jak2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62120",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62120"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62120",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62120"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62137",
            "gene_name": "Jak3",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62137",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62137"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62137",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62137"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62190",
            "gene_name": "Mst1r",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62190",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62190"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62190",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62190"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62270",
            "gene_name": "Srms",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62270",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62270"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62270",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62270"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62371",
            "gene_name": "Ddr2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62371",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62371"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62371",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62371"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62413",
            "gene_name": "Epha6",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62413",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62413"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62413",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62413"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62662",
            "gene_name": "Frk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62662",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62662"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62662",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62662"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62689",
            "gene_name": "Jak2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62689",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62689"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62689",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62689"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62799",
            "gene_name": "Erbb3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62799",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62799"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62799",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62799"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62838",
            "gene_name": "Musk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62838",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62838"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62838",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62838"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62844",
            "gene_name": "Fyn",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62844",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62844"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62844",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62844"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62862",
            "gene_name": "Map2k5",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62862",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62862"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62862",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62862"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q62956",
            "gene_name": "Erbb4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q62956",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62956"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q62956",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q62956"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63116",
            "gene_name": "Kit",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63116",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63116"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63116",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63116"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63117",
            "gene_name": "Clk3",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63117",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63117"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63117",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63117"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63132",
            "gene_name": "Ros1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63132",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63132"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63132",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63132"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63184",
            "gene_name": "Eif2ak2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63184",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63184"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63184",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63184"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63184",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63184"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63272",
            "gene_name": "Jak3",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63272",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63272"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63272",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63272"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63470",
            "gene_name": "Dyrk1a",
            "activity": [
                {
                    "ec_number": "2.7.11.23",
                    "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].",
                    "evidence": [
                        {
                            "id": "Q63470",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63470"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63470",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63470"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.23",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63470",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63470"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63470",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63470"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63474",
            "gene_name": "Ddr1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63474",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63474"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63474",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63474"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63572",
            "gene_name": "Tesk1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63572",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63572"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63572",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63572"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63604",
            "gene_name": "Ntrk2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63604",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63604"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63604",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63604"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63802",
            "gene_name": "Wee1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63802",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63802"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63802",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63802"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q63932",
            "gene_name": "Map2k2",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q63932",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63932"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q63932",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q63932"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q64434",
            "gene_name": "Ptk6",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q64434",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q64434"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q64434",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q64434"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q64716",
            "gene_name": "Insrr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q64716",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q64716"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q64716",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q64716"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q64725",
            "gene_name": "Syk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q64725",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q64725"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q64725",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q64725"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q66JT0",
            "gene_name": "Wee2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q66JT0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q66JT0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q66JT0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q66JT0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q6J9G0",
            "gene_name": "STYK1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q6J9G0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6J9G0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q6J9G0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6J9G0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q6J9G1",
            "gene_name": "Styk1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q6J9G1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6J9G1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q6J9G1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6J9G1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q6P6U0",
            "gene_name": "Fgr",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q6P6U0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6P6U0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q6P6U0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6P6U0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q6VNS1",
            "gene_name": "Ntrk3",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q6VNS1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6VNS1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q6VNS1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6VNS1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q6XUX1",
            "gene_name": "Dstyk",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q6XUX1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6XUX1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q6XUX1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6XUX1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q6XUX2",
            "gene_name": "Dstyk",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q6XUX2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6XUX2"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q6XUX2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6XUX2"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q6XUX3",
            "gene_name": "DSTYK",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q6XUX3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6XUX3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q6XUX3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q6XUX3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q75JK0",
            "gene_name": "zakA",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q75JK0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q75JK0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q75JK0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q75JK0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q76NV1",
            "gene_name": "dyrk1",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q76NV1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q76NV1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q76NV1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q76NV1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q78DX7",
            "gene_name": "Ros1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q78DX7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q78DX7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q78DX7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q78DX7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q7KJ08",
            "gene_name": "Alk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q7KJ08",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q7KJ08"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q7KT06",
            "gene_name": "Ret",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q7KT06",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q7KT06"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q8BI55",
            "gene_name": "Dyrk4",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q8BI55",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8BI55"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q8BI55",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8BI55"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q8BYG9",
            "gene_name": "Epha10",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q8BYG9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8BYG9"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q8BYG9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8BYG9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q8CBF3",
            "gene_name": "Ephb1",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q8CBF3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8CBF3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q8CBF3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8CBF3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q8CE90",
            "gene_name": "Map2k7",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q8CE90",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8CE90"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q8CE90",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8CE90"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q8INJ8",
            "gene_name": "Csk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q8INJ8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8INJ8"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q8INJ8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8INJ8"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q8VCT9",
            "gene_name": "Tesk2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q8VCT9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8VCT9"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q8VCT9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q8VCT9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q91ZT1",
            "gene_name": "Flt4",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q91ZT1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q91ZT1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q91ZT1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q91ZT1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q922K9",
            "gene_name": "Frk",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q922K9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q922K9"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q922K9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q922K9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q922Y0",
            "gene_name": "Dyrk3",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q922Y0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q922Y0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q922Y0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q922Y0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q924U5",
            "gene_name": "Tesk2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q924U5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q924U5"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q924U5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q924U5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q925D6",
            "gene_name": "Map2k6",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q925D6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q925D6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q925D6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q925D6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q92630",
            "gene_name": "DYRK2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q92630",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q92630"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q92630",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q92630"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q92729",
            "gene_name": "PTPRU",
            "activity": [
                {
                    "ec_number": "3.1.3.48",
                    "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.",
                    "evidence": [
                        {
                            "id": "Q92729",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q92729"
                        }
                    ]
                },
                {
                    "ec_number": "3.1.3.48",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q92729",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q92729"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q96KB5",
            "gene_name": "PBK",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q96KB5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q96KB5"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q96KB5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q96KB5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q96S53",
            "gene_name": "TESK2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q96S53",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q96S53"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q96S53",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q96S53"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q99ML2",
            "gene_name": "Tnk1",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q99ML2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q99ML2"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q99ML2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q99ML2"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9H3Y6",
            "gene_name": "SRMS",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9H3Y6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9H3Y6"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9H3Y6",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9H3Y6"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9HAZ1",
            "gene_name": "CLK4",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9HAZ1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9HAZ1"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9HAZ1",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9HAZ1"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9I7F7",
            "gene_name": "Ack-like",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9I7F7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9I7F7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9I7F7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9I7F7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9JJ78",
            "gene_name": "Pbk",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9JJ78",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9JJ78"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9JJ78",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9JJ78"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9NR20",
            "gene_name": "DYRK4",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9NR20",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9NR20"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9NR20",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9NR20"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9NWZ3",
            "gene_name": "IRAK4",
            "activity": [
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9NWZ3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9NWZ3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9NWZ3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9NWZ3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9QVP9",
            "gene_name": "Ptk2b",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9QVP9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9QVP9"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9QVP9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9QVP9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9R117",
            "gene_name": "Tyk2",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9R117",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9R117"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9R117",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9R117"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9UF33",
            "gene_name": "EPHA6",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9UF33",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9UF33"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9UF33",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9UF33"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9UIG0",
            "gene_name": "BAZ1B",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9UIG0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9UIG0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9UIG0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9UIG0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9UM73",
            "gene_name": "ALK",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9UM73",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9UM73"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9UM73",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9UM73"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9UQM7",
            "gene_name": "CAMK2A",
            "activity": [
                {
                    "ec_number": "2.7.11.17",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9UQM7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9UQM7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.17",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9UQM7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9UQM7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9V3D5",
            "gene_name": "Dyrk2",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9V3D5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9V3D5"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9V3D5",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9V3D5"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9V422",
            "gene_name": "dnt",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9V422",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9V422"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9V422",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9V422"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9V6K3",
            "gene_name": "Nrk",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9V6K3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9V6K3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9V6K3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9V6K3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9V9J3",
            "gene_name": "Src42A",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9V9J3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9V9J3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9V9J3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9V9J3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9VBW3",
            "gene_name": "Cad96Ca",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9VBW3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VBW3"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9VBW3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VBW3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9VE06",
            "gene_name": "cdi",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9VE06",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VE06"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9VE06",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VE06"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9VJ04",
            "gene_name": "Dmel\\CG10702",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9VJ04",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VJ04"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9VJ04",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VJ04"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9VPC0",
            "gene_name": "Pitslre",
            "activity": [
                {
                    "ec_number": "2.7.11.22",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9VPC0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VPC0"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.22",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9VPC0",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VPC0"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9VZA8",
            "gene_name": "Tie",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9VZA8",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VZA8"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9VZI2",
            "gene_name": "Ack",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9VZI2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VZI2"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9VZI2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VZI2"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.11.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9VZI2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VZI2"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9VZI2",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9VZI2"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9WTL4",
            "gene_name": "Insrr",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9WTL4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9WTL4"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9WTL4",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9WTL4"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9WUD9",
            "gene_name": "Src",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9WUD9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9WUD9"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9WUD9",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9WUD9"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9WVS7",
            "gene_name": "Map2k5",
            "activity": [
                {
                    "ec_number": "2.7.12.2",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9WVS7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9WVS7"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9WVS7",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9WVS7"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9Y463",
            "gene_name": "DYRK1B",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9Y463",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9Y463"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9Y463",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9Y463"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9Y4K3",
            "gene_name": "TRAF6",
            "activity": [
                {
                    "ec_number": "2.3.2.27",
                    "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.",
                    "evidence": [
                        {
                            "id": "Q9Y4K3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9Y4K3"
                        }
                    ]
                },
                {
                    "ec_number": "2.3.2.27",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9Y4K3",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9Y4K3"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9Z138",
            "gene_name": "Ror2",
            "activity": [
                {
                    "ec_number": "2.7.10.1",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9Z138",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9Z138"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9Z138",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9Z138"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9Z188",
            "gene_name": "Dyrk1b",
            "activity": [
                {
                    "ec_number": "2.7.12.1",
                    "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9Z188",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9Z188"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.12.1",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9Z188",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9Z188"
                        }
                    ]
                }
            ]
        },
        {
            "uniprot_ac": "Q9Z277",
            "gene_name": "Baz1b",
            "activity": [
                {
                    "ec_number": "2.7.10.2",
                    "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
                    "evidence": [
                        {
                            "id": "Q9Z277",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9Z277"
                        }
                    ]
                },
                {
                    "ec_number": "2.7.10.2",
                    "activity": "",
                    "evidence": [
                        {
                            "id": "Q9Z277",
                            "database": "UniProtKB",
                            "url": "https://www.uniprot.org/uniprot/Q9Z277"
                        }
                    ]
                }
            ]
        }
    ],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        },
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        }
    ],
    "sequence_features": {
        "n_linked_sites": [
            130,
            145,
            283,
            293,
            300,
            320,
            352,
            367,
            463,
            486
        ],
        "o_linked_sites": [],
        "snv_sites": [
            49,
            77,
            90,
            93,
            107,
            130,
            132,
            145,
            257,
            276,
            293,
            295,
            300,
            316,
            322,
            352,
            354,
            367,
            369,
            373,
            402,
            425,
            463,
            465,
            486,
            488,
            559,
            560,
            566,
            568,
            576,
            642,
            654,
            670,
            715,
            716,
            771,
            816,
            820,
            822,
            823,
            888,
            952
        ],
        "glycation_sites": [],
        "phosphorylation_sites": [
            354,
            362,
            501,
            545,
            547,
            553,
            568,
            570,
            670,
            703,
            721,
            730,
            741,
            746,
            747,
            821,
            823,
            891,
            900,
            936,
            959
        ],
        "sequon_annotation_sites": [
            {
                "start_pos": 130,
                "end_pos": 132
            },
            {
                "start_pos": 145,
                "end_pos": 147
            },
            {
                "start_pos": 283,
                "end_pos": 285
            },
            {
                "start_pos": 293,
                "end_pos": 295
            },
            {
                "start_pos": 300,
                "end_pos": 302
            },
            {
                "start_pos": 320,
                "end_pos": 322
            },
            {
                "start_pos": 352,
                "end_pos": 354
            },
            {
                "start_pos": 367,
                "end_pos": 369
            },
            {
                "start_pos": 463,
                "end_pos": 465
            },
            {
                "start_pos": 486,
                "end_pos": 488
            },
            {
                "start_pos": 819,
                "end_pos": 821
            },
            {
                "start_pos": 941,
                "end_pos": 943
            }
        ]
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 14
                },
                {
                    "field": "total_sites",
                    "count": 10
                },
                {
                    "field": "n_linked_glycans",
                    "count": 4
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 12
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 9
                },
                {
                    "field": "total_sites",
                    "count": 9
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 9
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 4
                },
                {
                    "field": "total_sites",
                    "count": 2
                },
                {
                    "field": "n_linked_glycans",
                    "count": 4
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 2
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 1
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 36
                },
                {
                    "field": "total_sites",
                    "count": 21
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "kinase_uniprot_canonical_ac",
                "kinase_gene_name",
                "residue",
                "comment",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 60
                },
                {
                    "field": "total_sites",
                    "count": 43
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "subjects_tested",
                "subjects_positive",
                "frequency",
                "sequence_org",
                "sequence_mut",
                "comment",
                "chr_id",
                "chr_pos",
                "ref_nt",
                "alt_nt",
                "minor_allelic_frequency",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 49
                },
                {
                    "field": "total_sites",
                    "count": 39
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "subjects_tested",
                "subjects_positive",
                "frequency",
                "sequence_org",
                "sequence_mut",
                "comment",
                "chr_id",
                "chr_pos",
                "ref_nt",
                "alt_nt",
                "minor_allelic_frequency",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 11
                },
                {
                    "field": "total_sites",
                    "count": 10
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "subjects_tested",
                "subjects_positive",
                "frequency",
                "sequence_org",
                "sequence_mut",
                "comment",
                "chr_id",
                "chr_pos",
                "ref_nt",
                "alt_nt",
                "minor_allelic_frequency",
                "site_lbl"
            ]
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 409
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}