{ "uniprot_canonical_ac": "P10620-1", "uniprot_ac": "P10620", "uniprot_id": "MGST1_HUMAN", "mass": { "chemical_mass": 17599.0, "monoisotopic_mass": 17599.0 }, "refseq": { "ac": "NP_001247440", "name": "microsomal glutathione S-transferase 1 isoform a", "summary": "The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress. Several transcript variants, some non-protein coding and some protein coding, have been found for this gene. [provided by RefSeq, May 2012].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001247440" }, "gene_names": [ { "name": "MGST1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P10620", "id": "P10620" }, { "name": "GST12; MGST; MGST-I; PMAN", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001247440", "id": "NP_001247440" }, { "name": "GST12", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P10620", "id": "P10620" }, { "name": "MGST1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001247440", "id": "NP_001247440" }, { "name": "MGST", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P10620", "id": "P10620" } ], "protein_names": [ { "name": "Microsomal glutathione S-transferase 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P10620" }, { "name": "2.5.1.18", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10620" }, { "name": "Microsomal GST-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10620" }, { "name": "Microsomal GST-I", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10620" }, { "name": "glutathione S-transferase 12; microsomal GST-1; microsomal GST-I; peritoneal metastasis associated long noncoding RNA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001247440", "id": "NP_001247440" }, { "name": "microsomal glutathione S-transferase 1 isoform a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001247440", "id": "NP_001247440" } ], "function": [ { "annotation": "A role for microsomal glutathione transferase 1 in melanin biosynthesis and melanoma progression.", "evidence": [ { "database": "RefSeq", "id": "NP_001247440", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001247440" }, { "database": "PubMed", "id": "37321450", "url": "https://glygen.org/publication/PubMed/37321450" } ] }, { "annotation": "Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.", "evidence": [ { "database": "UniProtKB", "id": "F5H760", "url": "https://www.uniprot.org/uniprot/F5H760#function" }, { "database": "UniProtKB", "id": "ARBA00003701", "url": "https://www.uniprot.org/uniprot/ARBA00003701#function" }, { "database": "UniProtKB", "id": "F5H7F6", "url": "https://www.uniprot.org/uniprot/F5H7F6#function" }, { "database": "UniProtKB", "id": "P10620", "url": "https://www.uniprot.org/uniprot/P10620#function" }, { "database": "UniProtKB", "id": "P08011", "url": "https://www.uniprot.org/uniprot/P08011#function" }, { "database": "UniProtKB", "id": "F5H6X2", "url": "https://www.uniprot.org/uniprot/F5H6X2#function" } ] }, { "annotation": "MGST1 is a redox-sensitive repressor of ferroptosis in pancreatic cancer cells.", "evidence": [ { "database": "RefSeq", "id": "NP_001247440", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001247440" }, { "database": "PubMed", "id": "33539732", "url": "https://glygen.org/publication/PubMed/33539732" } ] }, { "annotation": "MiR-379-5p targets microsomal glutathione transferase 1 (MGST1) to regulate human glioma in cell proliferation, migration and invasion and epithelial-mesenchymal transition (EMT).", "evidence": [ { "database": "RefSeq", "id": "NP_001247440", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001247440" }, { "database": "PubMed", "id": "34171541", "url": "https://glygen.org/publication/PubMed/34171541" } ] }, { "annotation": "Microsomal glutathione S-transferase 1 targets the autophagy signaling pathway to suppress ferroptosis in gastric carcinoma cells.", "evidence": [ { "database": "RefSeq", "id": "NP_001247440", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001247440" }, { "database": "PubMed", "id": "37161854", "url": "https://glygen.org/publication/PubMed/37161854" } ] }, { "annotation": "The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress. Several transcript variants, some non-protein coding and some protein coding, have been found for this gene. [provided by RefSeq, May 2012].", "evidence": [ { "database": "RefSeq", "id": "NP_001247440", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001247440" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "P10620", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10620" } ], "glycoeffect": [], "start_pos": 64, "end_pos": 64, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "Q", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (4).", "chr_id": "12", "chr_pos": "16357669", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R64", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] }, { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "98.63", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000008394", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000008394" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "88.51", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000008394", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000008394" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "94.99", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000008394", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000008394" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.33", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000008394", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000008394" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "99.22", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000008394", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000008394" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "99.22", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000008394", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000008394" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "99.37", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000008394", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000008394" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "99.58", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000008394", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000008394" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "98.38", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000008394", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000008394" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "99.14", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000008394", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000008394" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P10620", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10620" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P10620", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10620" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P10620", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10620" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P10620", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10620" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P10620", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10620" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P10620", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10620" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P10620", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10620" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P10620", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10620" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P10620", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10620" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P10620", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10620" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P10620", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10620" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P10620", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10620" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10620", "url": "https://www.uniprot.org/uniprot/P10620" } ], "common_name": "Human" } ], "gene": [ { "name": "MGST1", "url": "https://www.uniprot.org/uniprot/P10620", "locus": { "chromosome": "12", "start_pos": 16609259, "end_pos": 16347142, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000008394", "url": "https://www.ensembl.org/id/ENSG00000008394" } ] } } ], "crossref": [ { "id": "ENSG00000008394", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000008394", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P10620", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/P10620", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "CHEMBL1743184", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1743184", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "MGST1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=MGST1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "4257", "url": "https://www.ncbi.nlm.nih.gov/gene/4257", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "7061", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=7061", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P10620", "url": "https://www.ebi.ac.uk/intact/interactors/id:P10620*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001129", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001129", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023352", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023352", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040162", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040162", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:4257", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4257", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "138330", "url": "http://www.omim.org/entry/138330", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P10620", "url": "https://www.nextprot.org/entry/NX_P10620", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "P10620", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P10620", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "TFSMAYN", "url": "https://omabrowser.org/oma/group/TFSMAYN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5347993at2759", "url": "http://www.orthodb.org/?query=5347993at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10689", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10689", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10689:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10689:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01124", "url": "http://pfam.xfam.org/family/PF01124", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P10620", "url": "https://pharos.nih.gov/targets/P10620", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P10620", "url": "http://purl.obolibrary.org/obo/PR_P10620", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5423646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001247440", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001247440", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "16437", "url": "https://www.rhea-db.org/rhea/16437", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "F5GX73", "url": "https://www.uniprot.org/uniprot/F5GX73", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5GX73-1", "url": "https://www.uniprot.org/uniprot/F5GX73-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H613", "url": "https://www.uniprot.org/uniprot/F5H613", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H613-1", "url": "https://www.uniprot.org/uniprot/F5H613-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H6X2", "url": "https://www.uniprot.org/uniprot/F5H6X2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H6X2-1", "url": "https://www.uniprot.org/uniprot/F5H6X2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H760", "url": "https://www.uniprot.org/uniprot/F5H760", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H760-1", "url": "https://www.uniprot.org/uniprot/F5H760-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H7F6", "url": "https://www.uniprot.org/uniprot/F5H7F6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F5H7F6-1", "url": "https://www.uniprot.org/uniprot/F5H7F6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10620", "url": "https://www.uniprot.org/uniprot/P10620", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10620-1", "url": "https://www.uniprot.org/uniprot/P10620-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10620-2", "url": "https://www.uniprot.org/uniprot/P10620-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDCVAFGKGENAKKYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIAYLTPLPQPNRALSFFVGYGVTLSMAYRLLKSKLYL", "length": 155, "header": "sp|P10620-1|MGST1_HUMAN Isoform 1 of Microsomal glutathione S-transferase 1 OS=Homo sapiens OX=9606 GN=MGST1 PE=1 SV=1 CANONICAL=P10620-1" }, "isoforms": [ { "isoform_ac": "F5GX73-1", "url": "", "sequence": { "sequence": "MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRK", "length": 42, "header": "tr|F5GX73-1|MGST1_HUMAN Computationally mapped isoform of Microsomal glutathione S-transferase 1 OS=Homo sapiens OX=9606 GN=MGST1 PE=1 SV=1 CANONICAL=P10620-1" }, "locus": { "chromosome": "12", "start_pos": 16354378, "end_pos": 16354253, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000538885.5", "url": "https://www.ensembl.org/id/ENST00000538885.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000440443.1", "url": "https://www.ensembl.org/id/ENSP00000440443.1" } ] } }, { "isoform_ac": "F5H613-1", "url": "", "sequence": { "sequence": "MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKSPPE", "length": 46, "header": "tr|F5H613-1|MGST1_HUMAN Computationally mapped isoform of Microsomal glutathione S-transferase 1 OS=Homo sapiens OX=9606 GN=MGST1 PE=1 SV=1 CANONICAL=P10620-1" }, "locus": { "chromosome": "12", "start_pos": 16363806, "end_pos": 16354253, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000540056.5", "url": "https://www.ensembl.org/id/ENST00000540056.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000437988.1", "url": "https://www.ensembl.org/id/ENSP00000437988.1" } ] } }, { "isoform_ac": "F5H6X2-1", "url": "", "sequence": { "sequence": "MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDCVAFGKGENAKKYLRTDDRVERVRRAHLNDL", "length": 80, "header": "tr|F5H6X2-1|F5H6X2_HUMAN Computationally mapped isoform of Microsomal glutathione S-transferase 1 OS=Homo sapiens OX=9606 GN=MGST1 PE=1 SV=1 CANONICAL=P10620-1" }, "locus": { "chromosome": "12", "start_pos": 16363813, "end_pos": 16354253, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000540126.5", "url": "https://www.ensembl.org/id/ENST00000540126.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000442970.1", "url": "https://www.ensembl.org/id/ENSP00000442970.1" } ] } }, { "isoform_ac": "F5H760-1", "url": "", "sequence": { "sequence": "MVDLTQVFANPEDCVAFGKGENAKKYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIAYLTPLPQPNRALSFFVGYGVTL", "length": 106, "header": "tr|F5H760-1|MGST1_HUMAN Computationally mapped isoform of Microsomal glutathione S-transferase 1 OS=Homo sapiens OX=9606 GN=MGST1 PE=1 SV=1 CANONICAL=P10620-1" }, "locus": { "chromosome": "12", "start_pos": 16363999, "end_pos": 16354253, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000543076.5", "url": "https://www.ensembl.org/id/ENST00000543076.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000442767.1", "url": "https://www.ensembl.org/id/ENSP00000442767.1" } ] } }, { "isoform_ac": "F5H7F6-1", "url": "", "sequence": { "sequence": "MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDCVAFGKGENAKKYLRTDDRVERVRRAHL", "length": 77, "header": "tr|F5H7F6-1|MGST1_HUMAN Computationally mapped isoform of Microsomal glutathione S-transferase 1 OS=Homo sapiens OX=9606 GN=MGST1 PE=1 SV=1 CANONICAL=P10620-1" }, "locus": { "chromosome": "12", "start_pos": 16363804, "end_pos": 16354253, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000536371.5", "url": "https://www.ensembl.org/id/ENST00000536371.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000442557.1", "url": "https://www.ensembl.org/id/ENSP00000442557.1" } ] } }, { "isoform_ac": "P10620-1", "url": "", "sequence": { "sequence": "MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDCVAFGKGENAKKYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIAYLTPLPQPNRALSFFVGYGVTLSMAYRLLKSKLYL", "length": 155, "header": "sp|P10620-1|MGST1_HUMAN Isoform 1 of Microsomal glutathione S-transferase 1 OS=Homo sapiens OX=9606 GN=MGST1 PE=1 SV=1 CANONICAL=P10620-1" }, "locus": { "chromosome": "12", "start_pos": 16364038, "end_pos": 16354253, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000010404.6", "url": "https://www.ensembl.org/id/ENST00000010404.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000010404.2", "url": "https://www.ensembl.org/id/ENSP00000010404.2" } ] } }, { "isoform_ac": "P10620-2", "url": "", "sequence": { "sequence": "MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDCVAFGKGENAKKYLRTDDRVERVRRIKQTLSIYLASSI", "length": 87, "header": "sp|P10620-2|MGST1_HUMAN Isoform 2 of Microsomal glutathione S-transferase 1 OS=Homo sapiens OX=9606 GN=MGST1 PE=1 SV=1 CANONICAL=P10620-1" }, "locus": { "chromosome": "12", "start_pos": 16376161, "end_pos": 16354253, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000535309.5", "url": "https://www.ensembl.org/id/ENST00000535309.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000438308.1", "url": "https://www.ensembl.org/id/ENSP00000438308.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "P10620", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P10620" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Human glutathione transferase A4-4 crystal structures and mutagenesis reveal the basis of high catalytic efficiency with toxic lipid peroxidation products.", "journal": "Journal of molecular biology", "date": "1999", "authors": "Bruns CM, Hubatsch I, Ridderstrom M, Mannervik B, Tainer JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "10329152", "url": "https://glygen.org/publication/PubMed/10329152" } ] }, { "title": "Microsomal GST-I: genomic organization, expression, and alternative splicing of the human gene.", "journal": "Biochim. Biophys. Acta", "date": "1999", "authors": "Lee S H, DeJong J", "evidence": [ { "database": "UniProtKB", "id": "P10620", "url": "https://www.uniprot.org/uniprot/P10620" } ], "reference": [ { "type": "PubMed", "id": "10524215", "url": "https://glygen.org/publication/PubMed/10524215" } ] }, { "title": "An asparagine-phenylalanine substitution accounts for catalytic differences between hGSTM3-3 and other human class mu glutathione S-transferases.", "journal": "Biochemistry", "date": "1999", "authors": "Patskovsky YV, Patskovska LN, Listowsky I", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "10587441", "url": "https://glygen.org/publication/PubMed/10587441" } ] }, { "title": "Identification, characterization, and crystal structure of the Omega class glutathione transferases.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Board PG, Coggan M, Chelvanayagam G, Easteal S, Jermiin LS, Schulte GK, Danley DE, Hoth LR, Griffor MC, Kamath AV, Rosner MH, Chrunyk BA, Perregaux DE, Gabel CA, Geoghegan KF, Pandit J", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "10783391", "url": "https://glygen.org/publication/PubMed/10783391" } ] }, { "title": "Crystal structure of maleylacetoacetate isomerase/glutathione transferase zeta reveals the molecular basis for its remarkable catalytic promiscuity.", "journal": "Biochemistry", "date": "2001", "authors": "Polekhina G, Board PG, Blackburn AC, Parker MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "11327815", "url": "https://glygen.org/publication/PubMed/11327815" } ] }, { "title": "Reduction of aflatoxin B1 dialdehyde by rat and human aldo-keto reductases.", "journal": "Chemical research in toxicology", "date": "2001", "authors": "Guengerich FP, Cai H, McMahon M, Hayes JD, Sutter TR, Groopman JD, Deng Z, Harris TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5423646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646" } ], "reference": [ { "type": "PubMed", "id": "11409944", "url": "https://glygen.org/publication/PubMed/11409944" } ] }, { "title": "The 3-D structure of microsomal glutathione transferase 1 at 6 A resolution as determined by electron crystallography of p22(1)2(1) crystals.", "journal": "Biochimica et biophysica acta", "date": "2002", "authors": "Holm PJ, Morgenstern R, Hebert H", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "11904223", "url": "https://glygen.org/publication/PubMed/11904223" } ] }, { "title": "The human glutathione transferase alpha locus: genomic organization of the gene cluster and functional characterization of the genetic polymorphism in the hGSTA1 promoter.", "journal": "Pharmacogenetics", "date": "2002", "authors": "Morel F, Rauch C, Coles B, Le Ferrec E, Guillouzo A", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "12042665", "url": "https://glygen.org/publication/PubMed/12042665" } ] }, { "title": "Crystal structure of human renal dipeptidase involved in beta-lactam hydrolysis.", "journal": "Journal of molecular biology", "date": "2002", "authors": "Nitanai Y, Satow Y, Adachi H, Tsujimoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5423646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646" } ], "reference": [ { "type": "PubMed", "id": "12144777", "url": "https://glygen.org/publication/PubMed/12144777" } ] }, { "title": "1.3-A resolution structure of human glutathione S-transferase with S-hexyl glutathione bound reveals possible extended ligandin binding site.", "journal": "Proteins", "date": "2002", "authors": "Le Trong I, Stenkamp RE, Ibarra C, Atkins WM, Adman ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "12211029", "url": "https://glygen.org/publication/PubMed/12211029" } ] }, { "title": "Mechanism of metal activation of human hematopoietic prostaglandin D synthase.", "journal": "Nature structural biology", "date": "2003", "authors": "Inoue T, Irikura D, Okazaki N, Kinugasa S, Matsumura H, Uodome N, Yamamoto M, Kumasaka T, Miyano M, Kai Y, Urade Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "12627223", "url": "https://glygen.org/publication/PubMed/12627223" } ] }, { "title": "Characterization of the rat aflatoxin B1 aldehyde reductase gene, AKR7A1. Structure and chromosomal localization of AKR7A1 as well as identification of antioxidant response elements in the gene promoter.", "journal": "Carcinogenesis", "date": "2003", "authors": "Ellis EM, Slattery CM, Hayes JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5423646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646" } ], "reference": [ { "type": "PubMed", "id": "12727802", "url": "https://glygen.org/publication/PubMed/12727802" } ] }, { "title": "Essential roles of zinc ligation and enzyme dimerization for catalysis in the aminoacylase-1/M20 family.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Lindner HA, Lunin VV, Alary A, Hecker R, Cygler M, Menard R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5423646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646" } ], "reference": [ { "type": "PubMed", "id": "12933810", "url": "https://glygen.org/publication/PubMed/12933810" } ] }, { "title": "Gene and protein characterization of the human glutathione S-transferase kappa and evidence for a peroxisomal localization.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Morel F, Rauch C, Petit E, Piton A, Theret N, Coles B, Guillouzo A", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "14742434", "url": "https://glygen.org/publication/PubMed/14742434" } ] }, { "title": "The endo-8,9-epoxide of aflatoxin B1: a new metabolite.", "journal": "Chemical research in toxicology", "date": "1992", "authors": "Raney KD, Coles B, Guengerich FP, Harris TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5423646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646" } ], "reference": [ { "type": "PubMed", "id": "1504254", "url": "https://glygen.org/publication/PubMed/1504254" } ] }, { "title": "Thioredoxin-like domain of human kappa class glutathione transferase reveals sequence homology and structure similarity to the theta class enzyme.", "journal": "Protein science : a publication of the Protein Society", "date": "2005", "authors": "Li J, Xia Z, Ding J", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "16081649", "url": "https://glygen.org/publication/PubMed/16081649" } ] }, { "title": "Structural basis of the suppressed catalytic activity of wild-type human glutathione transferase T1-1 compared to its W234R mutant.", "journal": "Journal of molecular biology", "date": "2006", "authors": "Tars K, Larsson AK, Shokeer A, Olin B, Mannervik B, Kleywegt GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "16298388", "url": "https://glygen.org/publication/PubMed/16298388" } ] }, { "title": "Efficient activation of aflatoxin B1 by cytochrome P450 2A13, an enzyme predominantly expressed in human respiratory tract.", "journal": "International journal of cancer", "date": "2006", "authors": "He XY, Tang L, Wang SL, Cai QS, Wang JS, Hong JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-5423646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646" } ], "reference": [ { "type": "PubMed", "id": "16385575", "url": "https://glygen.org/publication/PubMed/16385575" } ] }, { "title": "Oxidation of aflatoxins and sterigmatocystin by human liver microsomes: significance of aflatoxin Q1 as a detoxication product of aflatoxin B1.", "journal": "Chemical research in toxicology", "date": "1992", "authors": "Raney KD, Shimada T, Kim DH, Groopman JD, Harris TM, Guengerich FP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5423646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646" } ], "reference": [ { "type": "PubMed", "id": "1643250", "url": "https://glygen.org/publication/PubMed/1643250" } ] }, { "title": "Transition state model and mechanism of nucleophilic aromatic substitution reactions catalyzed by human glutathione S-transferase M1a-1a.", "journal": "Biochemistry", "date": "2006", "authors": "Patskovsky Y, Patskovska L, Almo SC, Listowsky I", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "16548513", "url": "https://glygen.org/publication/PubMed/16548513" } ] }, { "title": "Aldo-keto reductases and bioactivation/detoxication.", "journal": "Annual review of pharmacology and toxicology", "date": "2007", "authors": "Jin Y, Penning TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5423646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646" } ], "reference": [ { "type": "PubMed", "id": "16970545", "url": "https://glygen.org/publication/PubMed/16970545" } ] }, { "title": "The human gamma-glutamyltransferase gene family.", "journal": "Human genetics", "date": "2008", "authors": "Heisterkamp N, Groffen J, Warburton D, Sneddon TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5423646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646" } ], "reference": [ { "type": "PubMed", "id": "18357469", "url": "https://glygen.org/publication/PubMed/18357469" } ] }, { "title": "Protection against aflatoxin B1-induced cytotoxicity by expression of the cloned aflatoxin B1-aldehyde reductases rat AKR7A1 and human AKR7A3.", "journal": "Chemical research in toxicology", "date": "2008", "authors": "Bodreddigari S, Jones LK, Egner PA, Groopman JD, Sutter CH, Roebuck BD, Guengerich FP, Kensler TW, Sutter TR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5423646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646" } ], "reference": [ { "type": "PubMed", "id": "18416522", "url": "https://glygen.org/publication/PubMed/18416522" } ] }, { "title": "Human kidney gamma-glutamyl transpeptidase. Catalytic properties, subunit structure, and localization of the gamma-glutamyl binding site on the light subunit.", "journal": "The Journal of biological chemistry", "date": "1977", "authors": "Tate SS, Ross ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-5423646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646" } ], "reference": [ { "type": "PubMed", "id": "19463", "url": "https://glygen.org/publication/PubMed/19463" } ] }, { "title": "Structural basis for featuring of steroid isomerase activity in alpha class glutathione transferases.", "journal": "Journal of molecular biology", "date": "2010", "authors": "Tars K, Olin B, Mannervik B", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "20083122", "url": "https://glygen.org/publication/PubMed/20083122" } ] }, { "title": "Substrate specificity combined with stereopromiscuity in glutathione transferase A4-4-dependent metabolism of 4-hydroxynonenal.", "journal": "Biochemistry", "date": "2010", "authors": "Balogh LM, Le Trong I, Kripps KA, Shireman LM, Stenkamp RE, Zhang W, Mannervik B, Atkins WM", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "20085333", "url": "https://glygen.org/publication/PubMed/20085333" } ] }, { "title": "Novel folding and stability defects cause a deficiency of human glutathione transferase omega 1.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Zhou H, Brock J, Casarotto MG, Oakley AJ, Board PG", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "21106529", "url": "https://glygen.org/publication/PubMed/21106529" } ] }, { "title": "Glutathione-S-transferase P1 is a critical regulator of Cdk5 kinase activity.", "journal": "Journal of neurochemistry", "date": "2011", "authors": "Sun KH, Chang KH, Clawson S, Ghosh S, Mirzaei H, Regnier F, Shah K", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "21668448", "url": "https://glygen.org/publication/PubMed/21668448" } ] }, { "title": "Structural insights into the dehydroascorbate reductase activity of human omega-class glutathione transferases.", "journal": "Journal of molecular biology", "date": "2012", "authors": "Zhou H, Brock J, Liu D, Board PG, Oakley AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "22522127", "url": "https://glygen.org/publication/PubMed/22522127" } ] }, { "title": "The Role of Human Aldo-Keto Reductases in the Metabolic Activation and Detoxication of Polycyclic Aromatic Hydrocarbons: Interconversion of PAH Catechols and PAH o-Quinones.", "journal": "Frontiers in pharmacology", "date": "2012", "authors": "Zhang L, Jin Y, Huang M, Penning TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "23162467", "url": "https://glygen.org/publication/PubMed/23162467" } ] }, { "title": "Proteome profiling of human neutrophil granule subsets, secretory vesicles, and cell membrane: correlation with transcriptome profiling of neutrophil precursors.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Rorvig S, Ostergaard O, Heegaard NH, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "23650620", "url": "https://glygen.org/publication/PubMed/23650620" } ] }, { "title": "Different gamma-glutamyl transpeptidase mRNAs are expressed in human liver and kidney.", "journal": "Biochemical and biophysical research communications", "date": "1989", "authors": "Pawlak A, Wu SJ, Bulle F, Suzuki A, Chikhi N, Ferry N, Baik JH, Siegrist S, Guellaen G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5423646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646" } ], "reference": [ { "type": "PubMed", "id": "2573352", "url": "https://glygen.org/publication/PubMed/2573352" } ] }, { "title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.", "journal": "Analytical chemistry", "date": "2017", "authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P10620", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P10620" } ], "reference": [ { "type": "PubMed", "id": "28510447", "url": "https://glygen.org/publication/PubMed/28510447" } ] }, { "title": "MGST1 is a redox-sensitive repressor of ferroptosis in pancreatic cancer cells.", "journal": "Cell chemical biology", "date": "2021", "authors": "Kuang F, Liu J, Xie Y, Tang D, Kang R", "evidence": [ { "database": "RefSeq", "id": "NP_001247440", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001247440" } ], "reference": [ { "type": "PubMed", "id": "33539732", "url": "https://glygen.org/publication/PubMed/33539732" } ] }, { "title": "Gene expression of rat and human microsomal glutathione S-transferases.", "journal": "J. Biol. Chem.", "date": "1988", "authors": "DeJong JL, Morgenstern R, Jornvall H, DePierre JW, Tu CP", "evidence": [ { "database": "UniProtKB", "id": "P10620", "url": "https://www.uniprot.org/uniprot/P10620" }, { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "3372534", "url": "https://glygen.org/publication/PubMed/3372534" } ] }, { "title": "MiR-379-5p targets microsomal glutathione transferase 1 (MGST1) to regulate human glioma in cell proliferation, migration and invasion and epithelial-mesenchymal transition (EMT).", "journal": "Biochemical and biophysical research communications", "date": "2021", "authors": "Yang B, Xia S, Ye X, Jing W, Wu B", "evidence": [ { "database": "RefSeq", "id": "NP_001247440", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001247440" } ], "reference": [ { "type": "PubMed", "id": "34171541", "url": "https://glygen.org/publication/PubMed/34171541" } ] }, { "title": "O-GlcNAcylation promotes fatty acid synthase activity under nutritional stress as a pro-survival mechanism in cancer cells.", "journal": "Proteomics", "date": "2022", "authors": "Wong YK, Wang J, Lim TK, Lin Q, Yap CT, Shen HM", "evidence": [ { "database": "O-GlcNAc Database", "id": "P10620", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P10620" } ], "reference": [ { "type": "PubMed", "id": "35083852", "url": "https://glygen.org/publication/PubMed/35083852" } ] }, { "title": "Microsomal glutathione S-transferase 1 targets the autophagy signaling pathway to suppress ferroptosis in gastric carcinoma cells.", "journal": "Human & experimental toxicology", "date": "2023", "authors": "Peng Z, Peng N", "evidence": [ { "database": "RefSeq", "id": "NP_001247440", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001247440" } ], "reference": [ { "type": "PubMed", "id": "37161854", "url": "https://glygen.org/publication/PubMed/37161854" } ] }, { "title": "A role for microsomal glutathione transferase 1 in melanin biosynthesis and melanoma progression.", "journal": "The Journal of biological chemistry", "date": "2023-08", "authors": "Zhang Jie, Ye Zhi-Wei, Br\u00e4utigam Lars, Chakraborty Paramita, Luo Zhenwu, Culpepper John, Aslam Muhammad, Zhang Leilei, Johansson Katarina, Haeggstr\u00f6m Jesper Z, Xu Jianqiang, Olsson Magnus, Townsend Danyelle M, Mehrotra Shikhar, Morgenstern Ralf, Tew Kenneth D", "evidence": [ { "database": "RefSeq", "id": "NP_001247440", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001247440" } ], "reference": [ { "type": "PubMed", "id": "37321450", "url": "https://glygen.org/publication/PubMed/37321450" } ] }, { "title": "Identity of the polymorphisms for esterase D and S-formylglutathione hydrolase in red blood cells.", "journal": "Human genetics", "date": "1986", "authors": "Eiberg H, Mohr J", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "3770744", "url": "https://glygen.org/publication/PubMed/3770744" } ] }, { "title": "Aflatoxin metabolism in humans: detection of metabolites and nucleic acid adducts in urine by affinity chromatography.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1985", "authors": "Groopman JD, Donahue PR, Zhu JQ, Chen JS, Wogan GN", "evidence": [ { "database": "Reactome", "id": "R-HSA-5423646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646" } ], "reference": [ { "type": "PubMed", "id": "3931076", "url": "https://glygen.org/publication/PubMed/3931076" } ] }, { "title": "Esterase D: a new human polymorphism.", "journal": "Annals of human genetics", "date": "1973", "authors": "Hopkinson DA, Mestriner MA, Cortner J, Harris H", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "4768551", "url": "https://glygen.org/publication/PubMed/4768551" } ] }, { "title": "Gene structural analysis and expression of human renal dipeptidase.", "journal": "Biotechnology progress", "date": "1994", "authors": "Satoh S, Ohtsuka K, Keida Y, Kusunoki C, Konta Y, Niwa M, Kohsaka M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5423646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646" } ], "reference": [ { "type": "PubMed", "id": "7764673", "url": "https://glygen.org/publication/PubMed/7764673" } ] }, { "title": "Oxidation of aflatoxin B1 by bacterial recombinant human cytochrome P450 enzymes.", "journal": "Chemical research in toxicology", "date": "1995", "authors": "Ueng YF, Shimada T, Yamazaki H, Guengerich FP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5423646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646" } ], "reference": [ { "type": "PubMed", "id": "7766804", "url": "https://glygen.org/publication/PubMed/7766804" } ] }, { "title": "Crystal structure of human class mu glutathione transferase GSTM2-2. Effects of lattice packing on conformational heterogeneity.", "journal": "Journal of molecular biology", "date": "1994", "authors": "Raghunathan S, Chandross RJ, Kretsinger RH, Allison TJ, Penington CJ, Rule GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "8182750", "url": "https://glygen.org/publication/PubMed/8182750" } ] }, { "title": "A comparison of the enzymatic and physicochemical properties of human glutathione transferase M4-4 and three other human Mu class enzymes.", "journal": "Archives of biochemistry and biophysics", "date": "1994", "authors": "Comstock KE, Widersten M, Hao XY, Henner WD, Mannervik B", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "8203914", "url": "https://glygen.org/publication/PubMed/8203914" } ] }, { "title": "Structure determination and refinement of human alpha class glutathione transferase A1-1, and a comparison with the Mu and Pi class enzymes.", "journal": "Journal of molecular biology", "date": "1993", "authors": "Sinning I, Kleywegt GJ, Cowan SW, Reinemer P, Dirr HW, Huber R, Gilliland GL, Armstrong RN, Ji X, Board PG, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "8331657", "url": "https://glygen.org/publication/PubMed/8331657" } ] }, { "title": "Characterization of two novel subunits of the alpha-class glutathione S-transferases of human liver.", "journal": "Biochimica et biophysica acta", "date": "1993", "authors": "Ahmad H, Singhal SS, Saxena M, Awasthi YC", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "8431482", "url": "https://glygen.org/publication/PubMed/8431482" } ] }, { "title": "Cloning and structural analysis of genomic DNA for human renal dipeptidase.", "journal": "Biochimica et biophysica acta", "date": "1993", "authors": "Satoh S, Kusunoki C, Konta Y, Niwa M, Kohsaka M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5423646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646" } ], "reference": [ { "type": "PubMed", "id": "8439558", "url": "https://glygen.org/publication/PubMed/8439558" } ] }, { "title": "Targeting of proteins to granule subsets is determined by timing and not by sorting: The specific granule protein NGAL is localized to azurophil granules when expressed in HL-60 cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Le Cabec V, Cowland JB, Calafat J, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "8692836", "url": "https://glygen.org/publication/PubMed/8692836" } ] }, { "title": "Identification and characterization of a novel human microsomal glutathione S-transferase with leukotriene C4 synthase activity and significant sequence identity to 5-lipoxygenase-activating protein and leukotriene C4 synthase.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Jakobsson PJ, Mancini JA, Ford-Hutchinson AW", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "8703034", "url": "https://glygen.org/publication/PubMed/8703034" } ] }, { "title": "Structural organization of the human microsomal glutathione S-transferase gene (GST12).", "journal": "Genomics", "date": "1996", "authors": "Kelner MJ, Stokely MN, Stovall NE, Montoya MA", "evidence": [ { "database": "UniProtKB", "id": "P10620", "url": "https://www.uniprot.org/uniprot/P10620" }, { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "8812420", "url": "https://glygen.org/publication/PubMed/8812420" } ] }, { "title": "The kinetics of aflatoxin B1 oxidation by human cDNA-expressed and human liver microsomal cytochromes P450 1A2 and 3A4.", "journal": "Toxicology and applied pharmacology", "date": "1996", "authors": "Gallagher EP, Kunze KL, Stapleton PL, Eaton DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5423646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646" } ], "reference": [ { "type": "PubMed", "id": "8975785", "url": "https://glygen.org/publication/PubMed/8975785" } ] }, { "title": "Identification and characterization of a novel microsomal enzyme with glutathione-dependent transferase and peroxidase activities.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Jakobsson PJ, Mancini JA, Riendeau D, Ford-Hutchinson AW", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "9278457", "url": "https://glygen.org/publication/PubMed/9278457" } ] }, { "title": "Human theta class glutathione transferase: the crystal structure reveals a sulfate-binding pocket within a buried active site.", "journal": "Structure (London, England : 1993)", "date": "1998", "authors": "Rossjohn J, McKinstry WJ, Oakley AJ, Verger D, Flanagan J, Chelvanayagam G, Tan KL, Board PG, Parker MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "9551553", "url": "https://glygen.org/publication/PubMed/9551553" } ] }, { "title": "Molecular cloning, expression and catalytic activity of a human AKR7 member of the aldo-keto reductase superfamily: evidence that the major 2-carboxybenzaldehyde reductase from human liver is a homologue of rat aflatoxin B1-aldehyde reductase.", "journal": "The Biochemical journal", "date": "1998", "authors": "Ireland LS, Harrison DJ, Neal GE, Hayes JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5423646", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646" } ], "reference": [ { "type": "PubMed", "id": "9576847", "url": "https://glygen.org/publication/PubMed/9576847" } ] }, { "title": "Purification and characterization of a novel alpha-class glutathione transferase from human liver.", "journal": "The international journal of biochemistry & cell biology", "date": "1998", "authors": "Pastore A, Lo Bello M, Aureli G, Federici G, Ricci G, Di Ilio C, Petruzzelli R", "evidence": [ { "database": "Reactome", "id": "R-HSA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590" } ], "reference": [ { "type": "PubMed", "id": "9839448", "url": "https://glygen.org/publication/PubMed/9839448" } ] } ], "pathway": [ { "id": "hsa:4257", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4257", "resource": "KEGG Pathway" }, { "id": "R-HSA-156590", "name": "Glutathione conjugation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156590", "resource": "Reactome", "description": "Glutathione conjugation" }, { "id": "R-HSA-5423646", "name": "Aflatoxin activation and detoxification", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423646", "resource": "Reactome", "description": "Aflatoxin activation and detoxification" }, { "id": "R-HSA-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" } ], "orthologs": [ { "uniprot_canonical_ac": "P08011-1", "protein_name": "Microsomal glutathione S-transferase 1", "gene_name": "Mgst1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MADLKQLMDNEVLMAFTSYATIILAKMMFLSSATAFQRLTNKVFANPEDCAGFGKGENAKKFLRTDEKVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTALIHFRIFVGARIYHTIAYLTPLPQPNRGLAFFVGYGVTLSMAYRLLRSRLYL", "length": 155 }, "evidence": [ { "id": "45929403", "url": "http://www.informatics.jax.org/homology/45929403", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P79382-1", "protein_name": "Microsomal glutathione S-transferase 1", "gene_name": "MGST1", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MADLTELMKNEVFMAFASYATIVLSKMMFMSTATAFYRLTRKVFANPEDCSSFGKGENAKKYLRTDERVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTAILHFRLFVGARIYHTIAYLTPLPQPNRGLAFFLGYGVTLSMAYRLLKSRLYL", "length": 155 }, "evidence": [ { "id": "P10620", "url": "https://omabrowser.org/oma/group/P10620/", "database": "OMA" } ], "common_name": "Pig" }, { "uniprot_canonical_ac": "Q91VS7-1", "protein_name": "Microsomal glutathione S-transferase 1", "gene_name": "Mgst1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MADLRQLMDNEVLMAFTSYATIILTKMMFMSSATAFQRITNKVFANPEDCAGFGKGENAKKFVRTDEKVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTALMHFRIFVGARIYHTIAYLTPLPQPNRGLAFFVGYGVTLSMAYRLLRSRLYL", "length": 155 }, "evidence": [ { "id": "45929403", "url": "http://www.informatics.jax.org/homology/45929403", "database": "MGI" }, { "id": "P10620", "url": "https://omabrowser.org/oma/group/P10620/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "glutathione transferase activity", "id": "GO:0004364", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004364", "evidence": [ { "database": "UniProtKB", "id": "P10620", "url": "https://www.uniprot.org/uniprot/P10620" } ], "pmid": "" }, { "name": "glutathione peroxidase activity", "id": "GO:0004602", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004602", "evidence": [ { "database": "UniProtKB", "id": "P10620", "url": "https://www.uniprot.org/uniprot/P10620" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "glutathione transport", "id": "GO:0034635", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034635", "evidence": [ { "database": "UniProtKB", "id": "P10620", "url": "https://www.uniprot.org/uniprot/P10620" } ], "pmid": "" }, { "name": "cellular response to lipid hydroperoxide", "id": "GO:0071449", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071449", "evidence": [ { "database": "UniProtKB", "id": "P10620", "url": "https://www.uniprot.org/uniprot/P10620" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "P10620", "url": "https://www.uniprot.org/uniprot/P10620" } ], "pmid": "" }, { "name": "mitochondrial outer membrane", "id": "GO:0005741", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005741", "evidence": [ { "database": "UniProtKB", "id": "P10620", "url": "https://www.uniprot.org/uniprot/P10620" } ], "pmid": "" }, { "name": "peroxisomal membrane", "id": "GO:0005778", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005778", "evidence": [ { "database": "UniProtKB", "id": "P10620", "url": "https://www.uniprot.org/uniprot/P10620" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "P10620", "url": "https://www.uniprot.org/uniprot/P10620" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P10620", "url": "https://www.uniprot.org/uniprot/P10620" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "P10620", "url": "https://www.uniprot.org/uniprot/P10620" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "P10620", "url": "https://www.uniprot.org/uniprot/P10620" } ], "pmid": "" }, { "name": "azurophil granule membrane", "id": "GO:0035577", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035577", "evidence": [ { "database": "UniProtKB", "id": "P10620", "url": "https://www.uniprot.org/uniprot/P10620" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "16437", "name": "", "equation": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P04904-1", "P46418-1", "P24473-1", "P30713-1", "Q6AXY0-1", "Q9QX69-1", "O35543-1", "Q9Z339-1", "P08009-1", "P14942-1", "Q9Z1B2-1", "Q6AXV9-1", "Q5BK56-1", "P00502-1", "P04903-1", "P04905-1", "P04906-1", "P57113-1", "Q01579-1", "P08010-1", "P08011-1", "Q4V8E6-1", "A0A0G2K4Q5-1", "F1LXL7-1", "Q9Y2Q3-1", "Q9H4Y5-1", "P46439-1", "Q03013-1", "P78417-1", "P08263-1", "P0CG30-1", "P09488-1", "Q7RTV2-1", "Q16772-1", "P28161-1", "P0CG29-1", "O60760-1", "P09211-1", "P30711-1", "P09210-1", "O15217-1", "O43813-1", "P21266-1", "P10620-1", "O43708-1", "Q99735-1", "A0A1W2PR19-1", "F6RWR5-1", "Q9JHF7-1", "E9Q6L7-1", "Q9WVL0-1", "O35660-1", "P46425-1", "P19639-1", "P48774-1", "Q9DCM2-1", "Q99L20-1", "O09131-1", "P24472-1", "P19157-1", "Q61133-1", "Q8K2Q2-1", "Q80W21-1", "O89112-1", "P10648-1", "P13745-1", "P15626-1", "P30115-1", "P10649-1", "Q64471-1", "Q9D4P7-1", "Q91VS7-1", "Q6P8Q0-1", "A2RST1-1", "Q8R5I6-1", "P17695-1", "P25373-1", "P36156-1", "P40582-1", "P48239-1", "Q04806-1", "Q12390-1", "Q54GA9-1", "Q54QV7-1", "Q54VI4-1", "Q55FF3-1", "Q86AU1-1", "Q556G3-1", "Q9VG94-1", "Q9VG96-1", "Q7JYX0-1", "P41043-1", "P20432-1", "Q9VG95-1", "Q9VG98-1", "Q9VG93-1", "Q9VHD3-1", "Q9VHD2-1" ], "evidence": [ { "id": "16437", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/16437" } ] }, { "id": "R-HSA-176059", "name": "GST trimers transfer GS from GSH to luminal substrates", "equation": "", "summary": "The microsomal glutathione S-transferases (MGSTs) catalyse the nucleophilic attack by reduced glutathione (GSH) on nonpolar compounds that contain an electrophilic C, N, or S atom. Three major families of proteins are widely distributed in nature. The cytosolic and mitochondrial GST families comprise soluble enzymes that are only distantly related whilst the third family comprises microsomal GST, referred to as membrane-associated proteins in eicosanoid and glutathione (MAPEG) metabolism. Three members of this family function as detoxification enzymes, MGST1-3 (DeJong et al. 1988, Kelner et al. 1996, Jakobsson et al. 1996, Jakobsson et al. 1997). Electron crystallography studies in rat Mgst1 indicate these enzymes function as homotrimers (Holm et al. 2002). Both aflatoxin B1 exo- and endo-epoxides (AFXBO and AFNBO) conjugate with glutathione. These conjugates are eventually excreted in urine as mercapturic acids.", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q99735-1", "O14880-1", "P10620-1" ], "evidence": [ { "id": "R-HSA-176059", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-176059" } ] }, { "id": "R-HSA-5423653", "name": "MGST trimers transfer GS from GSH to AFXBO and AFNBO", "equation": "", "summary": "The microsomal glutathione S-transferases (MGSTs) catalyse the nucleophilic attack by reduced glutathione (GSH) on nonpolar compounds that contain an electrophilic C, N, or S atom. Three major families of proteins are widely distributed in nature. The cytosolic and mitochondrial GST families comprise soluble enzymes that are only distantly related whilst the third family comprises microsomal GST, referred to as membrane-associated proteins in eicosanoid and glutathione (MAPEG) metabolism. Three members of this family function as detoxification enzymes, MGST1-3 (DeJong et al. 1988, Kelner et al. 1996, Jakobsson et al. 1996, Jakobsson et al. 1997). Electron crystallography studies in rat Mgst1 indicate these enzymes function as homotrimers (Holm et al. 2002). Both aflatoxin B1 exo- and endo-epoxides (AFXBO and AFNBO) conjugate with glutathione. These conjugates are eventually excreted in urine as mercapturic acids.", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q99735-1", "O14880-1", "P10620-1" ], "evidence": [ { "id": "R-HSA-5423653", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5423653" } ] }, { "id": "R-HSA-6798739", "name": "Exocytosis of azurophil granule membrane proteins", "equation": "", "summary": "Azurophil or primary granules were originally defined by their high content of myeloperoxidase (MPO) and their affinity for the basic dye azure A (Spicer & Hardin 1969). Azurophil granules are generally described as spherical. Like lysosomes, they contain CD63 in their membrane (Cham et al. 1994) but are regarded as specialized secretory granules rather than lysosomes (Cieutat et al. 1998). Azurophil granules undergo limited exocytosis in response to stimulation (Sengelov et al. 1993, Faurschou et al. 2002), their primary role is believed to be killing and degradation of engulfed microbes in the phagolysosome (Joiner et al. 1989).", "cellular_location": "plasma membrane, azurophil granule membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P51148-1", "P42785-1", "P61224-1", "P49768-1", "Q86UQ4-1", "Q9Y2Q0-1", "Q9Y2G3-1", "P10253-1", "P15291-1", "O95497-1", "Q8NF37-1", "O00462-1", "P10620-1", "P15309-1" ], "evidence": [ { "id": "R-HSA-6798739", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798739" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2K4Q5", "gene_name": "Gstp3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "A0A0G2K4Q5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K4Q5" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A0A0G2K4Q5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K4Q5" } ] } ] }, { "uniprot_ac": "A0A1W2PR19", "gene_name": "GSTT4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "A0A1W2PR19", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1W2PR19" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A0A1W2PR19", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1W2PR19" } ] } ] }, { "uniprot_ac": "A2RST1", "gene_name": "Mgst2", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "A2RST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2RST1" } ] }, { "ec_number": "4.4.1.20", "activity": "leukotriene C4 = glutathione + leukotriene A4.", "evidence": [ { "id": "A2RST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2RST1" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "A2RST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2RST1" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A2RST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2RST1" } ] } ] }, { "uniprot_ac": "E9Q6L7", "gene_name": "Gsta5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "E9Q6L7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q6L7" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "E9Q6L7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q6L7" } ] } ] }, { "uniprot_ac": "F1LXL7", "gene_name": "AC097845.1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "F1LXL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LXL7" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "F1LXL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LXL7" } ] } ] }, { "uniprot_ac": "F6RWR5", "gene_name": "Gstp3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "F6RWR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F6RWR5" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "F6RWR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F6RWR5" } ] } ] }, { "uniprot_ac": "O00462", "gene_name": "MANBA", "activity": [ { "ec_number": "3.2.1.25", "activity": "Hydrolysis of terminal, non-reducing beta-D-mannose residues in beta-D-mannosides.", "evidence": [ { "id": "O00462", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00462" } ] }, { "ec_number": "3.2.1.25", "activity": "", "evidence": [ { "id": "O00462", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00462" } ] } ] }, { "uniprot_ac": "O09131", "gene_name": "Gsto1", "activity": [ { "ec_number": "1.20.4.2", "activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] } ] }, { "uniprot_ac": "O14880", "gene_name": "MGST3", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "O14880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14880" } ] }, { "ec_number": "4.4.1.20", "activity": "leukotriene C4 = glutathione + leukotriene A4.", "evidence": [ { "id": "O14880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14880" } ] }, { "ec_number": "2.5.1.-", "activity": "", "evidence": [ { "id": "O14880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14880" } ] } ] }, { "uniprot_ac": "O15217", "gene_name": "GSTA4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O15217", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15217" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "O15217", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15217" } ] } ] }, { "uniprot_ac": "O35543", "gene_name": "Hpgds", "activity": [ { "ec_number": "5.3.99.2", "activity": "prostaglandin H2 = prostaglandin D2.", "evidence": [ { "id": "O35543", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35543" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O35543", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35543" } ] }, { "ec_number": "5.3.99.2", "activity": "", "evidence": [ { "id": "O35543", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35543" } ] } ] }, { "uniprot_ac": "O35660", "gene_name": "Gstm6", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O35660", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35660" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "O35660", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35660" } ] } ] }, { "uniprot_ac": "O43708", "gene_name": "GSTZ1", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "O43708", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43708" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "O43708", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43708" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O43708", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43708" } ] } ] }, { "uniprot_ac": "O43813", "gene_name": "LANCL1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O43813", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43813" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "O43813", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43813" } ] } ] }, { "uniprot_ac": "O60760", "gene_name": "HPGDS", "activity": [ { "ec_number": "5.3.99.2", "activity": "prostaglandin H2 = prostaglandin D2.", "evidence": [ { "id": "O60760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60760" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O60760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60760" } ] }, { "ec_number": "5.3.99.2", "activity": "", "evidence": [ { "id": "O60760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60760" } ] } ] }, { "uniprot_ac": "O89112", "gene_name": "Lancl1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "O89112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O89112" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "O89112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O89112" } ] } ] }, { "uniprot_ac": "O95497", "gene_name": "VNN1", "activity": [ { "ec_number": "3.5.1.92", "activity": "(R)-pantetheine + H2O = (R)-pantothenate + cysteamine.", "evidence": [ { "id": "O95497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95497" } ] }, { "ec_number": "3.5.1.92", "activity": "", "evidence": [ { "id": "O95497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95497" } ] } ] }, { "uniprot_ac": "P00502", "gene_name": "Gsta1", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "P00502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00502" } ] }, { "ec_number": "5.3.3.-", "activity": "", "evidence": [ { "id": "P00502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00502" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P00502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00502" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P00502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00502" } ] } ] }, { "uniprot_ac": "P04903", "gene_name": "Gsta2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P04903", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04903" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P04903", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04903" } ] } ] }, { "uniprot_ac": "P04904", "gene_name": "Gsta3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P04904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04904" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P04904", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04904" } ] } ] }, { "uniprot_ac": "P04905", "gene_name": "Gstm1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P04905", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04905" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P04905", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04905" } ] } ] }, { "uniprot_ac": "P04906", "gene_name": "Gstp1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P04906", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04906" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P04906", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04906" } ] } ] }, { "uniprot_ac": "P08009", "gene_name": "Gstm7", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P08009", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08009" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P08009", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08009" } ] } ] }, { "uniprot_ac": "P08010", "gene_name": "Gstm2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P08010", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08010" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P08010", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08010" } ] } ] }, { "uniprot_ac": "P08011", "gene_name": "Mgst1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P08011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08011" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P08011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08011" } ] } ] }, { "uniprot_ac": "P08263", "gene_name": "GSTA1", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "P08263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08263" } ] }, { "ec_number": "5.3.3.-", "activity": "", "evidence": [ { "id": "P08263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08263" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P08263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08263" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P08263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08263" } ] } ] }, { "uniprot_ac": "P09210", "gene_name": "GSTA2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P09210", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09210" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P09210", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09210" } ] } ] }, { "uniprot_ac": "P09211", "gene_name": "GSTP1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P09211", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09211" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P09211", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09211" } ] } ] }, { "uniprot_ac": "P09488", "gene_name": "GSTM1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P09488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09488" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P09488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09488" } ] } ] }, { "uniprot_ac": "P0CG29", "gene_name": "GSTT2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P0CG29", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CG29" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P0CG29", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CG29" } ] } ] }, { "uniprot_ac": "P0CG30", "gene_name": "GSTT2B", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P0CG30", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CG30" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P0CG30", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CG30" } ] } ] }, { "uniprot_ac": "P10253", "gene_name": "GAA", "activity": [ { "ec_number": "3.2.1.20", "activity": "Hydrolysis of terminal, non-reducing (1->4)-linked alpha-D-glucose residues with release of alpha-D-glucose.", "evidence": [ { "id": "P10253", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10253" } ] }, { "ec_number": "3.2.1.20", "activity": "", "evidence": [ { "id": "P10253", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10253" } ] } ] }, { "uniprot_ac": "P10620", "gene_name": "MGST1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P10620", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10620" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P10620", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10620" } ] } ] }, { "uniprot_ac": "P10648", "gene_name": "Gsta2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P10648", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10648" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P10648", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10648" } ] } ] }, { "uniprot_ac": "P10649", "gene_name": "Gstm1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P10649", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10649" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P10649", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10649" } ] } ] }, { "uniprot_ac": "P13745", "gene_name": "Gsta1", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "P13745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13745" } ] }, { "ec_number": "5.3.3.-", "activity": "", "evidence": [ { "id": "P13745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13745" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P13745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13745" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P13745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13745" } ] } ] }, { "uniprot_ac": "P14942", "gene_name": "Gsta4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P14942", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14942" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P14942", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14942" } ] } ] }, { "uniprot_ac": "P15291", "gene_name": "B4GALT1", "activity": [ { "ec_number": "2.4.1.-", "activity": "", "evidence": [ { "id": "P15291", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15291" } ] }, { "ec_number": "2.4.1.275", "activity": "a beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + UDP-alpha-D-galactose = a neolactoside nLc4Cer(d18:1(4E)) + H(+) + UDP.", "evidence": [ { "id": "P15291", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15291" } ] }, { "ec_number": "2.4.1.22", "activity": "D-glucose + UDP-alpha-D-galactose = H(+) + lactose + UDP.", "evidence": [ { "id": "P15291", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15291" } ] }, { "ec_number": "2.4.1.38", "activity": "an N-acetyl-beta-D-glucosaminyl derivative + UDP-alpha-D-galactose = a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "P15291", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15291" } ] }, { "ec_number": "2.4.1.90", "activity": "N-acetyl-D-glucosamine + UDP-alpha-D-galactose = beta-D-galactosyl-(1->4)-N-acetyl-D-glucosamine + H(+) + UDP.", "evidence": [ { "id": "P15291", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15291" } ] } ] }, { "uniprot_ac": "P15309", "gene_name": "ACP3", "activity": [ { "ec_number": "3.1.3.5", "activity": "a ribonucleoside 5'-phosphate + H2O = a ribonucleoside + phosphate.", "evidence": [ { "id": "P15309", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15309" } ] }, { "ec_number": "3.1.3.2", "activity": "a phosphate monoester + H2O = an alcohol + phosphate.", "evidence": [ { "id": "P15309", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15309" } ] }, { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "P15309", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15309" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P15309", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15309" } ] } ] }, { "uniprot_ac": "P15626", "gene_name": "Gstm2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P15626", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15626" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P15626", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15626" } ] } ] }, { "uniprot_ac": "P17695", "gene_name": "GRX2", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P17695", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17695" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P17695", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17695" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P17695", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17695" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "P17695", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17695" } ] } ] }, { "uniprot_ac": "P19157", "gene_name": "Gstp1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P19157", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19157" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P19157", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19157" } ] } ] }, { "uniprot_ac": "P19639", "gene_name": "Gstm3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P19639", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19639" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P19639", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19639" } ] } ] }, { "uniprot_ac": "P20432", "gene_name": "GstD1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P20432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20432" } ] }, { "ec_number": "4.5.1.1", "activity": "1,1,1-trichloro-2,2-bis(4-chlorophenyl)ethane = 1,1-dichloro-2,2-bis(4-chlorophenyl)ethylene + chloride + H(+).", "evidence": [ { "id": "P20432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20432" } ] }, { "ec_number": "4.5.1.1", "activity": "", "evidence": [ { "id": "P20432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20432" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P20432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20432" } ] } ] }, { "uniprot_ac": "P21266", "gene_name": "GSTM3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P21266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21266" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P21266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21266" } ] } ] }, { "uniprot_ac": "P24472", "gene_name": "Gsta4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P24472", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24472" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P24472", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24472" } ] } ] }, { "uniprot_ac": "P24473", "gene_name": "Gstk1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P24473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24473" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P24473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24473" } ] } ] }, { "uniprot_ac": "P25373", "gene_name": "GRX1", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H2O2 = glutathione disulfide + 2 H2O.", "evidence": [ { "id": "P25373", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25373" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P25373", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25373" } ] }, { "ec_number": "1.11.1.9", "activity": "", "evidence": [ { "id": "P25373", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25373" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P25373", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25373" } ] } ] }, { "uniprot_ac": "P28161", "gene_name": "GSTM2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P28161", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28161" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P28161", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28161" } ] } ] }, { "uniprot_ac": "P30115", "gene_name": "Gsta3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P30115", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30115" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P30115", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30115" } ] } ] }, { "uniprot_ac": "P30711", "gene_name": "GSTT1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P30711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30711" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P30711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30711" } ] } ] }, { "uniprot_ac": "P30713", "gene_name": "Gstt2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P30713", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30713" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P30713", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30713" } ] } ] }, { "uniprot_ac": "P36156", "gene_name": "ECM4", "activity": [ { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "P36156", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36156" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P36156", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36156" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P36156", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36156" } ] } ] }, { "uniprot_ac": "P40582", "gene_name": "GTT1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P40582", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40582" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P40582", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40582" } ] } ] }, { "uniprot_ac": "P41043", "gene_name": "GstS1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P41043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41043" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P41043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41043" } ] } ] }, { "uniprot_ac": "P42785", "gene_name": "PRCP", "activity": [ { "ec_number": "3.4.16.2", "activity": "Cleavage of a -Pro-|-Xaa bond to release a C-terminal amino acid.", "evidence": [ { "id": "P42785", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42785" } ] }, { "ec_number": "3.4.16.2", "activity": "", "evidence": [ { "id": "P42785", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42785" } ] } ] }, { "uniprot_ac": "P46418", "gene_name": "Gsta5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P46418", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46418" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P46418", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46418" } ] } ] }, { "uniprot_ac": "P46425", "gene_name": "Gstp2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P46425", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46425" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P46425", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46425" } ] } ] }, { "uniprot_ac": "P46439", "gene_name": "GSTM5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P46439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46439" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P46439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46439" } ] } ] }, { "uniprot_ac": "P48239", "gene_name": "GTO1", "activity": [ { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "P48239", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48239" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P48239", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48239" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P48239", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48239" } ] } ] }, { "uniprot_ac": "P48774", "gene_name": "Gstm5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P48774", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48774" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P48774", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48774" } ] } ] }, { "uniprot_ac": "P49768", "gene_name": "PSEN1", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P49768", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49768" } ] } ] }, { "uniprot_ac": "P51148", "gene_name": "RAB5C", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P51148", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51148" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P51148", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51148" } ] } ] }, { "uniprot_ac": "P57113", "gene_name": "Gstz1", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "P57113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P57113" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "P57113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P57113" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P57113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P57113" } ] } ] }, { "uniprot_ac": "P61224", "gene_name": "RAP1B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61224", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61224" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61224", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61224" } ] } ] }, { "uniprot_ac": "P78417", "gene_name": "GSTO1", "activity": [ { "ec_number": "1.20.4.2", "activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] } ] }, { "uniprot_ac": "Q01579", "gene_name": "Gstt1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q01579", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01579" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q01579", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01579" } ] } ] }, { "uniprot_ac": "Q03013", "gene_name": "GSTM4", "activity": [ { "ec_number": "4.4.1.20", "activity": "leukotriene C4 = glutathione + leukotriene A4.", "evidence": [ { "id": "Q03013", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03013" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q03013", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03013" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q03013", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03013" } ] } ] }, { "uniprot_ac": "Q04806", "gene_name": "GTO3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q04806", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04806" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q04806", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04806" } ] } ] }, { "uniprot_ac": "Q12390", "gene_name": "GTT2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q12390", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12390" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q12390", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12390" } ] } ] }, { "uniprot_ac": "Q16772", "gene_name": "GSTA3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q16772", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16772" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q16772", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16772" } ] } ] }, { "uniprot_ac": "Q4V8E6", "gene_name": "Gstt4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q4V8E6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V8E6" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q4V8E6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V8E6" } ] } ] }, { "uniprot_ac": "Q54GA9", "gene_name": "mgst", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q54GA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54GA9" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q54GA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54GA9" } ] } ] }, { "uniprot_ac": "Q54QV7", "gene_name": "gsta5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q54QV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QV7" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q54QV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QV7" } ] } ] }, { "uniprot_ac": "Q54VI4", "gene_name": "gsta3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q54VI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54VI4" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q54VI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54VI4" } ] } ] }, { "uniprot_ac": "Q556G3", "gene_name": "gsta2-2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q556G3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556G3" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q556G3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556G3" } ] } ] }, { "uniprot_ac": "Q55FF3", "gene_name": "gsta1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q55FF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55FF3" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q55FF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55FF3" } ] } ] }, { "uniprot_ac": "Q5BK56", "gene_name": "Gstm4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q5BK56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BK56" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q5BK56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BK56" } ] }, { "ec_number": "4.4.1.20", "activity": "leukotriene C4 = glutathione + leukotriene A4.", "evidence": [ { "id": "Q5BK56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BK56" } ] } ] }, { "uniprot_ac": "Q61133", "gene_name": "Gstt2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q61133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61133" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q61133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61133" } ] } ] }, { "uniprot_ac": "Q64471", "gene_name": "Gstt1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q64471", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64471" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q64471", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64471" } ] } ] }, { "uniprot_ac": "Q6AXV9", "gene_name": "Gsto2", "activity": [ { "ec_number": "1.20.4.2", "activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] } ] }, { "uniprot_ac": "Q6AXY0", "gene_name": "Gsta6", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q6AXY0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXY0" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q6AXY0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXY0" } ] } ] }, { "uniprot_ac": "Q6P8Q0", "gene_name": "Gm3776", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q6P8Q0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P8Q0" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q6P8Q0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P8Q0" } ] } ] }, { "uniprot_ac": "Q7JYX0", "gene_name": "GstE14", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q7JYX0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7JYX0" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q7JYX0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7JYX0" } ] } ] }, { "uniprot_ac": "Q7RTV2", "gene_name": "GSTA5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q7RTV2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7RTV2" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q7RTV2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7RTV2" } ] } ] }, { "uniprot_ac": "Q80W21", "gene_name": "Gstm7", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q80W21", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80W21" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q80W21", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80W21" } ] } ] }, { "uniprot_ac": "Q86AU1", "gene_name": "gsta4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q86AU1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86AU1" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q86AU1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86AU1" } ] } ] }, { "uniprot_ac": "Q86UQ4", "gene_name": "ABCA13", "activity": [ { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "Q86UQ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86UQ4" } ] } ] }, { "uniprot_ac": "Q8K2Q2", "gene_name": "Gsto2", "activity": [ { "ec_number": "1.20.4.2", "activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] } ] }, { "uniprot_ac": "Q8NF37", "gene_name": "LPCAT1", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q8NF37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NF37" } ] }, { "ec_number": "2.3.1.23", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "Q8NF37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NF37" } ] }, { "ec_number": "2.3.1.67", "activity": "1-O-alkyl-sn-glycero-3-phosphocholine + acetyl-CoA = a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "Q8NF37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NF37" } ] }, { "ec_number": "2.3.1.25", "activity": "1-O-(1Z-alkenyl)-sn-glycero-3-phosphocholine + an acyl-CoA = 1-O-(1Z-alkenyl)-2-acyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "Q8NF37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NF37" } ] }, { "ec_number": "2.3.1.23", "activity": "", "evidence": [ { "id": "Q8NF37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NF37" } ] } ] }, { "uniprot_ac": "Q8R5I6", "gene_name": "Gstm4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q8R5I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R5I6" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q8R5I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R5I6" } ] }, { "ec_number": "4.4.1.20", "activity": "leukotriene C4 = glutathione + leukotriene A4.", "evidence": [ { "id": "Q8R5I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R5I6" } ] } ] }, { "uniprot_ac": "Q91VS7", "gene_name": "Mgst1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q91VS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91VS7" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q91VS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91VS7" } ] } ] }, { "uniprot_ac": "Q99735", "gene_name": "MGST2", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "Q99735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99735" } ] }, { "ec_number": "4.4.1.20", "activity": "leukotriene C4 = glutathione + leukotriene A4.", "evidence": [ { "id": "Q99735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99735" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q99735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99735" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q99735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99735" } ] } ] }, { "uniprot_ac": "Q99L20", "gene_name": "Gstt3", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q99L20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99L20" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q99L20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99L20" } ] } ] }, { "uniprot_ac": "Q9D4P7", "gene_name": "Gstt4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9D4P7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D4P7" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9D4P7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D4P7" } ] } ] }, { "uniprot_ac": "Q9DCM2", "gene_name": "Gstk1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9DCM2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DCM2" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9DCM2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DCM2" } ] } ] }, { "uniprot_ac": "Q9H4Y5", "gene_name": "GSTO2", "activity": [ { "ec_number": "1.20.4.2", "activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.", "evidence": [ { "id": "Q9H4Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H4Y5" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "Q9H4Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H4Y5" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9H4Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H4Y5" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9H4Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H4Y5" } ] } ] }, { "uniprot_ac": "Q9JHF7", "gene_name": "Hpgds", "activity": [ { "ec_number": "5.3.99.2", "activity": "prostaglandin H2 = prostaglandin D2.", "evidence": [ { "id": "Q9JHF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHF7" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9JHF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHF7" } ] }, { "ec_number": "5.3.99.2", "activity": "", "evidence": [ { "id": "Q9JHF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHF7" } ] } ] }, { "uniprot_ac": "Q9QX69", "gene_name": "Lancl1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9QX69", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QX69" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9QX69", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QX69" } ] } ] }, { "uniprot_ac": "Q9VG93", "gene_name": "GstD7", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VG93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG93" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9VG93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG93" } ] } ] }, { "uniprot_ac": "Q9VG94", "gene_name": "GstD6", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VG94", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG94" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9VG94", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG94" } ] } ] }, { "uniprot_ac": "Q9VG95", "gene_name": "GstD5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VG95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG95" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9VG95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG95" } ] } ] }, { "uniprot_ac": "Q9VG96", "gene_name": "GstD4", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VG96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG96" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9VG96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG96" } ] } ] }, { "uniprot_ac": "Q9VG98", "gene_name": "GstD2", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VG98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG98" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9VG98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG98" } ] } ] }, { "uniprot_ac": "Q9VHD2", "gene_name": "GstZ2", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "Q9VHD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD2" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VHD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD2" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "Q9VHD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD2" } ] } ] }, { "uniprot_ac": "Q9VHD3", "gene_name": "GstZ1", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "Q9VHD3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD3" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9VHD3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD3" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "Q9VHD3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD3" } ] } ] }, { "uniprot_ac": "Q9WVL0", "gene_name": "Gstz1", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "Q9WVL0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVL0" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9WVL0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVL0" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "Q9WVL0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVL0" } ] } ] }, { "uniprot_ac": "Q9Y2G3", "gene_name": "ATP11B", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "Q9Y2G3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2G3" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "Q9Y2G3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2G3" } ] } ] }, { "uniprot_ac": "Q9Y2Q0", "gene_name": "ATP8A1", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "Q9Y2Q0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2Q0" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "Q9Y2Q0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2Q0" } ] } ] }, { "uniprot_ac": "Q9Y2Q3", "gene_name": "GSTK1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9Y2Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2Q3" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9Y2Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2Q3" } ] } ] }, { "uniprot_ac": "Q9Z1B2", "gene_name": "Gstm5", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9Z1B2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1B2" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9Z1B2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1B2" } ] } ] }, { "uniprot_ac": "Q9Z339", "gene_name": "Gsto1", "activity": [ { "ec_number": "1.20.4.2", "activity": "2 glutathione + H(+) + methylarsonate = glutathione disulfide + H2O + methylarsonous acid.", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] }, { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [ 64 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 57 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }