{ "uniprot_canonical_ac": "P10646-1", "uniprot_ac": "P10646", "uniprot_id": "TFPI1_HUMAN", "mass": { "chemical_mass": 35015.0, "monoisotopic_mass": 35015.0 }, "refseq": { "ac": "NP_001027452", "name": "tissue factor pathway inhibitor isoform b precursor", "summary": "This gene encodes a Kunitz-type serine protease inhibitor that regulates the tissue factor (TF)-dependent pathway of blood coagulation. The coagulation process initiates with the formation of a factor VIIa-TF complex, which proteolytically activates additional proteases (factors IX and X) and ultimately leads to the formation of a fibrin clot. The product of this gene inhibits the activated factor X and VIIa-TF proteases in an autoregulatory loop. Inhibition of the encoded protein restores hemostasis in animal models of hemophilia. This gene encodes multiple protein isoforms that differ in their inhibitory activity, specificity and cellular localization. [provided by RefSeq, Jul 2016].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027452" }, "gene_names": [ { "name": "TFPI", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P10646", "id": "P10646" }, { "name": "EPI; LACI; TFI; TFPI1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027452", "id": "NP_001027452" }, { "name": "LACI", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P10646", "id": "P10646" }, { "name": "TFPI1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P10646", "id": "P10646" }, { "name": "TFPI", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027452", "id": "NP_001027452" } ], "protein_names": [ { "name": "Tissue factor pathway inhibitor", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P10646" }, { "name": "EPI", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10646" }, { "name": "Extrinsic pathway inhibitor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10646" }, { "name": "LACI", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10646" }, { "name": "Lipoprotein-associated coagulation inhibitor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10646" }, { "name": "TFPI", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10646" }, { "name": "anti-convertin; extrinsic pathway inhibitor; tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027452", "id": "NP_001027452" }, { "name": "tissue factor pathway inhibitor isoform b precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027452", "id": "NP_001027452" } ], "function": [ { "annotation": "Activated protein C, protein S, and tissue factor pathway inhibitor cooperate to inhibit thrombin activation.", "evidence": [ { "database": "RefSeq", "id": "NP_001027452", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027452" }, { "database": "PubMed", "id": "37660436", "url": "https://glygen.org/publication/PubMed/37660436" } ] }, { "annotation": "Effects of human TFPI and CD47 expression and selectin and integrin inhibition during GalTKO.hCD46 pig lung perfusion with human blood.", "evidence": [ { "database": "RefSeq", "id": "NP_001027452", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027452" }, { "database": "PubMed", "id": "35234315", "url": "https://glygen.org/publication/PubMed/35234315" } ] }, { "annotation": "Endothelial-dependent S-Sulfhydration of tissue factor pathway inhibitor regulates blood coagulation.", "evidence": [ { "database": "RefSeq", "id": "NP_001027452", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027452" }, { "database": "PubMed", "id": "37030150", "url": "https://glygen.org/publication/PubMed/37030150" } ] }, { "annotation": "Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646#function" } ] }, { "annotation": "Mutations of TFPI-binding exosites on factor VII cause bleeding phenotypes in factor VII deficiency.", "evidence": [ { "database": "RefSeq", "id": "NP_001027452", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027452" }, { "database": "PubMed", "id": "35973191", "url": "https://glygen.org/publication/PubMed/35973191" } ] }, { "annotation": "This gene encodes a Kunitz-type serine protease inhibitor that regulates the tissue factor (TF)-dependent pathway of blood coagulation. The coagulation process initiates with the formation of a factor VIIa-TF complex, which proteolytically activates additional proteases (factors IX and X) and ultimately leads to the formation of a fibrin clot. The product of this gene inhibits the activated factor X and VIIa-TF proteases in an autoregulatory loop. Inhibition of the encoded protein restores hemostasis in animal models of hemophilia. This gene encodes multiple protein isoforms that differ in their inhibitory activity, specificity and cellular localization. [provided by RefSeq, Jul 2016].", "evidence": [ { "database": "RefSeq", "id": "NP_001027452", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027452" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs1471884159", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1471884159" }, { "id": "rs1471884159", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1471884159" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 114, "end_pos": 114, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KTT->NTT).", "chr_id": "2", "chr_pos": "187488353", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K114", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1414724546", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1414724546" }, { "id": "rs1414724546", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1414724546" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 116, "end_pos": 116, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "2", "chr_pos": "187488348", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T116", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1574398819", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1574398819" }, { "id": "rs1574398819", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1574398819" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 145, "end_pos": 145, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->YQT).", "chr_id": "2", "chr_pos": "187484913", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N145", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs145362964", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145362964" }, { "id": "rs145362964", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs145362964" }, { "id": "rs145362964", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145362964" }, { "id": "rs145362964", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs145362964#frequency_tab" }, { "id": "rs145362964", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs145362964" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 147, "end_pos": 147, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NQT->NQK).", "chr_id": "2", "chr_pos": "187484906", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.003395", "site_lbl": "T147", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs890858430", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs890858430" }, { "id": "rs890858430", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs890858430" }, { "id": "rs890858430", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs890858430#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 195, "end_pos": 195, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->KNS).", "chr_id": "2", "chr_pos": "187484167", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N195", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1387745873", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1387745873" }, { "id": "rs1387745873", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1387745873#frequency_tab" }, { "id": "rs1387745873", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1387745873" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 195, "end_pos": 195, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->SNS).", "chr_id": "2", "chr_pos": "187484168", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N195", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1387745873", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1387745873" }, { "id": "rs1387745873", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1387745873#frequency_tab" }, { "id": "rs1387745873", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1387745873" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 195, "end_pos": 195, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNS->TNS).", "chr_id": "2", "chr_pos": "187484168", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N195", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1158632431", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1158632431" }, { "id": "rs1158632431", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1158632431#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 22, "end_pos": 22, "sequence_org": "A", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLA->NLS).", "chr_id": "2", "chr_pos": "187503705", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A22", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs369191990", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369191990" }, { "id": "rs369191990", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs369191990" }, { "id": "rs369191990", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369191990" }, { "id": "rs369191990", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs369191990#frequency_tab" }, { "id": "rs369191990", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs369191990" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 42, "end_pos": 42, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->K).", "chr_id": "2", "chr_pos": "187497075", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T42", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "P10646", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10646" }, { "id": "rs369191990", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369191990" }, { "id": "rs369191990", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs369191990" }, { "id": "rs369191990", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369191990" }, { "id": "rs369191990", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs369191990" }, { "id": "rs369191990", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs369191990#frequency_tab" }, { "id": "rs369191990", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs369191990" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 42, "end_pos": 42, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "M", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->M).", "chr_id": "2", "chr_pos": "187497075", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "T42", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ] }, { "evidence": [ { "id": "P10646", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10646" } ], "glycoeffect": [], "start_pos": 80, "end_pos": 80, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "E", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "2", "chr_pos": "187496962", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "E80", "disease": [ { "disease_id": "DOID:4362", "recommended_name": { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical cancer", "description": "A female reproductive organ cancer that is located_in the cervix." }, "synonyms": [ { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical neoplasm", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix uteri cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "neoplasm of uterine cervix", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "tumor of the Cervix Uteri", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer", "description": "A primary or metastatic malignant neoplasm involving the cervix." }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cancer of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer, somatic", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix uteri cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervix cancer", "description": "" }, { "id": "MIM:603956", "resource": "MIM", "url": "https://www.omim.org/entry/603956", "name": "Cervical cancer", "description": "Cervical cancer" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [ { "start_pos": 135, "end_pos": 135, "sequence_org": "R", "sequence_mut": "L", "comment": "Abolishes inhibition of X(a).", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ] }, { "start_pos": 227, "end_pos": 227, "sequence_org": "R", "sequence_mut": "L", "comment": "Abolishes inhibition of VII(a)/TF.", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ] }, { "start_pos": 64, "end_pos": 64, "sequence_org": "K", "sequence_mut": "I", "comment": "Abolishes inhibition of VII(a)/TF.", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "91.92", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000003436", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003436" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "86.51", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000003436", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003436" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "86.02", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000003436", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003436" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "80.33", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000003436", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003436" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "98.35", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000003436", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003436" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "93.18", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000003436", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003436" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "73.05", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000003436", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003436" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "93.65", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000003436", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003436" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "92.57", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000003436", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003436" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "98.22", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000003436", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003436" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "98.89", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000003436", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003436" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "81.72", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000003436", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003436" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "92.46", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000003436", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003436" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P10646", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10646" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P10646", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10646" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P10646", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10646" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P10646", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10646" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P10646", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10646" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P10646", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10646" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P10646", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10646" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P10646", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10646" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P10646", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10646" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P10646", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10646" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P10646", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10646" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P10646", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10646" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "common_name": "Human" } ], "gene": [ { "name": "TFPI", "url": "https://www.uniprot.org/uniprot/P10646", "locus": { "chromosome": "2", "start_pos": 106531, "end_pos": 16326, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "LRG_604", "url": "https://www.ensembl.org/id/LRG_604" } ] } } ], "crossref": [ { "id": "ENSG00000003436", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003436", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P10646", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10646", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd22613", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd22613", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd22614", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd22614", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd22615", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd22615", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL3713062", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3713062", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "TFPI", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=TFPI", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "7035", "url": "https://www.ncbi.nlm.nih.gov/gene/7035", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "602", "url": "https://glyconnect.expasy.org/browser/proteins/602", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "11760", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=11760", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P10646", "url": "https://www.ebi.ac.uk/intact/interactors/id:P10646*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002223", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002223", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008296", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008296", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020901", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020901", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036880", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036880", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:7035", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7035", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "152310", "url": "http://www.omim.org/entry/152310", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P10646", "url": "https://www.nextprot.org/entry/NX_P10646", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "WWILCAV", "url": "https://omabrowser.org/oma/group/WWILCAV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3558236at2759", "url": "http://www.orthodb.org/?query=3558236at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10083", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10083", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10083:SF217", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10083:SF217", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10083:SF328", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10083:SF328", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1ADZ", "url": "https://www.rcsb.org/structure/1ADZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1IRH", "url": "https://www.rcsb.org/structure/1IRH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1TFX", "url": "https://www.rcsb.org/structure/1TFX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4BQD", "url": "https://www.rcsb.org/structure/4BQD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4DTG", "url": "https://www.rcsb.org/structure/4DTG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5NMV", "url": "https://www.rcsb.org/structure/5NMV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BX8", "url": "https://www.rcsb.org/structure/6BX8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7V1N", "url": "https://www.rcsb.org/structure/7V1N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00014", "url": "http://pfam.xfam.org/family/PF00014", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P10646", "url": "https://pharos.nih.gov/targets/P10646", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000054774", "url": "https://proconsortium.org/app/entry/PR:000054774", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054775", "url": "https://proconsortium.org/app/entry/PR:000054775", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054776", "url": "https://proconsortium.org/app/entry/PR:000054776", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054777", "url": "https://proconsortium.org/app/entry/PR:000054777", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054778", "url": "https://proconsortium.org/app/entry/PR:000054778", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054779", "url": "https://proconsortium.org/app/entry/PR:000054779", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054780", "url": "https://proconsortium.org/app/entry/PR:000054780", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054781", "url": "https://proconsortium.org/app/entry/PR:000054781", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054782", "url": "https://proconsortium.org/app/entry/PR:000054782", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054783", "url": "https://proconsortium.org/app/entry/PR:000054783", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054784", "url": "https://proconsortium.org/app/entry/PR:000054784", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054785", "url": "https://proconsortium.org/app/entry/PR:000054785", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054786", "url": "https://proconsortium.org/app/entry/PR:000054786", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054787", "url": "https://proconsortium.org/app/entry/PR:000054787", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054788", "url": "https://proconsortium.org/app/entry/PR:000054788", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054789", "url": "https://proconsortium.org/app/entry/PR:000054789", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054790", "url": "https://proconsortium.org/app/entry/PR:000054790", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054791", "url": "https://proconsortium.org/app/entry/PR:000054791", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000054792", "url": "https://proconsortium.org/app/entry/PR:000054792", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_P10646", "url": "http://purl.obolibrary.org/obo/PR_P10646", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-140834", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140834", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001027452", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027452", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P10646", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "C9J103", "url": "https://www.uniprot.org/uniprot/C9J103", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9J103-1", "url": "https://www.uniprot.org/uniprot/C9J103-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JKV3", "url": "https://www.uniprot.org/uniprot/C9JKV3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JKV3-1", "url": "https://www.uniprot.org/uniprot/C9JKV3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JP39", "url": "https://www.uniprot.org/uniprot/C9JP39", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JP39-1", "url": "https://www.uniprot.org/uniprot/C9JP39-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JQ14", "url": "https://www.uniprot.org/uniprot/C9JQ14", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JQ14-1", "url": "https://www.uniprot.org/uniprot/C9JQ14-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JT76", "url": "https://www.uniprot.org/uniprot/C9JT76", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JT76-1", "url": "https://www.uniprot.org/uniprot/C9JT76-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10646-1", "url": "https://www.uniprot.org/uniprot/P10646-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10646-2", "url": "https://www.uniprot.org/uniprot/P10646-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM", "length": 304, "header": "sp|P10646-1|TFPI1_HUMAN Isoform 1 of Tissue factor pathway inhibitor OS=Homo sapiens OX=9606 GN=TFPI PE=1 SV=1 CANONICAL=P10646-1" }, "isoforms": [ { "isoform_ac": "C9J103-1", "url": "", "sequence": { "sequence": "MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFT", "length": 76, "header": "tr|C9J103-1|C9J103_HUMAN Computationally mapped isoform of Tissue factor pathway inhibitor OS=Homo sapiens OX=9606 GN=TFPI PE=1 SV=1 CANONICAL=P10646-1" }, "locus": { "chromosome": "2", "start_pos": 187503768, "end_pos": 187496972, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000417013.5", "url": "https://www.ensembl.org/id/ENST00000417013.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000400179.1", "url": "https://www.ensembl.org/id/ENSP00000400179.1" } ] } }, { "isoform_ac": "C9JKV3-1", "url": "", "sequence": { "sequence": "MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTREKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRA", "length": 215, "header": "tr|C9JKV3-1|C9JKV3_HUMAN Computationally mapped isoform of Tissue factor pathway inhibitor OS=Homo sapiens OX=9606 GN=TFPI PE=1 SV=1 CANONICAL=P10646-1" }, "locus": { "chromosome": "2", "start_pos": 187503768, "end_pos": 187467877, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000435414.5", "url": "https://www.ensembl.org/id/ENST00000435414.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000409177.1", "url": "https://www.ensembl.org/id/ENSP00000409177.1" } ] } }, { "isoform_ac": "C9JP39-1", "url": "", "sequence": { "sequence": "MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDG", "length": 61, "header": "tr|C9JP39-1|C9JP39_HUMAN Computationally mapped isoform of Tissue factor pathway inhibitor OS=Homo sapiens OX=9606 GN=TFPI PE=4 SV=1 CANONICAL=P10646-1" }, "locus": { "chromosome": "2", "start_pos": 187503768, "end_pos": 187497017, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000420747.1", "url": "https://www.ensembl.org/id/ENST00000420747.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000402954.1", "url": "https://www.ensembl.org/id/ENSP00000402954.1" } ] } }, { "isoform_ac": "C9JQ14-1", "url": "", "sequence": { "sequence": "MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTR", "length": 106, "header": "tr|C9JQ14-1|C9JQ14_HUMAN Computationally mapped isoform of Tissue factor pathway inhibitor OS=Homo sapiens OX=9606 GN=TFPI PE=1 SV=1 CANONICAL=P10646-1" }, "locus": { "chromosome": "2", "start_pos": 187503768, "end_pos": 187496882, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000437725.5", "url": "https://www.ensembl.org/id/ENST00000437725.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000388159.1", "url": "https://www.ensembl.org/id/ENSP00000388159.1" } ] } }, { "isoform_ac": "C9JT76-1", "url": "", "sequence": { "sequence": "MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCT", "length": 105, "header": "tr|C9JT76-1|C9JT76_HUMAN Computationally mapped isoform of Tissue factor pathway inhibitor OS=Homo sapiens OX=9606 GN=TFPI PE=1 SV=1 CANONICAL=P10646-1" }, "locus": { "chromosome": "2", "start_pos": 187503768, "end_pos": 187496885, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000453013.5", "url": "https://www.ensembl.org/id/ENST00000453013.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000394185.1", "url": "https://www.ensembl.org/id/ENSP00000394185.1" } ] } }, { "isoform_ac": "P10646-1", "url": "", "sequence": { "sequence": "MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM", "length": 304, "header": "sp|P10646-1|TFPI1_HUMAN Isoform 1 of Tissue factor pathway inhibitor OS=Homo sapiens OX=9606 GN=TFPI PE=1 SV=1 CANONICAL=P10646-1" }, "locus": { "chromosome": "2", "start_pos": 187503768, "end_pos": 187466939, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000392365.5", "url": "https://www.ensembl.org/id/ENST00000392365.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000376172.1", "url": "https://www.ensembl.org/id/ENSP00000376172.1" } ] } }, { "isoform_ac": "P10646-2", "url": "", "sequence": { "sequence": "MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFVTKEGTNDGWKNAAHIYQVFLNAFCIHASMFFLGLDSISCLC", "length": 251, "header": "sp|P10646-2|TFPI1_HUMAN Isoform 2 of Tissue factor pathway inhibitor OS=Homo sapiens OX=9606 GN=TFPI PE=1 SV=1 CANONICAL=P10646-1" }, "locus": { "chromosome": "2", "start_pos": 187503768, "end_pos": 187478679, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000409676.5", "url": "https://www.ensembl.org/id/ENST00000409676.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000386344.1", "url": "https://www.ensembl.org/id/ENSP00000386344.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "IIKTTLQQEKPDFCFLEEDPGICR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 112, "start_aa": "Ile", "end_pos": 135, "end_aa": "Arg", "evidence": [ { "id": "P10646", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 115, "start_aa": "Thr", "end_pos": 115, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr115", "evidence": [ { "id": "P10646", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "TTLQQEKPDFCFLEEDPGICR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 115, "start_aa": "Thr", "end_pos": 135, "end_aa": "Arg", "evidence": [ { "id": "P10646", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 116, "start_aa": "Thr", "end_pos": 116, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr116", "evidence": [ { "id": "P10646", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G07947TY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-145, N-195, S-202, T-203", "start_pos": 145, "start_aa": "Asn", "end_pos": 145, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn145", "evidence": [ { "id": "P10646", "database": "UniCarbKB", "url": "" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" }, { "id": "1388166", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1388166" } ] }, { "glytoucan_ac": "G31991IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-145, N-195, S-202, T-203", "start_pos": 145, "start_aa": "Asn", "end_pos": 145, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn145", "evidence": [ { "id": "P10646", "database": "UniCarbKB", "url": "" }, { "id": "1388166", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1388166" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "glytoucan_ac": "G45359RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-145, N-195, S-202, T-203", "start_pos": 145, "start_aa": "Asn", "end_pos": 145, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn145", "evidence": [ { "id": "P10646", "database": "UniCarbKB", "url": "" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" }, { "id": "1388166", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1388166" } ] }, { "glytoucan_ac": "G51562OR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-145, N-195, S-202, T-203", "start_pos": 145, "start_aa": "Asn", "end_pos": 145, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn145", "evidence": [ { "id": "P10646", "database": "UniCarbKB", "url": "" }, { "id": "1388166", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1388166" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "glytoucan_ac": "G63889NK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-145, N-195, S-202, T-203", "start_pos": 145, "start_aa": "Asn", "end_pos": 145, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn145", "evidence": [ { "id": "P10646", "database": "UniCarbKB", "url": "" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" }, { "id": "1388166", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1388166" } ] }, { "glytoucan_ac": "G65832JS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-145, N-195, S-202, T-203", "start_pos": 145, "start_aa": "Asn", "end_pos": 145, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn145", "evidence": [ { "id": "P10646", "database": "UniCarbKB", "url": "" }, { "id": "1388166", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1388166" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-145, N-195, S-202, T-203", "start_pos": 145, "start_aa": "Asn", "end_pos": 145, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn145", "evidence": [ { "id": "P10646", "database": "UniCarbKB", "url": "" }, { "id": "1388166", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1388166" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "glytoucan_ac": "G86357DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-145, N-195, S-202, T-203", "start_pos": 145, "start_aa": "Asn", "end_pos": 145, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn145", "evidence": [ { "id": "P10646", "database": "UniCarbKB", "url": "" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" }, { "id": "1388166", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1388166" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 145, "start_aa": "Asn", "end_pos": 145, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn145", "evidence": [ { "id": "P10646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10646#ptm_processing" }, { "id": "19017259", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19017259" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "glytoucan_ac": "G07947TY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-145, N-195, S-202, T-203", "start_pos": 195, "start_aa": "Asn", "end_pos": 195, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn195", "evidence": [ { "id": "P10646", "database": "UniCarbKB", "url": "" }, { "id": "1388166", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1388166" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "glytoucan_ac": "G31991IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-145, N-195, S-202, T-203", "start_pos": 195, "start_aa": "Asn", "end_pos": 195, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn195", "evidence": [ { "id": "P10646", "database": "UniCarbKB", "url": "" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" }, { "id": "1388166", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1388166" } ] }, { "glytoucan_ac": "G45359RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-145, N-195, S-202, T-203", "start_pos": 195, "start_aa": "Asn", "end_pos": 195, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn195", "evidence": [ { "id": "P10646", "database": "UniCarbKB", "url": "" }, { "id": "1388166", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1388166" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "glytoucan_ac": "G51562OR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-145, N-195, S-202, T-203", "start_pos": 195, "start_aa": "Asn", "end_pos": 195, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn195", "evidence": [ { "id": "P10646", "database": "UniCarbKB", "url": "" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" }, { "id": "1388166", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1388166" } ] }, { "glytoucan_ac": "G63889NK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-145, N-195, S-202, T-203", "start_pos": 195, "start_aa": "Asn", "end_pos": 195, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn195", "evidence": [ { "id": "P10646", "database": "UniCarbKB", "url": "" }, { "id": "1388166", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1388166" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "glytoucan_ac": "G65832JS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-145, N-195, S-202, T-203", "start_pos": 195, "start_aa": "Asn", "end_pos": 195, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn195", "evidence": [ { "id": "P10646", "database": "UniCarbKB", "url": "" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" }, { "id": "1388166", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1388166" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-145, N-195, S-202, T-203", "start_pos": 195, "start_aa": "Asn", "end_pos": 195, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn195", "evidence": [ { "id": "P10646", "database": "UniCarbKB", "url": "" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" }, { "id": "1388166", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1388166" } ] }, { "glytoucan_ac": "G86357DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-145, N-195, S-202, T-203", "start_pos": 195, "start_aa": "Asn", "end_pos": 195, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn195", "evidence": [ { "id": "P10646", "database": "UniCarbKB", "url": "" }, { "id": "1388166", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1388166" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 195, "start_aa": "Asn", "end_pos": 195, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn195", "evidence": [ { "id": "P10646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10646#ptm_processing" }, { "id": "19017259", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19017259" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "glytoucan_ac": "G49632WD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-145, N-195, S-202, T-203", "start_pos": 202, "start_aa": "Ser", "end_pos": 202, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser202", "evidence": [ { "id": "P10646", "database": "UniCarbKB", "url": "" }, { "id": "1388166", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1388166" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine; partial O-GalNAcylation", "start_pos": 202, "start_aa": "Ser", "end_pos": 202, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser202", "evidence": [ { "id": "P10646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10646#ptm_processing" }, { "id": "19017259", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19017259" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 203, "start_aa": "Thr", "end_pos": 203, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr203", "evidence": [ { "id": "P10646", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 203, "start_aa": "Thr", "end_pos": 203, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr203", "evidence": [ { "id": "P10646", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G49632WD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-145, N-195, S-202, T-203", "start_pos": 203, "start_aa": "Thr", "end_pos": 203, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr203", "evidence": [ { "id": "P10646", "database": "UniCarbKB", "url": "" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" }, { "id": "1388166", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1388166" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "start_pos": 203, "start_aa": "Thr", "end_pos": 203, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr203", "evidence": [ { "id": "P10646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10646#ptm_processing" }, { "id": "19017259", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19017259" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 42, "start_aa": "Thr", "end_pos": 42, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr42", "evidence": [ { "id": "P10646", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "site_category": "reported", "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine; partial O-GalNAcylation", "start_pos": 42, "start_aa": "Thr", "end_pos": 42, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr42", "evidence": [ { "id": "P10646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10646#ptm_processing" }, { "id": "19017259", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19017259" } ] }, { "glytoucan_ac": "G07947TY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "602", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/602" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "602", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/602" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "glytoucan_ac": "G24413UY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "602", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/602" }, { "id": "1388166", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1388166" } ] }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "602", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/602" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "glytoucan_ac": "G31544HA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "602", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/602" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "glytoucan_ac": "G31991IV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "602", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/602" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "glytoucan_ac": "G32673DL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "602", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/602" }, { "id": "1388166", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1388166" } ] }, { "glytoucan_ac": "G43984TE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "602", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/602" }, { "id": "1388166", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1388166" } ] }, { "glytoucan_ac": "G45359RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "602", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/602" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "glytoucan_ac": "G45700OA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "602", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/602" }, { "id": "1388166", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1388166" } ] }, { "glytoucan_ac": "G46422KL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "602", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/602" }, { "id": "1388166", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1388166" } ] }, { "glytoucan_ac": "G49632WD", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "602", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/602" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "glytoucan_ac": "G49743VF", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "602", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/602" }, { "id": "1388166", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1388166" } ] }, { "glytoucan_ac": "G51562OR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "602", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/602" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "glytoucan_ac": "G57196QI", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "602", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/602" }, { "id": "1388166", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/1388166" } ] }, { "glytoucan_ac": "G63889NK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "602", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/602" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "glytoucan_ac": "G65832JS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "602", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/602" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "glytoucan_ac": "G70894RY", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "602", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/602" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "602", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/602" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "602", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/602" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "glytoucan_ac": "G86357DX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "602", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/602" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "", "evidence": [ { "id": "602", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/602" }, { "id": "8639592", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8639592" } ] } ], "phosphorylation": [ { "start_pos": 202, "end_pos": 202, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10646", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10646" }, { "database": "PubMed", "id": "22028470", "url": "https://glygen.org/publication/PubMed/22028470" } ], "site_lbl": "Ser202" }, { "start_pos": 30, "end_pos": 30, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10646", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10646" }, { "database": "PubMed", "id": "31364055", "url": "" }, { "database": "phospho.ELM", "id": "P10646", "url": "http://phospho.elm.eu.org/byAccession/P10646.html" }, { "database": "PubMed", "id": "2122883", "url": "https://glygen.org/publication/PubMed/2122883" } ], "site_lbl": "Ser30" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "P10646", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "Characterization of single-nucleotide polymorphisms in coding regions of human genes.", "journal": "Nat. Genet.", "date": "1999", "authors": "Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "reference": [ { "type": "PubMed", "id": "10391209", "url": "https://glygen.org/publication/PubMed/10391209" } ] }, { "title": "Structural mechanism for heparin-binding of the third Kunitz domain of human tissue factor pathway inhibitor.", "journal": "Biochemistry", "date": "2002", "authors": "Mine Shouhei, Yamazaki Toshio, Miyata Toshiyuki, Hara Saburo, Kato Hisao", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "reference": [ { "type": "PubMed", "id": "11772005", "url": "https://glygen.org/publication/PubMed/11772005" } ] }, { "title": "The asparagine-linked oligosaccharides on tissue factor pathway inhibitor terminate with SO4-4GalNAc beta 1, 4GlcNAc beta 1,2 Mana alpha.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Smith PL, Skelton TP, Fiete D, Dharmesh SM, Beranek MC, MacPhail L, Broze GJ Jr, Baenziger JU", "evidence": [ { "database": "UniCarbKB", "id": "P10646", "url": "" }, { "database": "GlyConnect", "id": "602", "url": "https://glyconnect.expasy.org/browser/proteins/602" } ], "reference": [ { "type": "PubMed", "id": "1388166", "url": "https://glygen.org/publication/PubMed/1388166" } ] }, { "title": "Signal peptide prediction based on analysis of experimentally verified cleavage sites.", "journal": "Protein Sci.", "date": "2004", "authors": "Zhang Z, Henzel WJ", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "reference": [ { "type": "PubMed", "id": "15340161", "url": "https://glygen.org/publication/PubMed/15340161" } ] }, { "title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.", "journal": "Journal of proteome research", "date": "2005", "authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646#ptm_processing" }, { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "reference": [ { "type": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "title": "Characterization of factor VII association with tissue factor in solution. High and low affinity calcium binding sites in factor VII contribute to functionally distinct interactions.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Ruf W, Kalnik MW, Lund-Hansen T, Edgington TS", "evidence": [ { "database": "Reactome", "id": "R-HSA-140834", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140834" } ], "reference": [ { "type": "PubMed", "id": "1874730", "url": "https://glygen.org/publication/PubMed/1874730" } ] }, { "title": "Biochemical characterization of plasma-derived tissue factor pathway inhibitor: post-translational modification of free, full-length form with particular reference to the sugar chain.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2009", "authors": "Mori Y, Hamuro T, Nakashima T, Hamamoto T, Natsuka S, Hase S, Iwanaga S", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646#ptm_processing" }, { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "reference": [ { "type": "PubMed", "id": "19017259", "url": "https://glygen.org/publication/PubMed/19017259" } ] }, { "title": "Intron-exon organization of the human gene coding for the lipoprotein-associated coagulation inhibitor: the factor Xa dependent inhibitor of the extrinsic pathway of coagulation.", "journal": "Biochemistry", "date": "1991", "authors": "van der Logt CP, Reitsma PH, Bertina RM", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "reference": [ { "type": "PubMed", "id": "1993173", "url": "https://glygen.org/publication/PubMed/1993173" } ] }, { "title": "Structure of the human lipoprotein-associated coagulation inhibitor gene. Intro/exon gene organization and localization of the gene to chromosome 2.", "journal": "J. Biol. Chem.", "date": "1991", "authors": "Girard T J, Eddy R, Wesselschmidt R L, MacPhail L A, Likert K M, Byers M G, Shows T B, Broze G J", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "reference": [ { "type": "PubMed", "id": "2002045", "url": "https://glygen.org/publication/PubMed/2002045" } ] }, { "title": "Cooperative activation of human factor IX by the human extrinsic pathway of blood coagulation.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Lawson JH, Mann KG", "evidence": [ { "database": "Reactome", "id": "R-HSA-140834", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140834" } ], "reference": [ { "type": "PubMed", "id": "2040636", "url": "https://glygen.org/publication/PubMed/2040636" } ] }, { "title": "Endogenous phosphorylation of the lipoprotein-associated coagulation inhibitor at serine-2.", "journal": "The Biochemical journal", "date": "1990", "authors": "Girard TJ, McCourt D, Novotny WF, MacPhail LA, Likert KM, Broze GJ Jr", "evidence": [ { "database": "iPTMnet", "id": "P10646", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10646" } ], "reference": [ { "type": "PubMed", "id": "2122883", "url": "https://glygen.org/publication/PubMed/2122883" } ] }, { "title": "Large-scale discovery of ERK2 substrates identifies ERK-mediated transcriptional regulation by ETV3.", "journal": "Science signaling", "date": "2011", "authors": "Carlson SM, Chouinard CR, Labadorf A, Lam CJ, Schmelzle K, Fraenkel E, White FM", "evidence": [ { "database": "iPTMnet", "id": "P10646", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10646" } ], "reference": [ { "type": "PubMed", "id": "22028470", "url": "https://glygen.org/publication/PubMed/22028470" } ] }, { "title": "TFPIbeta is the GPI-anchored TFPI isoform on human endothelial cells and placental microsomes.", "journal": "Blood", "date": "2012", "authors": "Girard Thomas J, Tuley Elodee, Broze George J", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "reference": [ { "type": "PubMed", "id": "22144186", "url": "https://glygen.org/publication/PubMed/22144186" } ] }, { "title": "Proteolytic activation of human factors IX and X by recombinant human factor VIIa: effects of calcium, phospholipids, and tissue factor.", "journal": "Biochemistry", "date": "1990", "authors": "Komiyama Y, Pedersen AH, Kisiel W", "evidence": [ { "database": "Reactome", "id": "R-HSA-140834", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140834" } ], "reference": [ { "type": "PubMed", "id": "2248955", "url": "https://glygen.org/publication/PubMed/2248955" } ] }, { "title": "Structural biology of factor VIIa/tissue factor initiated coagulation.", "journal": "Frontiers in bioscience (Landmark edition)", "date": "2012", "authors": "Vadivel K, Bajaj SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-140834", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140834" } ], "reference": [ { "type": "PubMed", "id": "22652793", "url": "https://glygen.org/publication/PubMed/22652793" } ] }, { "title": "Regulation of coagulation by a multivalent Kunitz-type inhibitor.", "journal": "Biochemistry", "date": "1990", "authors": "Broze GJ Jr, Girard TJ, Novotny WF", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" }, { "database": "Reactome", "id": "R-HSA-140834", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140834" } ], "reference": [ { "type": "PubMed", "id": "2271516", "url": "https://glygen.org/publication/PubMed/2271516" } ] }, { "title": "Regulation of tissue factor coagulant activity on cell surfaces.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2012", "authors": "Rao LV, Pendurthi UR", "evidence": [ { "database": "Reactome", "id": "R-HSA-140834", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140834" } ], "reference": [ { "type": "PubMed", "id": "23006890", "url": "https://glygen.org/publication/PubMed/23006890" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "P10646", "url": "" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "Analysis of tissue factor expression in various cell model systems: cryptic vs. active.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2013", "authors": "Kothari H, Pendurthi UR, Rao LV", "evidence": [ { "database": "Reactome", "id": "R-HSA-140834", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140834" } ], "reference": [ { "type": "PubMed", "id": "23621622", "url": "https://glygen.org/publication/PubMed/23621622" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "Cloning and characterization of a cDNA coding for the lipoprotein-associated coagulation inhibitor shows that it consists of three tandem Kunitz-type inhibitory domains.", "journal": "J. Biol. Chem.", "date": "1988", "authors": "Wun T C, Kretzmer K K, Girard T J, Miletich J P, Broze G J", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "reference": [ { "type": "PubMed", "id": "2452157", "url": "https://glygen.org/publication/PubMed/2452157" } ] }, { "title": "Purification and characterization of the lipoprotein-associated coagulation inhibitor from human plasma.", "journal": "J. Biol. Chem.", "date": "1989", "authors": "Novotny W F, Girard T J, Miletich J P, Broze G J", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "reference": [ { "type": "PubMed", "id": "2553722", "url": "https://glygen.org/publication/PubMed/2553722" } ] }, { "title": "Localization of tissue factor in the normal vessel wall and in the atherosclerotic plaque.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Wilcox JN, Smith KM, Schwartz SM, Gordon D", "evidence": [ { "database": "Reactome", "id": "R-HSA-140834", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140834" } ], "reference": [ { "type": "PubMed", "id": "2704749", "url": "https://glygen.org/publication/PubMed/2704749" } ] }, { "title": "Identification of the 1.4 kb and 4.0 kb messages for the lipoprotein associated coagulation inhibitor and expression of the encoded protein.", "journal": "Thromb. Res.", "date": "1989", "authors": "Girard T J, Warren L A, Novotny W F, Bejcek B E, Miletich J P, Broze G J", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "reference": [ { "type": "PubMed", "id": "2781520", "url": "https://glygen.org/publication/PubMed/2781520" } ] }, { "title": "Functional significance of the Kunitz-type inhibitory domains of lipoprotein-associated coagulation inhibitor.", "journal": "Nature", "date": "1989", "authors": "Girard T J, Warren L A, Novotny W F, Likert K M, Brown S G, Miletich J P, Broze G J", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "reference": [ { "type": "PubMed", "id": "2927510", "url": "https://glygen.org/publication/PubMed/2927510" } ] }, { "title": "Tissue Factor: An Essential Mediator of Hemostasis and Trigger of Thrombosis.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2018", "authors": "Grover SP, Mackman N", "evidence": [ { "database": "Reactome", "id": "R-HSA-140834", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140834" } ], "reference": [ { "type": "PubMed", "id": "29437578", "url": "https://glygen.org/publication/PubMed/29437578" } ] }, { "title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).", "journal": "Molecular systems biology", "date": "2018", "authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "P10646", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30459171", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "title": "Allostery in Coagulation Factor VIIa Revealed by Ensemble Refinement of Crystallographic Structures.", "journal": "Biophysical journal", "date": "2019", "authors": "Sorensen AB, Madsen JJ, Frimurer TM, Overgaard MT, Gandhi PS, Persson E, Olsen OH", "evidence": [ { "database": "Reactome", "id": "R-HSA-140834", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140834" } ], "reference": [ { "type": "PubMed", "id": "31003762", "url": "https://glygen.org/publication/PubMed/31003762" } ] }, { "title": "Tissue factor and hemostasis.", "journal": "Blood", "date": "1988", "authors": "Nemerson Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-140834", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140834" } ], "reference": [ { "type": "PubMed", "id": "3275472", "url": "https://glygen.org/publication/PubMed/3275472" } ] }, { "title": "Effects of human TFPI and CD47 expression and selectin and integrin inhibition during GalTKO.hCD46 pig lung perfusion with human blood.", "journal": "Xenotransplantation", "date": "2022", "authors": "Miura S, Habibabady ZA, Pollok F, Connolly M, Pratts S, Dandro A, Sorrells L, Karavi K, Phelps C, Eyestone W, Ayares D, Burdorf L, Azimzadeh A, Pierson RN 3rd", "evidence": [ { "database": "RefSeq", "id": "NP_001027452", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027452" } ], "reference": [ { "type": "PubMed", "id": "35234315", "url": "https://glygen.org/publication/PubMed/35234315" } ] }, { "title": "Factor VII binding to tissue factor in reconstituted phospholipid vesicles: induction of cooperativity by phosphatidylserine.", "journal": "Biochemistry", "date": "1986", "authors": "Bach R, Gentry R, Nemerson Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-140834", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140834" } ], "reference": [ { "type": "PubMed", "id": "3527261", "url": "https://glygen.org/publication/PubMed/3527261" } ] }, { "title": "Mutations of TFPI-binding exosites on factor VII cause bleeding phenotypes in factor VII deficiency.", "journal": "Blood advances", "date": "2022-11-22", "authors": "Seanoon Karnsasin, Payongsri Panwajee, Vivithanaporn Pornpun, Sirachainan Nongnuch, Chuansumrit Ampaiwan, Hongeng Suradej, Tanratana Pansakorn", "evidence": [ { "database": "RefSeq", "id": "NP_001027452", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027452" } ], "reference": [ { "type": "PubMed", "id": "35973191", "url": "https://glygen.org/publication/PubMed/35973191" } ] }, { "title": "Endothelial-dependent S-Sulfhydration of tissue factor pathway inhibitor regulates blood coagulation.", "journal": "Redox biology", "date": "2023-04-03", "authors": "Wittig Janina, Drekolia Maria-Kyriaki, Kyselova Anastasia, Delgado Lagos Fredy, Bochenek Magdalena L, Hu Jiong, Sch\u00e4fer Katrin, Fleming Ingrid, Bibli Sofia-Iris", "evidence": [ { "database": "RefSeq", "id": "NP_001027452", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027452" } ], "reference": [ { "type": "PubMed", "id": "37030150", "url": "https://glygen.org/publication/PubMed/37030150" } ] }, { "title": "Activated protein C, protein S, and tissue factor pathway inhibitor cooperate to inhibit thrombin activation.", "journal": "Thrombosis research", "date": "2023-10", "authors": "Li Xian, Song Xiaohong, Mahmood Dlovan F D, Sim Martha M S, Bidarian Sara J, Wood Jeremy P", "evidence": [ { "database": "RefSeq", "id": "NP_001027452", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001027452" } ], "reference": [ { "type": "PubMed", "id": "37660436", "url": "https://glygen.org/publication/PubMed/37660436" } ] }, { "title": "Binding of human factor VII and VIIa to monocytes.", "journal": "The Journal of clinical investigation", "date": "1982", "authors": "Broze GJ Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-140834", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140834" } ], "reference": [ { "type": "PubMed", "id": "6980899", "url": "https://glygen.org/publication/PubMed/6980899" } ] }, { "title": "The tissue factor pathway: how it has become a `prima ballerina`.", "journal": "Thrombosis and haemostasis", "date": "1995", "authors": "Rapaport SI, Rao LV", "evidence": [ { "database": "Reactome", "id": "R-HSA-140834", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140834" } ], "reference": [ { "type": "PubMed", "id": "8578528", "url": "https://glygen.org/publication/PubMed/8578528" } ] }, { "title": "The crystal structure of the complex of blood coagulation factor VIIa with soluble tissue factor.", "journal": "Nature", "date": "1996", "authors": "Banner DW, D'Arcy A, Chene C, Winkler FK, Guha A, Konigsberg WH, Nemerson Y, Kirchhofer D", "evidence": [ { "database": "Reactome", "id": "R-HSA-140834", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140834" } ], "reference": [ { "type": "PubMed", "id": "8598903", "url": "https://glygen.org/publication/PubMed/8598903" } ] }, { "title": "Amino acid sequence and carbohydrate structure of a recombinant human tissue factor pathway inhibitor expressed in Chinese hamster ovary cells: one N-and two O-linked carbohydrate chains are located between Kunitz domains 2 and 3 and one N-linked carbohydrate chain is in Kunitz domain 2.", "journal": "Biochemistry", "date": "1996", "authors": "Nakahara Y, Miyata T, Hamuro T, Funatsu A, Miyagi M, Tsunasawa S, Kato H", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646#ptm_processing" }, { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" }, { "database": "UniCarbKB", "id": "P10646", "url": "" }, { "database": "GlyConnect", "id": "602", "url": "https://glyconnect.expasy.org/browser/proteins/602" } ], "reference": [ { "type": "PubMed", "id": "8639592", "url": "https://glygen.org/publication/PubMed/8639592" } ] }, { "title": "Kinetics of human factor VII activation.", "journal": "Biochemistry", "date": "1996", "authors": "Butenas S, Mann KG", "evidence": [ { "database": "Reactome", "id": "R-HSA-140834", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140834" } ], "reference": [ { "type": "PubMed", "id": "8639673", "url": "https://glygen.org/publication/PubMed/8639673" } ] }, { "title": "The second Kunitz domain of human tissue factor pathway inhibitor: cloning, structure determination and interaction with factor Xa.", "journal": "J. Mol. Biol.", "date": "1997", "authors": "Burgering M J, Orbons L P, van der Doelen A, Mulders J, Theunissen H J, Grootenhuis P D, Bode W, Huber R, Stubbs M T", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "reference": [ { "type": "PubMed", "id": "9199408", "url": "https://glygen.org/publication/PubMed/9199408" } ] }, { "title": "The three-dimensional structure of recombinant leech-derived tryptase inhibitor in complex with trypsin. Implications for the structure of human mast cell tryptase and its inhibition.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Stubbs M T, Morenweiser R, St\u00fcrzebecher J, Bauer M, Bode W, Huber R, Piechottka G P, Matschiner G, Sommerhoff C P, Fritz H, Auerswald E A", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "reference": [ { "type": "PubMed", "id": "9242660", "url": "https://glygen.org/publication/PubMed/9242660" } ] } ], "pathway": [ { "id": "hsa:7035", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7035", "resource": "KEGG Pathway" }, { "id": "R-HSA-140834", "name": "Extrinsic Pathway of Fibrin Clot Formation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-140834", "resource": "Reactome", "description": "Extrinsic Pathway of Fibrin Clot Formation" } ], "orthologs": [ { "uniprot_canonical_ac": "O54819-1", "protein_name": "Tissue factor pathway inhibitor", "gene_name": "Tfpi", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTYKMKKEYAFWATVCLLLSLVPEFLNALSEEADDTDSELGSMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPGYEKTAVKAASGAERPDFCFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICENPVHSPSPVNEVQMSDYVTDGNTVTDRSTVNNIVVPQSPKVPRRRDYRGRPWCLQPADSGLCKASERRFYYNSATGKCHRFNYTGCGGNNNNFTTRRRCLRSCKTGLIKNKSKGVVKIQRRKAPFVKVVYESIN", "length": 306 }, "evidence": [ { "id": "45917869", "url": "http://www.informatics.jax.org/homology/45917869", "database": "MGI" }, { "id": "P10646", "url": "https://omabrowser.org/oma/group/P10646/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q02445-1", "protein_name": "Tissue factor pathway inhibitor", "gene_name": "Tfpi", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MTNKLKKDHAFWAAVCLLLSIVPELLNALPEEDDDTINTDSELRPMKPLHTFCAMKAEDGPCKAMIRSYYFNMNSHQCEEFIYGGCRGNKNRFDTLEECRKTCIPGYKKTTIKTTSGAEKPDFCFLEEDPGICRGFMTRYFYNNQSKQCEQFKYGGCLGNSNNFETLEECRNTCEDPVNEVQKGDYVTNQITVTDRTTVNNVVIPQATKAPSQWDYDGPSWCLEPADSGLCKASEKRFYYNPAIGKCRQFNYTGCGGNNNNFTTKQDCNRACKKDSSKKSSKRAKTQRRRKSFVKVMYENIH", "length": 302 }, "evidence": [ { "id": "45917869", "url": "http://www.informatics.jax.org/homology/45917869", "database": "MGI" }, { "id": "P10646", "url": "https://omabrowser.org/oma/group/P10646/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "serine-type endopeptidase inhibitor activity", "id": "GO:0004867", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004867", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "pmid": "" }, { "name": "endopeptidase inhibitor activity", "id": "GO:0004866", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004866", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "pmid": "" }, { "name": "caveola", "id": "GO:0005901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005901", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "pmid": "" }, { "name": "side of membrane", "id": "GO:0098552", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098552", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "blood coagulation", "id": "GO:0007596", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007596", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "pmid": "" }, { "name": "negative regulation of blood coagulation", "id": "GO:0030195", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030195", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "pmid": "" }, { "name": "cellular response to steroid hormone stimulus", "id": "GO:0071383", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071383", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "tissue factor pathway inhibitor N-glycosylated 1 (human)", "definition": "A tissue factor pathway inhibitor (human) that has been N-glycosylated at the residue equivalent to Asn-145 of the amino acid sequence represented by UniProtKB:P10646-1, in which the glycan structure is represented by GlyTouCan:G07947TY. Example: UniProtKB:P10646-1, Asn-145, MOD:00160~GNO:G07947TY. [PRO:DNx, PMID:1388166, PMID:8639592]", "evidence": [ { "id": "PR:000054774", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054774" } ] }, { "name": "tissue factor pathway inhibitor N-glycosylated 2 (human)", "definition": "A tissue factor pathway inhibitor (human) that has been N-glycosylated at the residue equivalent to Asn-145 of the amino acid sequence represented by UniProtKB:P10646-1, in which the glycan structure is represented by GlyTouCan:G31991IV. Example: UniProtKB:P10646-1, Asn-145, MOD:00160~GNO:G31991IV. [PRO:DNx, PMID:1388166, PMID:8639592]", "evidence": [ { "id": "PR:000054775", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054775" } ] }, { "name": "tissue factor pathway inhibitor N-glycosylated 3 (human)", "definition": "A tissue factor pathway inhibitor (human) that has been N-glycosylated at the residue equivalent to Asn-145 of the amino acid sequence represented by UniProtKB:P10646-1, in which the glycan structure is represented by GlyTouCan:G45359RY. Example: UniProtKB:P10646-1, Asn-145, MOD:00160~GNO:G45359RY. [PRO:DNx, PMID:1388166, PMID:8639592]", "evidence": [ { "id": "PR:000054776", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054776" } ] }, { "name": "tissue factor pathway inhibitor N-glycosylated 4 (human)", "definition": "A tissue factor pathway inhibitor (human) that has been N-glycosylated at the residue equivalent to Asn-145 of the amino acid sequence represented by UniProtKB:P10646-1, in which the glycan structure is represented by GlyTouCan:G51562OR. Example: UniProtKB:P10646-1, Asn-145, MOD:00160~GNO:G51562OR. [PRO:DNx, PMID:1388166, PMID:8639592]", "evidence": [ { "id": "PR:000054777", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054777" } ] }, { "name": "tissue factor pathway inhibitor N-glycosylated 5 (human)", "definition": "A tissue factor pathway inhibitor (human) that has been N-glycosylated at the residue equivalent to Asn-145 of the amino acid sequence represented by UniProtKB:P10646-1, in which the glycan structure is represented by GlyTouCan:G63889NK. Example: UniProtKB:P10646-1, Asn-145, MOD:00160~GNO:G63889NK. [PRO:DNx, PMID:1388166, PMID:8639592]", "evidence": [ { "id": "PR:000054778", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054778" } ] }, { "name": "tissue factor pathway inhibitor N-glycosylated 6 (human)", "definition": "A tissue factor pathway inhibitor (human) that has been N-glycosylated at the residue equivalent to Asn-145 of the amino acid sequence represented by UniProtKB:P10646-1, in which the glycan structure is represented by GlyTouCan:G65832JS. Example: UniProtKB:P10646-1, Asn-145, MOD:00160~GNO:G65832JS. [PRO:DNx, PMID:1388166, PMID:8639592]", "evidence": [ { "id": "PR:000054779", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054779" } ] }, { "name": "tissue factor pathway inhibitor N-glycosylated 7 (human)", "definition": "A tissue factor pathway inhibitor (human) that has been N-glycosylated at the residue equivalent to Asn-145 of the amino acid sequence represented by UniProtKB:P10646-1, in which the glycan structure is represented by GlyTouCan:G78059CC. Example: UniProtKB:P10646-1, Asn-145, MOD:00160~GNO:G78059CC. [PRO:DNx, PMID:1388166, PMID:8639592]", "evidence": [ { "id": "PR:000054780", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054780" } ] }, { "name": "tissue factor pathway inhibitor N-glycosylated 8 (human)", "definition": "A tissue factor pathway inhibitor (human) that has been N-glycosylated at the residue equivalent to Asn-145 of the amino acid sequence represented by UniProtKB:P10646-1, in which the glycan structure is represented by GlyTouCan:G86357DX. Example: UniProtKB:P10646-1, Asn-145, MOD:00160~GNO:G86357DX. [PRO:DNx, PMID:1388166, PMID:8639592]", "evidence": [ { "id": "PR:000054781", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054781" } ] }, { "name": "tissue factor pathway inhibitor N-glycosylated 9 (human)", "definition": "A tissue factor pathway inhibitor (human) that has been N-glycosylated at the residue equivalent to Asn-195 of the amino acid sequence represented by UniProtKB:P10646-1, in which the glycan structure is represented by GlyTouCan:G07947TY. Example: UniProtKB:P10646-1, Asn-195, MOD:00160~GNO:G07947TY. [PRO:DNx, PMID:1388166, PMID:8639592]", "evidence": [ { "id": "PR:000054782", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054782" } ] }, { "name": "tissue factor pathway inhibitor N-glycosylated 10 (human)", "definition": "A tissue factor pathway inhibitor (human) that has been N-glycosylated at the residue equivalent to Asn-195 of the amino acid sequence represented by UniProtKB:P10646-1, in which the glycan structure is represented by GlyTouCan:G31991IV. Example: UniProtKB:P10646-1, Asn-195, MOD:00160~GNO:G31991IV. [PRO:DNx, PMID:1388166, PMID:8639592]", "evidence": [ { "id": "PR:000054783", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054783" } ] }, { "name": "tissue factor pathway inhibitor N-glycosylated 11 (human)", "definition": "A tissue factor pathway inhibitor (human) that has been N-glycosylated at the residue equivalent to Asn-195 of the amino acid sequence represented by UniProtKB:P10646-1, in which the glycan structure is represented by GlyTouCan:G45359RY. Example: UniProtKB:P10646-1, Asn-195, MOD:00160~GNO:G45359RY. [PRO:DNx, PMID:1388166, PMID:8639592]", "evidence": [ { "id": "PR:000054784", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054784" } ] }, { "name": "tissue factor pathway inhibitor N-glycosylated 12 (human)", "definition": "A tissue factor pathway inhibitor (human) that has been N-glycosylated at the residue equivalent to Asn-195 of the amino acid sequence represented by UniProtKB:P10646-1, in which the glycan structure is represented by GlyTouCan:G51562OR. Example: UniProtKB:P10646-1, Asn-195, MOD:00160~GNO:G51562OR. [PRO:DNx, PMID:1388166, PMID:8639592]", "evidence": [ { "id": "PR:000054785", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054785" } ] }, { "name": "tissue factor pathway inhibitor N-glycosylated 13 (human)", "definition": "A tissue factor pathway inhibitor (human) that has been N-glycosylated at the residue equivalent to Asn-195 of the amino acid sequence represented by UniProtKB:P10646-1, in which the glycan structure is represented by GlyTouCan:G63889NK. Example: UniProtKB:P10646-1, Asn-195, MOD:00160~GNO:G63889NK. [PRO:DNx, PMID:1388166, PMID:8639592]", "evidence": [ { "id": "PR:000054786", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054786" } ] }, { "name": "tissue factor pathway inhibitor N-glycosylated 14 (human)", "definition": "A tissue factor pathway inhibitor (human) that has been N-glycosylated at the residue equivalent to Asn-195 of the amino acid sequence represented by UniProtKB:P10646-1, in which the glycan structure is represented by GlyTouCan:G65832JS. Example: UniProtKB:P10646-1, Asn-195, MOD:00160~GNO:G65832JS. [PRO:DNx, PMID:1388166, PMID:8639592]", "evidence": [ { "id": "PR:000054787", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054787" } ] }, { "name": "tissue factor pathway inhibitor N-glycosylated 15 (human)", "definition": "A tissue factor pathway inhibitor (human) that has been N-glycosylated at the residue equivalent to Asn-195 of the amino acid sequence represented by UniProtKB:P10646-1, in which the glycan structure is represented by GlyTouCan:G78059CC. Example: UniProtKB:P10646-1, Asn-195, MOD:00160~GNO:G78059CC. [PRO:DNx, PMID:1388166, PMID:8639592]", "evidence": [ { "id": "PR:000054788", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054788" } ] }, { "name": "tissue factor pathway inhibitor N-glycosylated 16 (human)", "definition": "A tissue factor pathway inhibitor (human) that has been N-glycosylated at the residue equivalent to Asn-195 of the amino acid sequence represented by UniProtKB:P10646-1, in which the glycan structure is represented by GlyTouCan:G86357DX. Example: UniProtKB:P10646-1, Asn-195, MOD:00160~GNO:G86357DX. [PRO:DNx, PMID:1388166, PMID:8639592]", "evidence": [ { "id": "PR:000054789", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054789" } ] }, { "name": "tissue factor pathway inhibitor O-glycosylated 1 (human)", "definition": "A tissue factor pathway inhibitor (human) that has been O-glycosylated at the residue equivalent to Thr-203 of the amino acid sequence represented by UniProtKB:P10646-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:P10646-1, Thr-203, MOD:00005~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000054790", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054790" } ] }, { "name": "tissue factor pathway inhibitor O-glycosylated 2 (human)", "definition": "A tissue factor pathway inhibitor (human) that has been O-glycosylated at the residue equivalent to Thr-203 of the amino acid sequence represented by UniProtKB:P10646-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P10646-1, Thr-203, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000054791", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054791" } ] }, { "name": "tissue factor pathway inhibitor O-glycosylated 3 (human)", "definition": "A tissue factor pathway inhibitor (human) that has been O-glycosylated at the residue equivalent to Thr-42 of the amino acid sequence represented by UniProtKB:P10646-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:P10646-1, Thr-42, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000054792", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000054792" } ] } ], "site_annotation": [ { "start_pos": 145, "end_pos": 147, "annotation": "n_glycosylation_sequon" }, { "start_pos": 195, "end_pos": 197, "annotation": "n_glycosylation_sequon" }, { "start_pos": 256, "end_pos": 258, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "O-glycosylated.", "evidence": [ { "database": "UniProtKB", "id": "P10646", "url": "https://www.uniprot.org/uniprot/P10646" }, { "database": "PubMed", "id": "19017259", "url": "https://glygen.org/publication/PubMed/19017259" }, { "database": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" }, { "database": "PubMed", "id": "8639592", "url": "https://glygen.org/publication/PubMed/8639592" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 145, 195 ], "o_linked_sites": [ 42, 112, 115, 116, 202, 203 ], "snv_sites": [ 22, 42, 80, 114, 116, 145, 147, 195 ], "glycation_sites": [], "phosphorylation_sites": [ 30, 202 ], "sequon_annotation_sites": [ { "start_pos": 145, "end_pos": 147 }, { "start_pos": 195, "end_pos": 197 }, { "start_pos": 256, "end_pos": 258 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 52 }, { "field": "total_sites", "count": 8 }, { "field": "n_linked_glycans", "count": 20 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 5 }, { "field": "o_linked_glycan_sites", "count": 9 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 47 }, { "field": "total_sites", "count": 8 }, { "field": "n_linked_glycans", "count": 20 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 5 }, { "field": "o_linked_glycan_sites", "count": 6 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 11 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 43 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }