{ "uniprot_canonical_ac": "P10276-1", "uniprot_ac": "P10276", "uniprot_id": "RARA_HUMAN", "mass": { "chemical_mass": 50771.0, "monoisotopic_mass": 50771.0 }, "refseq": { "ac": "NP_000955", "name": "retinoic acid receptor alpha isoform 1", "summary": "This gene represents a nuclear retinoic acid receptor. The encoded protein, retinoic acid receptor alpha, regulates transcription in a ligand-dependent manner. This gene has been implicated in regulation of development, differentiation, apoptosis, granulopoeisis, and transcription of clock genes. Translocations between this locus and several other loci have been associated with acute promyelocytic leukemia. Alternatively spliced transcript variants have been found for this locus.[provided by RefSeq, Sep 2010].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000955" }, "gene_names": [ { "name": "RARA", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P10276", "id": "P10276" }, { "name": "NR1B1; RAR; RARalpha", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000955", "id": "NP_000955" }, { "name": "NR1B1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P10276", "id": "P10276" }, { "name": "RARA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000955", "id": "NP_000955" }, { "name": "hCG_2007196", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P10276", "id": "P10276" } ], "protein_names": [ { "name": "Retinoic acid receptor alpha", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P10276" }, { "name": "Nuclear receptor subfamily 1 group B member 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10276" }, { "name": "RAR-alpha", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10276" }, { "name": "retinoic acid receptor alpha isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000955", "id": "NP_000955" }, { "name": "retinoic acid receptor, alpha polypeptide; nucleophosmin-retinoic acid receptor alpha fusion protein NPM-RAR long form; PML-DDX5-RARA fusion; PML-DDX5-RARA fusion protein; RAR-alpha; nuclear receptor subfamily 1 group B member 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000955", "id": "NP_000955" } ], "function": [ { "annotation": "Hyperthermia promotes degradation of the acute promyelocytic leukemia driver oncoprotein ZBTB16/RARalpha.", "evidence": [ { "database": "RefSeq", "id": "NP_000955", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000955" }, { "database": "PubMed", "id": "36216898", "url": "https://glygen.org/publication/PubMed/36216898" } ] }, { "annotation": "Multi-omics and machine learning reveal context-specific gene regulatory activities of PML::RARA in acute promyelocytic leukemia. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_000955", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000955" }, { "database": "PubMed", "id": "36759620", "url": "https://glygen.org/publication/PubMed/36759620" } ] }, { "annotation": "Receptor for retinoic acid (PubMed:19850744, PubMed:16417524, PubMed:20215566). Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes (PubMed:28167758). The RXR/RAR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5 (PubMed:28167758, PubMed:19398580). In the absence of ligand, the RXR-RAR heterodimers associate with a multiprotein complex containing transcription corepressors that induce histone deacetylation, chromatin condensation and transcriptional suppression (PubMed:16417524). On ligand binding, the corepressors dissociate from the receptors and associate with the coactivators leading to transcriptional activation (PubMed:9267036, PubMed:19850744, PubMed:20215566). Formation of a complex with histone deacetylases might lead to inhibition of RARE DNA element binding and to transcriptional repression (PubMed:28167758). Transcriptional activation and RARE DNA element binding might be supported by the transcription factor KLF2 (PubMed:28167758). RARA plays an essential role in the regulation of retinoic acid-induced germ cell development during spermatogenesis (By similarity). Has a role in the survival of early spermatocytes at the beginning prophase of meiosis (By similarity). In Sertoli cells, may promote the survival and development of early meiotic prophase spermatocytes (By similarity). In concert with RARG, required for skeletal growth, matrix homeostasis and growth plate function (By similarity). Together with RXRA, positively regulates microRNA-10a expression, thereby inhibiting the GATA6/VCAM1 signaling response to pulsatile shear stress in vascular endothelial cells (PubMed:28167758). In association with HDAC3, HDAC5 and HDAC7 corepressors, plays a role in the repression of microRNA-10a and thereby promotes the inflammatory response (PubMed:28167758).", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276#function" }, { "database": "UniProtKB", "id": "P11416", "url": "https://www.uniprot.org/uniprot/P11416#function" }, { "database": "PubMed", "id": "19850744", "url": "https://glygen.org/publication/PubMed/19850744" }, { "database": "PubMed", "id": "20215566", "url": "https://glygen.org/publication/PubMed/20215566" }, { "database": "PubMed", "id": "28167758", "url": "https://glygen.org/publication/PubMed/28167758" }, { "database": "PubMed", "id": "16417524", "url": "https://glygen.org/publication/PubMed/16417524" }, { "database": "PubMed", "id": "9267036", "url": "https://glygen.org/publication/PubMed/9267036" }, { "database": "PubMed", "id": "19398580", "url": "https://glygen.org/publication/PubMed/19398580" } ] }, { "annotation": "This gene represents a nuclear retinoic acid receptor. The encoded protein, retinoic acid receptor alpha, regulates transcription in a ligand-dependent manner. This gene has been implicated in regulation of development, differentiation, apoptosis, granulopoeisis, and transcription of clock genes. Translocations between this locus and several other loci have been associated with acute promyelocytic leukemia. Alternatively spliced transcript variants have been found for this locus.[provided by RefSeq, Sep 2010].", "evidence": [ { "database": "RefSeq", "id": "NP_000955", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000955" } ] } ], "disease": [ { "disease_id": "DOID:0060318", "recommended_name": { "id": "DOID:0060318", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060318", "name": "acute promyelocytic leukemia", "description": "An acute myeloid leukemia characterized by accumulation of promyelocytes in the bone marrow and by a translocation between chromosomes 15 and 17." }, "synonyms": [ { "id": "DOID:0060318", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060318", "name": "acute myeloblastic leukaemia type 3", "description": "" }, { "id": "DOID:0060318", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060318", "name": "acute myeloblastic leukemia type 3", "description": "" }, { "id": "DOID:0060318", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060318", "name": "acute myeloid leukaemia M3", "description": "" }, { "id": "DOID:0060318", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060318", "name": "acute myeloid leukemia M3", "description": "" }, { "id": "DOID:0060318", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060318", "name": "acute promyelocytic leukaemia", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "acute promyelocytic leukemia", "description": "An aggressive form of acute myeloid leukemia (AML), characterized by arrest of leukocyte differentiation at the promyelocyte stage, due to a specific chromosomal translocation t(15;17) in myeloid cells. APL manifests with easy bruising, hemorrhagic diathesis and fatigue." }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "AML M3", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "AML with t(15;17)(q22;q12)", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "AML with t(15;17)(q22;q12);(PML/RARalpha) and variants", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "APL", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "APML", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "APML - acute promyelocytic leukaemia", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "APML - acute promyelocytic leukemia", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "FAB M3", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "acute myeloblastic leukaemia 3", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "acute myeloblastic leukaemia type 3", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "acute myeloblastic leukemia 3", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "acute myeloblastic leukemia type 3", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "acute myeloid leukaemia M3", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "acute myeloid leukaemia with t(15;17)(q22;q12);(PML/RARalpha) and variants", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "acute myeloid leukemia M3", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "acute myeloid leukemia with t(15;17)(q22;q12);(PML/RARalpha) and variants", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "acute promyelocytic leukaemia with PML-rara", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "acute promyelocytic leukaemia with t(15;17)(q22;q12); PML-rara", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "acute promyelocytic leukaemia with t(15;17)(q22;q12); PML/rara", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "acute promyelocytic leukemia", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "acute promyelocytic leukemia with PML-rara", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "acute promyelocytic leukemia with t(15;17)(q22;q12); PML-rara", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "acute promyelocytic leukemia with t(15;17)(q22;q12); PML/rara", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "leukemia, acute promyelocytic, somatic", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "promyelocytic leukaemia", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "promyelocytic leukemia", "description": "" }, { "id": "MONDO:0012883", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012883", "name": "leukemia, acute promyelocytic", "description": "" } ], "evidence": [ { "id": "612376", "database": "MIM", "url": "https://www.omim.org/entry/612376" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 147, "end_pos": 147, "sequence_org": "K", "sequence_mut": "R", "comment": "Abrogates sumoylation in the presence or absence of ATRA and primarily nuclear localization and enhanced ATRA-mediated transcriptional activity; when associated with R-166; R-171 and R-399.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "PubMed", "id": "19850744", "url": "https://glygen.org/publication/PubMed/19850744" } ] }, { "start_pos": 154, "end_pos": 154, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on PKB/AKT1-mediated phosphorylation. No repression of transactivation.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "PubMed", "id": "16417524", "url": "https://glygen.org/publication/PubMed/16417524" } ] }, { "start_pos": 157, "end_pos": 157, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on PKB/AKT1-mediated phosphorylation. Repressed transactivation.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "PubMed", "id": "16417524", "url": "https://glygen.org/publication/PubMed/16417524" } ] }, { "start_pos": 166, "end_pos": 166, "sequence_org": "K", "sequence_mut": "R", "comment": "Cytoplasmic in the absence of ATRA and reduced transcriptional activity in the presence of ATRA. Low sumoylation levels in the presence of ATRA; when associated with R-399. Nuclear localization and enhanced transcriptional activity; when associated with R-171 and R-399. Primarily nuclear localization and enhanced ATRA-mediated transcriptional activity; when associated with R-147; R-171 and R-399.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "PubMed", "id": "19850744", "url": "https://glygen.org/publication/PubMed/19850744" } ] }, { "start_pos": 171, "end_pos": 171, "sequence_org": "K", "sequence_mut": "R", "comment": "Cytoplasmic in the absence of ATRA and reduced transcriptional activity in the presence of ATRA. Low sumoylation levels in the presence of ATRA; when associated with R-399. Nuclear localization and enhanced transcriptional activity; when associated with R-166 and R-399. Primarily nuclear localization and enhanced ATRA-mediated transcriptional activity; when associated with R-147; R-166 and R-399.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "PubMed", "id": "19850744", "url": "https://glygen.org/publication/PubMed/19850744" } ] }, { "start_pos": 219, "end_pos": 219, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on heterodimerization with RARA. On ATRA treatment, localizes to the nucleus, and increased protein levels; when associated with A-369.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "PubMed", "id": "20215566", "url": "https://glygen.org/publication/PubMed/20215566" } ] }, { "start_pos": 219, "end_pos": 219, "sequence_org": "S", "sequence_mut": "E", "comment": "No effect on heterodimerization with RARA. On ATRA treatment, localizes to both nucleus and cytoplasm, no increase in protein levels, and decrease in RARA-mediated transcriptional activity; when associated with E-369.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "PubMed", "id": "20215566", "url": "https://glygen.org/publication/PubMed/20215566" } ] }, { "start_pos": 369, "end_pos": 369, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on heterodimerization with RARA. On ATRA treatment, localizes to the nucleus, and increased protein levels; when associated with A-219.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "PubMed", "id": "20215566", "url": "https://glygen.org/publication/PubMed/20215566" } ] }, { "start_pos": 369, "end_pos": 369, "sequence_org": "S", "sequence_mut": "E", "comment": "Some inhibition of heterodimerization with RARA. On ATRA treatment, localizes to both nucleus and cytoplasm, increase in protein levels, and decrease in RARA-mediated transcriptional activity; when associated with E-219.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "PubMed", "id": "20215566", "url": "https://glygen.org/publication/PubMed/20215566" } ] }, { "start_pos": 396, "end_pos": 396, "sequence_org": "I", "sequence_mut": "E", "comment": "Abrogates interaction with NCOR1 or NCOR2. Increased affinity for NCOR1 and NCOR2 in the presence of BMS493. Increased transcriptional activity in the presence of agonist and decreased activity in the presence of neutral antagonist.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "PubMed", "id": "20543827", "url": "https://glygen.org/publication/PubMed/20543827" } ] }, { "start_pos": 399, "end_pos": 399, "sequence_org": "K", "sequence_mut": "R", "comment": "In the absence of ATRA, abolishes sumoylation and is mainly nuclear. In the presence of ATRA, some sumoylation, cytoplasmic location, reduced transcriptional activity and no SENP6 binding. Low sumoylation levels in the presence of ATRA and nuclear location in the absence of ATRA; when associated with R-166 or with R-171. Primarily nuclear localization and enhanced ATRA-mediated transcriptional activity; when associated with R-147; R-166 and R-171.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "PubMed", "id": "19850744", "url": "https://glygen.org/publication/PubMed/19850744" } ] }, { "start_pos": 409, "end_pos": 410, "sequence_org": "LI", "sequence_mut": "AA", "comment": "Abolishes interaction with ASXL1 and NCOA1.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "PubMed", "id": "16606617", "url": "https://glygen.org/publication/PubMed/16606617" } ] }, { "start_pos": 412, "end_pos": 412, "sequence_org": "E", "sequence_mut": "Q", "comment": "Impairs interaction with ASXL1 and NCOA1; when associated with Q-415.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "PubMed", "id": "16606617", "url": "https://glygen.org/publication/PubMed/16606617" } ] }, { "start_pos": 413, "end_pos": 414, "sequence_org": "ML", "sequence_mut": "AA", "comment": "Abolishes interaction with ASXL1 and NCOA1.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "PubMed", "id": "16606617", "url": "https://glygen.org/publication/PubMed/16606617" } ] }, { "start_pos": 415, "end_pos": 415, "sequence_org": "E", "sequence_mut": "Q", "comment": "Impairs interaction with ASXL1 and NCOA1; when associated with Q-412.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "PubMed", "id": "16606617", "url": "https://glygen.org/publication/PubMed/16606617" } ] }, { "start_pos": 95, "end_pos": 95, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on PKB/AKT1-mediated phosphorylation. Repressed transactivation.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "PubMed", "id": "16417524", "url": "https://glygen.org/publication/PubMed/16417524" } ] }, { "start_pos": 96, "end_pos": 96, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes PKB/AKT1-mediated phosphorylation. Repressed transactivation.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "PubMed", "id": "16417524", "url": "https://glygen.org/publication/PubMed/16417524" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "79.76", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131759", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131759" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "74.07", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131759", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131759" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "84.12", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000131759", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131759" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "79.79", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131759", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131759" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "92.13", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000131759", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131759" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "85.56", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000131759", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131759" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "86.34", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000131759", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131759" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "82.02", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000131759", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131759" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "87.46", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000131759", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131759" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "90.07", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000131759", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131759" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "85.39", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000131759", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131759" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "89.46", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000131759", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131759" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "92.02", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000131759", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131759" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P10276", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10276" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P10276", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10276" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P10276", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10276" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P10276", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10276" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P10276", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10276" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P10276", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10276" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P10276", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10276" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P10276", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10276" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P10276", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10276" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P10276", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10276" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P10276", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10276" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P10276", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10276" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "common_name": "Human" } ], "gene": [ { "name": "RARA", "url": "https://www.uniprot.org/uniprot/P10276", "locus": { "chromosome": "17", "start_pos": 40357643, "end_pos": 40309180, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000131759", "url": "https://www.ensembl.org/id/ENSG00000131759" } ] } } ], "crossref": [ { "id": "ENSG00000131759", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000131759", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd06937", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd06937", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd06964", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd06964", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL2055", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2055", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "RARA", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=RARA", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "5914", "url": "https://www.ncbi.nlm.nih.gov/gene/5914", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "9864", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=9864", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P10276", "url": "https://www.ebi.ac.uk/intact/interactors/id:P10276*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000536", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000536", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001628", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001628", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001723", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001723", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003078", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003078", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013088", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013088", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035500", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035500", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047158", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047158", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047159", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047159", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:5914", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5914", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "180240", "url": "http://www.omim.org/entry/180240", "database": "MIM", "categories": [ "Other" ] }, { "id": "612376", "url": "http://www.omim.org/entry/612376", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P10276", "url": "https://www.nextprot.org/entry/NX_P10276", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "CHTRAPT", "url": "https://omabrowser.org/oma/group/CHTRAPT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5390715at2759", "url": "http://www.orthodb.org/?query=5390715at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24085", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24085", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24085:SF8", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24085:SF8", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1DKF", "url": "https://www.rcsb.org/structure/1DKF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1DSZ", "url": "https://www.rcsb.org/structure/1DSZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3A9E", "url": "https://www.rcsb.org/structure/3A9E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KMR", "url": "https://www.rcsb.org/structure/3KMR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KMZ", "url": "https://www.rcsb.org/structure/3KMZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4DQM", "url": "https://www.rcsb.org/structure/4DQM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5K13", "url": "https://www.rcsb.org/structure/5K13", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6XWG", "url": "https://www.rcsb.org/structure/6XWG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7AOS", "url": "https://www.rcsb.org/structure/7AOS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7APO", "url": "https://www.rcsb.org/structure/7APO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7QAA", "url": "https://www.rcsb.org/structure/7QAA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7WQQ", "url": "https://www.rcsb.org/structure/7WQQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00104", "url": "http://pfam.xfam.org/family/PF00104", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00105", "url": "http://pfam.xfam.org/family/PF00105", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P10276", "url": "https://pharos.nih.gov/targets/P10276", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P10276", "url": "http://purl.obolibrary.org/obo/PR_P10276", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-383280", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-383280", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5362517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5362517", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_000955", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000955", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A8MUP8", "url": "https://www.uniprot.org/uniprot/A8MUP8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A8MUP8-1", "url": "https://www.uniprot.org/uniprot/A8MUP8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3KSJ4", "url": "https://www.uniprot.org/uniprot/J3KSJ4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3KSJ4-1", "url": "https://www.uniprot.org/uniprot/J3KSJ4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QRM2", "url": "https://www.uniprot.org/uniprot/J3QRM2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3QRM2-1", "url": "https://www.uniprot.org/uniprot/J3QRM2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10276-1", "url": "https://www.uniprot.org/uniprot/P10276-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10276-2", "url": "https://www.uniprot.org/uniprot/P10276-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10276-3", "url": "https://www.uniprot.org/uniprot/P10276-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP", "length": 462, "header": "sp|P10276-1|RARA_HUMAN Isoform 1 of Retinoic acid receptor alpha OS=Homo sapiens OX=9606 GN=RARA PE=1 SV=2 CANONICAL=P10276-1" }, "isoforms": [ { "isoform_ac": "A8MUP8-1", "url": "", "sequence": { "sequence": "MMSQTMTQAGVSFRHSVRAAQCHTRVPNTWPRATRPYASCRRSPRLRGRWPGSAGQGAGGRAPRAGWRAGDVTGSAIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP", "length": 478, "header": "tr|A8MUP8-1|RARA_HUMAN Computationally mapped isoform of Retinoic acid receptor alpha OS=Homo sapiens OX=9606 GN=RARA PE=1 SV=1 CANONICAL=P10276-1" }, "locus": { "chromosome": "17", "start_pos": 40356223, "end_pos": 40341390, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000394086.7", "url": "https://www.ensembl.org/id/ENST00000394086.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000377648.3", "url": "https://www.ensembl.org/id/ENSP00000377648.3" } ] } }, { "isoform_ac": "J3KSJ4-1", "url": "", "sequence": { "sequence": "MVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPL", "length": 186, "header": "tr|J3KSJ4-1|J3KSJ4_HUMAN Computationally mapped isoform of Retinoic acid receptor alpha OS=Homo sapiens OX=9606 GN=RARA PE=1 SV=1 CANONICAL=P10276-1" }, "locus": { "chromosome": "17", "start_pos": 40354409, "end_pos": 40349814, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000475125.1", "url": "https://www.ensembl.org/id/ENST00000475125.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000462514.1", "url": "https://www.ensembl.org/id/ENSP00000462514.1" } ] } }, { "isoform_ac": "J3QRM2-1", "url": "", "sequence": { "sequence": "MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSS", "length": 66, "header": "tr|J3QRM2-1|J3QRM2_HUMAN Computationally mapped isoform of Retinoic acid receptor alpha OS=Homo sapiens OX=9606 GN=RARA PE=4 SV=1 CANONICAL=P10276-1" }, "locus": { "chromosome": "17", "start_pos": 40348335, "end_pos": 40331219, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000577646.5", "url": "https://www.ensembl.org/id/ENST00000577646.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000464287.1", "url": "https://www.ensembl.org/id/ENSP00000464287.1" } ] } }, { "isoform_ac": "P10276-1", "url": "", "sequence": { "sequence": "MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP", "length": 462, "header": "sp|P10276-1|RARA_HUMAN Isoform 1 of Retinoic acid receptor alpha OS=Homo sapiens OX=9606 GN=RARA PE=1 SV=2 CANONICAL=P10276-1" }, "locus": { "chromosome": "17", "start_pos": 40356223, "end_pos": 40331219, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000254066.10", "url": "https://www.ensembl.org/id/ENST00000254066.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000254066.5", "url": "https://www.ensembl.org/id/ENSP00000254066.5" } ] } }, { "isoform_ac": "P10276-2", "url": "", "sequence": { "sequence": "MYESVEVGGPTPNPFLVVDFYNQNRACLLPEKGLPAPGPYSTPLRTPLWNGSNHSIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP", "length": 457, "header": "sp|P10276-2|RARA_HUMAN Isoform 2 of Retinoic acid receptor alpha OS=Homo sapiens OX=9606 GN=RARA PE=1 SV=2 CANONICAL=P10276-1" }, "locus": { "chromosome": "17", "start_pos": 40356223, "end_pos": 40342705, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000394081.7", "url": "https://www.ensembl.org/id/ENST00000394081.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000377643.3", "url": "https://www.ensembl.org/id/ENSP00000377643.3" } ] } }, { "isoform_ac": "P10276-3", "url": "", "sequence": { "sequence": "MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP", "length": 365, "header": "sp|P10276-3|RARA_HUMAN Isoform 3 of Retinoic acid receptor alpha OS=Homo sapiens OX=9606 GN=RARA PE=1 SV=2 CANONICAL=P10276-1" }, "locus": { "chromosome": "17", "start_pos": 40356223, "end_pos": 40331219, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000425707.7", "url": "https://www.ensembl.org/id/ENST00000425707.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000389993.3", "url": "https://www.ensembl.org/id/ENSP00000389993.3" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 157, "end_pos": 157, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "10608897", "url": "https://glygen.org/publication/PubMed/10608897" } ], "site_lbl": "Ser157" }, { "start_pos": 181, "end_pos": 181, "kinase_uniprot_canonical_ac": "P45983-1", "kinase_gene_name": "MAPK8", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "15657432", "url": "https://glygen.org/publication/PubMed/15657432" } ], "site_lbl": "Thr181" }, { "start_pos": 181, "end_pos": 181, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P10276", "url": "http://phospho.elm.eu.org/byAccession/P10276.html" }, { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "15657432", "url": "https://glygen.org/publication/PubMed/15657432" } ], "site_lbl": "Thr181" }, { "start_pos": 210, "end_pos": 210, "kinase_uniprot_canonical_ac": "Q13555-1", "kinase_gene_name": "CAMK2G", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "17431504", "url": "https://glygen.org/publication/PubMed/17431504" } ], "site_lbl": "Thr210" }, { "start_pos": 219, "end_pos": 219, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "20215566", "url": "https://glygen.org/publication/PubMed/20215566" } ], "site_lbl": "Ser219" }, { "start_pos": 369, "end_pos": 369, "kinase_uniprot_canonical_ac": "O75582-1", "kinase_gene_name": "RPS6KA5", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "19078967", "url": "https://glygen.org/publication/PubMed/19078967" } ], "site_lbl": "Ser369" }, { "start_pos": 369, "end_pos": 369, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "16769902", "url": "https://glygen.org/publication/PubMed/16769902" }, { "database": "PubMed", "id": "19078967", "url": "https://glygen.org/publication/PubMed/19078967" }, { "database": "PubMed", "id": "20215566", "url": "https://glygen.org/publication/PubMed/20215566" } ], "site_lbl": "Ser369" }, { "start_pos": 445, "end_pos": 445, "kinase_uniprot_canonical_ac": "P45983-1", "kinase_gene_name": "MAPK8", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "15657432", "url": "https://glygen.org/publication/PubMed/15657432" } ], "site_lbl": "Ser445" }, { "start_pos": 445, "end_pos": 445, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P10276", "url": "http://phospho.elm.eu.org/byAccession/P10276.html" }, { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "15657432", "url": "https://glygen.org/publication/PubMed/15657432" } ], "site_lbl": "Ser445" }, { "start_pos": 461, "end_pos": 461, "kinase_uniprot_canonical_ac": "P45983-1", "kinase_gene_name": "MAPK8", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "15657432", "url": "https://glygen.org/publication/PubMed/15657432" } ], "site_lbl": "Ser461" }, { "start_pos": 461, "end_pos": 461, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "P10276", "url": "http://phospho.elm.eu.org/byAccession/P10276.html" }, { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "15657432", "url": "https://glygen.org/publication/PubMed/15657432" } ], "site_lbl": "Ser461" }, { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "P50613-1", "kinase_gene_name": "CDK7", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "9230306", "url": "https://glygen.org/publication/PubMed/9230306" }, { "database": "phospho.ELM", "id": "P10276", "url": "http://phospho.elm.eu.org/byAccession/P10276.html" }, { "database": "PubMed", "id": "11955452", "url": "https://glygen.org/publication/PubMed/11955452" } ], "site_lbl": "Ser77" }, { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK7", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "PRO", "id": "P10276", "url": "http://purl.obolibrary.org/obo/P10276" }, { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "16275922", "url": "https://glygen.org/publication/PubMed/16275922" }, { "database": "PubMed", "id": "11955452", "url": "https://glygen.org/publication/PubMed/11955452" }, { "database": "PubMed", "id": "12054865", "url": "https://glygen.org/publication/PubMed/12054865" }, { "database": "PubMed", "id": "15670742", "url": "https://glygen.org/publication/PubMed/15670742" }, { "database": "PubMed", "id": "16769902", "url": "https://glygen.org/publication/PubMed/16769902" }, { "database": "PubMed", "id": "22135230", "url": "https://glygen.org/publication/PubMed/22135230" }, { "database": "PubMed", "id": "33902658", "url": "https://glygen.org/publication/PubMed/33902658" }, { "database": "PubMed", "id": "9230306", "url": "https://glygen.org/publication/PubMed/9230306" } ], "site_lbl": "Ser77" }, { "start_pos": 96, "end_pos": 96, "kinase_uniprot_canonical_ac": "P31749-1", "kinase_gene_name": "AKT1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "16417524", "url": "https://glygen.org/publication/PubMed/16417524" } ], "site_lbl": "Ser96" }, { "start_pos": 96, "end_pos": 96, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKB/AKT1", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" }, { "database": "PubMed", "id": "16417524", "url": "https://glygen.org/publication/PubMed/16417524" } ], "site_lbl": "Ser96" } ], "glycation": [], "keywords": [], "publication": [ { "title": "C/EBPepsilon directly interacts with the DNA binding domain of c-myb and cooperatively activates transcription of myeloid promoters.", "journal": "Blood", "date": "1999", "authors": "Verbeek W, Gombart AF, Chumakov AM, Muller C, Friedman AD, Koeffler HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "10233885", "url": "https://glygen.org/publication/PubMed/10233885" } ] }, { "title": "Ligand-dependent transcription activation by nuclear receptors requires the DRIP complex.", "journal": "Nature", "date": "1999", "authors": "Rachez C, Lemon BD, Suldan Z, Bromleigh V, Gamble M, Naar AM, Erdjument-Bromage H, Tempst P, Freedman LP", "evidence": [ { "database": "Reactome", "id": "R-HSA-383280", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-383280" } ], "reference": [ { "type": "PubMed", "id": "10235266", "url": "https://glygen.org/publication/PubMed/10235266" } ] }, { "title": "CCAAT/enhancer binding protein epsilon is a potential retinoid target gene in acute promyelocytic leukemia treatment.", "journal": "The Journal of clinical investigation", "date": "1999", "authors": "Park DJ, Chumakov AM, Vuong PT, Chih DY, Gombart AF, Miller WH Jr, Koeffler HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "10330422", "url": "https://glygen.org/publication/PubMed/10330422" } ] }, { "title": "Genomic structure of the human retinoic acid receptor-alpha1 gene.", "journal": "Mamm. Genome", "date": "1999", "authors": "Hjalt T A, Murray J C", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "10337631", "url": "https://glygen.org/publication/PubMed/10337631" } ] }, { "title": "Expression, purification, and crystal structure determination of recombinant human epidermal-type fatty acid binding protein.", "journal": "Biochemistry", "date": "1999", "authors": "Hohoff C, Borchers T, Rustow B, Spener F, van Tilbeurgh H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5362517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5362517" } ], "reference": [ { "type": "PubMed", "id": "10493790", "url": "https://glygen.org/publication/PubMed/10493790" } ] }, { "title": "Multimeric Coactivator Complexes for Steroid/Nuclear Receptors.", "journal": "Trends in endocrinology and metabolism: TEM", "date": "1999", "authors": "Freedman LP", "evidence": [ { "database": "Reactome", "id": "R-HSA-383280", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-383280" } ], "reference": [ { "type": "PubMed", "id": "10542397", "url": "https://glygen.org/publication/PubMed/10542397" } ] }, { "title": "A nuclear factor ASC-2, as a cancer-amplified transcriptional coactivator essential for ligand-dependent transactivation by nuclear receptors in vivo.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "Lee SK, Anzick SL, Choi JE, Bubendorf L, Guan XY, Jung YK, Kallioniemi OP, Kononen J, Trent JM, Azorsa D, Jhun BH, Cheong JH, Lee YC, Meltzer PS, Lee JW", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "10567404", "url": "https://glygen.org/publication/PubMed/10567404" } ] }, { "title": "Serine 157, a retinoic acid receptor alpha residue phosphorylated by protein kinase C in vitro, is involved in RXR.RARalpha heterodimerization and transcriptional activity.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Delmotte MH, Tahayato A, Formstecher P, Lefebvre P", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" } ], "reference": [ { "type": "PubMed", "id": "10608897", "url": "https://glygen.org/publication/PubMed/10608897" } ] }, { "title": "Structure of the RXR-RAR DNA-binding complex on the retinoic acid response element DR1.", "journal": "EMBO J.", "date": "2000", "authors": "Rastinejad F, Wagner T, Zhao Q, Khorasanizadeh S", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "10698945", "url": "https://glygen.org/publication/PubMed/10698945" } ] }, { "title": "Recruitment of nuclear receptor corepressor and coactivator to the retinoic acid receptor by retinoid ligands. Influence of DNA-heterodimer interactions.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Klein ES, Wang JW, Khalifa B, Gavigan SA, Chandraratna RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "10777502", "url": "https://glygen.org/publication/PubMed/10777502" } ] }, { "title": "Crystal structure of a heterodimeric complex of RAR and RXR ligand-binding domains.", "journal": "Mol. Cell", "date": "2000", "authors": "Bourguet W, Vivat V, Wurtz J M, Chambon P, Gronemeyer H, Moras D", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "10882070", "url": "https://glygen.org/publication/PubMed/10882070" } ] }, { "title": "Covalent modification of the androgen receptor by small ubiquitin-like modifier 1 (SUMO-1).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Poukka H, Karvonen U, Janne OA, Palvimo JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "11121022", "url": "https://glygen.org/publication/PubMed/11121022" } ] }, { "title": "Dominant-negative mutations of CEBPA, encoding CCAAT/enhancer binding protein-alpha (C/EBPalpha), in acute myeloid leukemia.", "journal": "Nature genetics", "date": "2001", "authors": "Pabst T, Mueller BU, Zhang P, Radomska HS, Narravula S, Schnittger S, Behre G, Hiddemann W, Tenen DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11242107", "url": "https://glygen.org/publication/PubMed/11242107" } ] }, { "title": "c-Myc is a critical target for c/EBPalpha in granulopoiesis.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Johansen LM, Iwama A, Lodie TA, Sasaki K, Felsher DW, Golub TR, Tenen DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11340171", "url": "https://glygen.org/publication/PubMed/11340171" } ] }, { "title": "CCAAT/enhancer-binding protein-alpha cooperates with p21 to inhibit cyclin-dependent kinase-2 activity and induces growth arrest independent of DNA binding.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Harris TE, Albrecht JH, Nakanishi M, Darlington GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11369759", "url": "https://glygen.org/publication/PubMed/11369759" } ] }, { "title": "Use of chromatin immunoprecipitation to clone novel E2F target promoters.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Weinmann AS, Bartley SM, Zhang T, Zhang MQ, Farnham PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11564866", "url": "https://glygen.org/publication/PubMed/11564866" } ] }, { "title": "C/EBPalpha arrests cell proliferation through direct inhibition of Cdk2 and Cdk4.", "journal": "Molecular cell", "date": "2001", "authors": "Wang H, Iakova P, Wilde M, Welm A, Goode T, Roesler WJ, Timchenko NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11684017", "url": "https://glygen.org/publication/PubMed/11684017" } ] }, { "title": "Retinoic acid receptor alpha1 variants, RARalpha1DeltaB and RARalpha1DeltaBC, define a new class of nuclear receptor isoforms.", "journal": "Nucleic Acids Res.", "date": "2001", "authors": "Parrado A, Despouy G, Kra\u00efba R, Le Pogam C, Dupas S, Choquette M, Robledo M, Larghero J, Bui H, Le Gall I, Rochette-Egly C, Chomienne C, Padua R A", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "11812818", "url": "https://glygen.org/publication/PubMed/11812818" } ] }, { "title": "Biological roles and mechanistic actions of co-repressor complexes.", "journal": "Journal of cell science", "date": "2002", "authors": "Jepsen K, Rosenfeld MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-383280", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-383280" } ], "reference": [ { "type": "PubMed", "id": "11865025", "url": "https://glygen.org/publication/PubMed/11865025" } ] }, { "title": "C/EBPalpha triggers proteasome-dependent degradation of cdk4 during growth arrest.", "journal": "The EMBO journal", "date": "2002", "authors": "Wang H, Goode T, Iakova P, Albrecht JH, Timchenko NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "11867521", "url": "https://glygen.org/publication/PubMed/11867521" } ] }, { "title": "Direct channeling of retinoic acid between cellular retinoic acid-binding protein II and retinoic acid receptor sensitizes mammary carcinoma cells to retinoic acid-induced growth arrest.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Budhu AS, Noy N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5362517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5362517" } ], "reference": [ { "type": "PubMed", "id": "11909957", "url": "https://glygen.org/publication/PubMed/11909957" } ] }, { "title": "XPD mutations prevent TFIIH-dependent transactivation by nuclear receptors and phosphorylation of RARalpha.", "journal": "Cell", "date": "2002", "authors": "Keriel A, Stary A, Sarasin A, Rochette-Egly C, Egly JM", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" } ], "reference": [ { "type": "PubMed", "id": "11955452", "url": "https://glygen.org/publication/PubMed/11955452" } ] }, { "title": "ERAP140, a conserved tissue-specific nuclear receptor coactivator.", "journal": "Mol. Cell. Biol.", "date": "2002", "authors": "Shao W, Halachmi S, Brown M", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "11971969", "url": "https://glygen.org/publication/PubMed/11971969" } ] }, { "title": "Identification of protein arginine methyltransferase 2 as a coactivator for estrogen receptor alpha.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Qi C, Chang J, Zhu Y, Yeldandi AV, Rao SM, Zhu YJ", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "12039952", "url": "https://glygen.org/publication/PubMed/12039952" } ] }, { "title": "Promoter of FGF8 reveals a unique regulation by unliganded RARalpha.", "journal": "Journal of molecular biology", "date": "2002", "authors": "Brondani V, Klimkait T, Egly JM, Hamy F", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" } ], "reference": [ { "type": "PubMed", "id": "12054865", "url": "https://glygen.org/publication/PubMed/12054865" } ] }, { "title": "PIAS proteins modulate transcription factors by functioning as SUMO-1 ligases.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Kotaja N, Karvonen U, Janne OA, Palvimo JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "12077349", "url": "https://glygen.org/publication/PubMed/12077349" } ] }, { "title": "Small ubiquitin-related modifier-1 (SUMO-1) modification of the glucocorticoid receptor.", "journal": "The Biochemical journal", "date": "2002", "authors": "Tian S, Poukka H, Palvimo JJ, Janne OA", "evidence": [ { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "12144530", "url": "https://glygen.org/publication/PubMed/12144530" } ] }, { "title": "PIAS1 and PIASxalpha function as SUMO-E3 ligases toward androgen receptor and repress androgen receptor-dependent transcription.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Nishida T, Yasuda H", "evidence": [ { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "12177000", "url": "https://glygen.org/publication/PubMed/12177000" } ] }, { "title": "Calreticulin interacts with C/EBPalpha and C/EBPbeta mRNAs and represses translation of C/EBP proteins.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Timchenko LT, Iakova P, Welm AL, Cai ZJ, Timchenko NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "12242300", "url": "https://glygen.org/publication/PubMed/12242300" } ] }, { "title": "Cytogenetics, FISH and RT-PCR analysis of acute promyelocytic leukemia: structure of the fusion point in a case lacking classic t(15;17) translocation.", "journal": "Leuk. Lymphoma", "date": "2003", "authors": "Fujita Kazuhiro, Oba Remi, Harada Hiroshi, Mori Hiraku, Niikura Haruo, Isoyama Keiichi, Omine Mitsuhiro", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "12691149", "url": "https://glygen.org/publication/PubMed/12691149" } ] }, { "title": "Transcription activation function of C/EBPalpha is required for induction of granulocytic differentiation.", "journal": "Blood", "date": "2003", "authors": "Keeshan K, Santilli G, Corradini F, Perrotti D, Calabretta B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "12702500", "url": "https://glygen.org/publication/PubMed/12702500" } ] }, { "title": "The amino terminal and E2F interaction domains are critical for C/EBP alpha-mediated induction of granulopoietic development of hematopoietic cells.", "journal": "Blood", "date": "2003", "authors": "D'Alo' F, Johansen LM, Nelson EA, Radomska HS, Evans EK, Zhang P, Nerlov C, Tenen DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "12869508", "url": "https://glygen.org/publication/PubMed/12869508" } ] }, { "title": "Protein inhibitor of activated signal transducer and activator of transcription 1 interacts with the N-terminal domain of mineralocorticoid receptor and represses its transcriptional activity: implication of small ubiquitin-related modifier 1 modification.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2003", "authors": "Tallec LP, Kirsh O, Lecomte MC, Viengchareun S, Zennaro MC, Dejean A, Lombes M", "evidence": [ { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "14500761", "url": "https://glygen.org/publication/PubMed/14500761" } ] }, { "title": "Restoration of C/EBPalpha expression in a BCR-ABL+ cell line induces terminal granulocytic differentiation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Tavor S, Park DJ, Gery S, Vuong PT, Gombart AF, Koeffler HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "14517214", "url": "https://glygen.org/publication/PubMed/14517214" } ] }, { "title": "A unified nomenclature for protein subunits of mediator complexes linking transcriptional regulators to RNA polymerase II.", "journal": "Molecular cell", "date": "2004", "authors": "Bourbon HM, Aguilera A, Ansari AZ, Asturias FJ, Berk AJ, Bjorklund S, Blackwell TK, Borggrefe T, Carey M, Carlson M, Conaway JW, Conaway RC, Emmons SW, Fondell JD, Freedman LP, Fukasawa T, Gustafsson CM, Han M, He X, Herman PK, Hinnebusch AG, Holmberg S, Holstege FC, Jaehning JA, Kim YJ, Kuras L, Leutz A, Lis JT, Meisterernest M, Naar AM, Nasmyth K, Parvin JD, Ptashne M, Reinberg D, Ronne H, Sadowski I, Sakurai H, Sipiczki M, Sternberg PW, Stillman DJ, Strich R, Struhl K, Svejstrup JQ, Tuck S, Winston F, Roeder RG, Kornberg RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-383280", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-383280" } ], "reference": [ { "type": "PubMed", "id": "15175151", "url": "https://glygen.org/publication/PubMed/15175151" } ] }, { "title": "Small ubiquitin-like modifier 1 (SUMO-1) modification of the synergy control motif of Ad4 binding protein/steroidogenic factor 1 (Ad4BP/SF-1) regulates synergistic transcription between Ad4BP/SF-1 and Sox9.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2004", "authors": "Komatsu T, Mizusaki H, Mukai T, Ogawa H, Baba D, Shirakawa M, Hatakeyama S, Nakayama KI, Yamamoto H, Kikuchi A, Morohashi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "15192080", "url": "https://glygen.org/publication/PubMed/15192080" } ] }, { "title": "SUMO modification of repression domains modulates function of nuclear receptor 5A1 (steroidogenic factor-1).", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Chen WY, Lee WC, Hsu NC, Huang F, Chung BC", "evidence": [ { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "15192092", "url": "https://glygen.org/publication/PubMed/15192092" } ] }, { "title": "Retinoid X receptor regulates Nur77/TR3-dependent apoptosis [corrected] by modulating its nuclear export and mitochondrial targeting.", "journal": "Mol. Cell. Biol.", "date": "2004", "authors": "Cao X, Liu W, Lin F, Li H, Kolluri SK, Lin B, Han YH, Dawson MI, Zhang XK", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "15509776", "url": "https://glygen.org/publication/PubMed/15509776" } ] }, { "title": "c-Jun N-terminal kinase contributes to aberrant retinoid signaling in lung cancer cells by phosphorylating and inducing proteasomal degradation of retinoic acid receptor alpha.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Srinivas H, Juroske DM, Kalyankrishna S, Cody DD, Price RE, Xu XC, Narayanan R, Weigel NL, Kurie JM", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" } ], "reference": [ { "type": "PubMed", "id": "15657432", "url": "https://glygen.org/publication/PubMed/15657432" } ] }, { "title": "The peptidyl-prolyl isomerase Pin1 regulates phospho-Ser77 retinoic acid receptor alpha stability.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Brondani V, Schefer Q, Hamy F, Klimkait T", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" } ], "reference": [ { "type": "PubMed", "id": "15670742", "url": "https://glygen.org/publication/PubMed/15670742" } ] }, { "title": "Requirement of the coiled-coil domain of PML-RARalpha oncoprotein for localization, sumoylation, and inhibition of monocyte differentiation.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Kim YE, Kim DY, Lee JM, Kim ST, Han TH, Ahn JH", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "15809060", "url": "https://glygen.org/publication/PubMed/15809060" } ] }, { "title": "A ligand-activated nuclear localization signal in cellular retinoic acid binding protein-II.", "journal": "Molecular cell", "date": "2005", "authors": "Sessler RJ, Noy N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5362517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5362517" } ], "reference": [ { "type": "PubMed", "id": "15866176", "url": "https://glygen.org/publication/PubMed/15866176" } ] }, { "title": "Expression of HOXB2, a retinoic acid signaling target in pancreatic cancer and pancreatic intraepithelial neoplasia.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2005", "authors": "Segara D, Biankin AV, Kench JG, Langusch CC, Dawson AC, Skalicky DA, Gotley DC, Coleman MJ, Sutherland RL, Henshall SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "15867264", "url": "https://glygen.org/publication/PubMed/15867264" } ] }, { "title": "Dynamic regulation of pol II transcription by the mammalian Mediator complex.", "journal": "Trends in biochemical sciences", "date": "2005", "authors": "Malik S, Roeder RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-383280", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-383280" } ], "reference": [ { "type": "PubMed", "id": "15896744", "url": "https://glygen.org/publication/PubMed/15896744" } ] }, { "title": "SUMO-dependent compartmentalization in promyelocytic leukemia protein nuclear bodies prevents the access of LRH-1 to chromatin.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Chalkiadaki A, Talianidis I", "evidence": [ { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "15923626", "url": "https://glygen.org/publication/PubMed/15923626" } ] }, { "title": "Sumoylation of the estrogen receptor alpha hinge region regulates its transcriptional activity.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2005", "authors": "Sentis S, Le Romancer M, Bianchin C, Rostan MC, Corbo L", "evidence": [ { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "15961505", "url": "https://glygen.org/publication/PubMed/15961505" } ] }, { "title": "HoxB2 binds mutant SOD1 and is altered in transgenic model of ALS.", "journal": "Human molecular genetics", "date": "2005", "authors": "Zhai J, Lin H, Canete-Soler R, Schlaepfer WW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "16079151", "url": "https://glygen.org/publication/PubMed/16079151" } ] }, { "title": "The human tumor antigen PRAME is a dominant repressor of retinoic acid receptor signaling.", "journal": "Cell", "date": "2005", "authors": "Epping MT, Wang L, Edel MJ, Carlee L, Hernandez M, Bernards R", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "16179254", "url": "https://glygen.org/publication/PubMed/16179254" } ] }, { "title": "Cyclin H binding to the RARalpha activation function (AF)-2 domain directs phosphorylation of the AF-1 domain by cyclin-dependent kinase 7.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Bour G, Gaillard E, Bruck N, Lalevee S, Plassat JL, Busso D, Samama JP, Rochette-Egly C", "evidence": [ { "database": "iPTMnet", "id": "P10276-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276-1" } ], "reference": [ { "type": "PubMed", "id": "16275922", "url": "https://glygen.org/publication/PubMed/16275922" } ] }, { "title": "Akt phosphorylates and suppresses the transactivation of retinoic acid receptor alpha.", "journal": "The Biochemical journal", "date": "2006", "authors": "Srinivas H, Xia D, Moore NL, Uray IP, Kim H, Ma L, Weigel NL, Brown PH, Kurie JM", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" } ], "reference": [ { "type": "PubMed", "id": "16417524", "url": "https://glygen.org/publication/PubMed/16417524" } ] }, { "title": "MicroRNA fingerprints during human megakaryocytopoiesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Garzon R, Pichiorri F, Palumbo T, Iuliano R, Cimmino A, Aqeilan R, Volinia S, Bhatt D, Alder H, Marcucci G, Calin GA, Liu CG, Bloomfield CD, Andreeff M, Croce CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "16549775", "url": "https://glygen.org/publication/PubMed/16549775" } ] }, { "title": "Additional sex comb-like 1 (ASXL1), in cooperation with SRC-1, acts as a ligand-dependent coactivator for retinoic acid receptor.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Cho YS, Kim EJ, Park UH, Sin HS, Um SJ", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "16606617", "url": "https://glygen.org/publication/PubMed/16606617" } ] }, { "title": "Sensors and signals: a coactivator/corepressor/epigenetic code for integrating signal-dependent programs of transcriptional response.", "journal": "Genes & development", "date": "2006", "authors": "Rosenfeld MG, Lunyak VV, Glass CK", "evidence": [ { "database": "Reactome", "id": "R-HSA-383280", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-383280" } ], "reference": [ { "type": "PubMed", "id": "16751179", "url": "https://glygen.org/publication/PubMed/16751179" } ] }, { "title": "C/EBPbeta is required for 'emergency' granulopoiesis.", "journal": "Nature immunology", "date": "2006", "authors": "Hirai H, Zhang P, Dayaram T, Hetherington CJ, Mizuno S, Imanishi J, Akashi K, Tenen DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "16751774", "url": "https://glygen.org/publication/PubMed/16751774" } ] }, { "title": "Phosphorylation by PKA potentiates retinoic acid receptor alpha activity by means of increasing interaction with and phosphorylation by cyclin H/cdk7.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Gaillard E, Bruck N, Brelivet Y, Bour G, Lalevee S, Bauer A, Poch O, Moras D, Rochette-Egly C", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" } ], "reference": [ { "type": "PubMed", "id": "16769902", "url": "https://glygen.org/publication/PubMed/16769902" } ] }, { "title": "Negative modulation of RXRalpha transcriptional activity by small ubiquitin-related modifier (SUMO) modification and its reversal by SUMO-specific protease SUSP1.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Choi SJ, Chung SS, Rho EJ, Lee HW, Lee MH, Choi HS, Seol JH, Baek SH, Bang OS, Chung CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "16912044", "url": "https://glygen.org/publication/PubMed/16912044" } ] }, { "title": "PIAS3 induction of PRB sumoylation represses PRB transactivation by destabilizing its retention in the nucleus.", "journal": "Nucleic acids research", "date": "2006", "authors": "Man JH, Li HY, Zhang PJ, Zhou T, He K, Pan X, Liang B, Li AL, Zhao J, Gong WL, Jin BF, Xia Q, Yu M, Shen BF, Zhang XM", "evidence": [ { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "17020914", "url": "https://glygen.org/publication/PubMed/17020914" } ] }, { "title": "LEF-1 is crucial for neutrophil granulocytopoiesis and its expression is severely reduced in congenital neutropenia.", "journal": "Nature medicine", "date": "2006", "authors": "Skokowa J, Cario G, Uenalan M, Schambach A, Germeshausen M, Battmer K, Zeidler C, Lehmann U, Eder M, Baum C, Grosschedl R, Stanulla M, Scherr M, Welte K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "17063141", "url": "https://glygen.org/publication/PubMed/17063141" } ] }, { "title": "Coactivation of the N-terminal transactivation of mineralocorticoid receptor by Ubc9.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Yokota K, Shibata H, Kurihara I, Kobayashi S, Suda N, Murai-Takeda A, Saito I, Kitagawa H, Kato S, Saruta T, Itoh H", "evidence": [ { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "17105732", "url": "https://glygen.org/publication/PubMed/17105732" } ] }, { "title": "Noncoding RNA synthesis and loss of Polycomb group repression accompanies the colinear activation of the human HOXA cluster.", "journal": "RNA (New York, N.Y.)", "date": "2007", "authors": "Sessa L, Breiling A, Lavorgna G, Silvestri L, Casari G, Orlando V", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17185360", "url": "https://glygen.org/publication/PubMed/17185360" } ] }, { "title": "Parallel SUMOylation-dependent pathways mediate gene- and signal-specific transrepression by LXRs and PPARgamma.", "journal": "Molecular cell", "date": "2007", "authors": "Ghisletti S, Huang W, Ogawa S, Pascual G, Lin ME, Willson TM, Rosenfeld MG, Glass CK", "evidence": [ { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "17218271", "url": "https://glygen.org/publication/PubMed/17218271" } ] }, { "title": "Sumoylation and proteasomal activity determine the transactivation properties of the mineralocorticoid receptor.", "journal": "Molecular and cellular endocrinology", "date": "2007", "authors": "Tirard M, Almeida OF, Hutzler P, Melchior F, Michaelidis TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "17314004", "url": "https://glygen.org/publication/PubMed/17314004" } ] }, { "title": "Overlapping roles of the methylated DNA-binding protein MBD1 and polycomb group proteins in transcriptional repression of HOXA genes and heterochromatin foci formation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Sakamoto Y, Watanabe S, Ichimura T, Kawasuji M, Koseki H, Baba H, Nakao M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17428788", "url": "https://glygen.org/publication/PubMed/17428788" } ] }, { "title": "CaMKII regulates retinoic acid receptor transcriptional activity and the differentiation of myeloid leukemia cells.", "journal": "The Journal of clinical investigation", "date": "2007", "authors": "Si J, Mueller L, Collins SJ", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" } ], "reference": [ { "type": "PubMed", "id": "17431504", "url": "https://glygen.org/publication/PubMed/17431504" } ] }, { "title": "RIF-1, a novel nuclear receptor corepressor that associates with the nuclear matrix.", "journal": "J. Cell. Biochem.", "date": "2007", "authors": "Li HJ, Haque ZK, Chen A, Mendelsohn M", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "17455211", "url": "https://glygen.org/publication/PubMed/17455211" } ] }, { "title": "PML-retinoic acid receptor alpha inhibits PML IV enhancement of PU.1-induced C/EBPepsilon expression in myeloid differentiation.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Yoshida H, Ichikawa H, Tagata Y, Katsumoto T, Ohnishi K, Akao Y, Naoe T, Pandolfi PP, Kitabayashi I", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "17562868", "url": "https://glygen.org/publication/PubMed/17562868" } ] }, { "title": "HOX4 genes encode transcription factors with potential auto- and cross-regulatory capacities.", "journal": "The EMBO journal", "date": "1991", "authors": "Zappavigna V, Renucci A, Izpisua-Belmonte JC, Urier G, Peschle C, Duboule D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "1756725", "url": "https://glygen.org/publication/PubMed/1756725" } ] }, { "title": "DNA methylation regulates MicroRNA expression.", "journal": "Cancer biology & therapy", "date": "2007", "authors": "Han L, Witmer PD, Casey E, Valle D, Sukumar S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17660710", "url": "https://glygen.org/publication/PubMed/17660710" } ] }, { "title": "UTX and JMJD3 are histone H3K27 demethylases involved in HOX gene regulation and development.", "journal": "Nature", "date": "2007", "authors": "Agger K, Cloos PA, Christensen J, Pasini D, Rose S, Rappsilber J, Issaeva I, Canaani E, Salcini AE, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17713478", "url": "https://glygen.org/publication/PubMed/17713478" } ] }, { "title": "Phosphorylation-dependent antagonism of sumoylation derepresses progesterone receptor action in breast cancer cells.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2007", "authors": "Daniel AR, Faivre EJ, Lange CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "17717077", "url": "https://glygen.org/publication/PubMed/17717077" } ] }, { "title": "Demethylation of H3K27 regulates polycomb recruitment and H2A ubiquitination.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Lee MG, Villa R, Trojer P, Norman J, Yan KP, Reinberg D, Di Croce L, Shiekhattar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17761849", "url": "https://glygen.org/publication/PubMed/17761849" } ] }, { "title": "A histone H3 lysine 27 demethylase regulates animal posterior development.", "journal": "Nature", "date": "2007", "authors": "Lan F, Bayliss PE, Rinn JL, Whetstine JR, Wang JK, Chen S, Iwase S, Alpatov R, Issaeva I, Canaani E, Roberts TM, Chang HY, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17851529", "url": "https://glygen.org/publication/PubMed/17851529" } ] }, { "title": "Retinoic acid in development: towards an integrated view.", "journal": "Nature reviews. Genetics", "date": "2008", "authors": "Niederreither K, Dolle P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5362517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5362517" } ], "reference": [ { "type": "PubMed", "id": "18542081", "url": "https://glygen.org/publication/PubMed/18542081" } ] }, { "title": "C/EBPalpha and C/EBPvarepsilon induce the monocytic differentiation of myelomonocytic cells with the MLL-chimeric fusion gene.", "journal": "Oncogene", "date": "2008", "authors": "Matsushita H, Nakajima H, Nakamura Y, Tsukamoto H, Tanaka Y, Jin G, Yabe M, Asai S, Ono R, Nosaka T, Sugita K, Morimoto A, Hayashi Y, Hotta T, Ando K, Miyachi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "18776924", "url": "https://glygen.org/publication/PubMed/18776924" } ] }, { "title": "MicroRNAs in the Hox network: an apparent link to posterior prevalence.", "journal": "Nature reviews. Genetics", "date": "2008", "authors": "Yekta S, Tabin CJ, Bartel DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "18781158", "url": "https://glygen.org/publication/PubMed/18781158" } ] }, { "title": "SUMOylation of RORalpha potentiates transcriptional activation function.", "journal": "Biochemical and biophysical research communications", "date": "2009", "authors": "Hwang EJ, Lee JM, Jeong J, Park JH, Yang Y, Lim JS, Kim JH, Baek SH, Kim KI", "evidence": [ { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "19041634", "url": "https://glygen.org/publication/PubMed/19041634" } ] }, { "title": "A coordinated phosphorylation cascade initiated by p38MAPK/MSK1 directs RARalpha to target promoters.", "journal": "The EMBO journal", "date": "2009", "authors": "Bruck N, Vitoux D, Ferry C, Duong V, Bauer A, de The H, Rochette-Egly C", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" } ], "reference": [ { "type": "PubMed", "id": "19078967", "url": "https://glygen.org/publication/PubMed/19078967" } ] }, { "title": "The truncated Hoxa1 protein interacts with Hoxa1 and Pbx1 in stem cells.", "journal": "Journal of cellular biochemistry", "date": "2009", "authors": "Fernandez CC, Gudas LJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19115252", "url": "https://glygen.org/publication/PubMed/19115252" } ] }, { "title": "Up-regulation of the alpha-secretase ADAM10 by retinoic acid receptors and acitretin.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2009", "authors": "Tippmann F, Hundt J, Schneider A, Endres K, Fahrenholz F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5362517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5362517" } ], "reference": [ { "type": "PubMed", "id": "19144697", "url": "https://glygen.org/publication/PubMed/19144697" } ] }, { "title": "Mechanisms underlying the control of progesterone receptor transcriptional activity by SUMOylation.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Abdel-Hafiz H, Dudevoir ML, Horwitz KB", "evidence": [ { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "19211567", "url": "https://glygen.org/publication/PubMed/19211567" } ] }, { "title": "Transcriptional inhibiton of Hoxd4 expression by miRNA-10a in human breast cancer cells.", "journal": "BMC molecular biology", "date": "2009", "authors": "Tan Y, Zhang B, Wu T, Skogerbo G, Zhu X, Guo X, He S, Chen R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19232136", "url": "https://glygen.org/publication/PubMed/19232136" } ] }, { "title": "GlcNAcylation of a histone methyltransferase in retinoic-acid-induced granulopoiesis.", "journal": "Nature", "date": "2009", "authors": "Fujiki Ryoji, Chikanishi Toshihiro, Hashiba Waka, Ito Hiroaki, Takada Ichiro, Roeder Robert G, Kitagawa Hirochika, Kato Shigeaki", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "19377461", "url": "https://glygen.org/publication/PubMed/19377461" } ] }, { "title": "ZNF536, a novel zinc finger protein specifically expressed in the brain, negatively regulates neuron differentiation by repressing retinoic acid-induced gene transcription.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Qin Z, Ren F, Xu X, Ren Y, Li H, Wang Y, Zhai Y, Chang Z", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "19398580", "url": "https://glygen.org/publication/PubMed/19398580" } ] }, { "title": "Transcriptional Suppression by Transient Recruitment of ARIP4 to Sumoylated nuclear receptor Ad4BP/SF-1.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Ogawa H, Komatsu T, Hiraoka Y, Morohashi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "19692572", "url": "https://glygen.org/publication/PubMed/19692572" } ] }, { "title": "Retinoic acid receptor antagonists inhibit miR-10a expression and block metastatic behavior of pancreatic cancer.", "journal": "Gastroenterology", "date": "2009", "authors": "Weiss FU, Marques IJ, Woltering JM, Vlecken DH, Aghdassi A, Partecke LI, Heidecke CD, Lerch MM, Bagowski CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19747919", "url": "https://glygen.org/publication/PubMed/19747919" } ] }, { "title": "Sequential activation of HOX2 homeobox genes by retinoic acid in human embryonal carcinoma cells.", "journal": "Nature", "date": "1990", "authors": "Simeone A, Acampora D, Arcioni L, Andrews PW, Boncinelli E, Mavilio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "1975088", "url": "https://glygen.org/publication/PubMed/1975088" } ] }, { "title": "Hypoxia-inducible mir-210 regulates normoxic gene expression involved in tumor initiation.", "journal": "Molecular cell", "date": "2009", "authors": "Huang X, Ding L, Bennewith KL, Tong RT, Welford SM, Ang KK, Story M, Le QT, Giaccia AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19782034", "url": "https://glygen.org/publication/PubMed/19782034" } ] }, { "title": "Small ubiquitin-like modifier-2 modification of retinoic acid receptor-alpha regulates its subcellular localization and transcriptional activity.", "journal": "Endocrinology", "date": "2009", "authors": "Zhu L, Santos NC, Kim KH", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "19850744", "url": "https://glygen.org/publication/PubMed/19850744" } ] }, { "title": "Epigenetic silencing of the RASSF1A tumor suppressor gene through HOXB3-mediated induction of DNMT3B expression.", "journal": "Molecular cell", "date": "2009", "authors": "Palakurthy RK, Wajapeyee N, Santra MK, Gazin C, Lin L, Gobeil S, Green MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19854132", "url": "https://glygen.org/publication/PubMed/19854132" } ] }, { "title": "The bile acid receptor FXR is a modulator of intestinal innate immunity.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2009", "authors": "Vavassori P, Mencarelli A, Renga B, Distrutti E, Fiorucci S", "evidence": [ { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "19864602", "url": "https://glygen.org/publication/PubMed/19864602" } ] }, { "title": "SUMOylation of human peroxisome proliferator-activated receptor alpha inhibits its trans-activity through the recruitment of the nuclear corepressor NCoR.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Pourcet B, Pineda-Torra I, Derudas B, Staels B, Glineur C", "evidence": [ { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "19955185", "url": "https://glygen.org/publication/PubMed/19955185" } ] }, { "title": "Retinoic acid activation of peroxisome proliferation-activated receptor delta represses obesity and insulin resistance.", "journal": "Nutrition reviews", "date": "2010", "authors": "Wolf G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5362517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5362517" } ], "reference": [ { "type": "PubMed", "id": "20042001", "url": "https://glygen.org/publication/PubMed/20042001" } ] }, { "title": "The transforming acidic coiled coil (TACC1) protein modulates the transcriptional activity of the nuclear receptors TR and RAR.", "journal": "BMC Mol. Biol.", "date": "2010", "authors": "Guyot R, Vincent S, Bertin J, Samarut J, Ravel-Chapuis P", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "20078863", "url": "https://glygen.org/publication/PubMed/20078863" } ] }, { "title": "Regulation of HOXA2 gene expression by the ATP-dependent chromatin remodeling enzyme CHD8.", "journal": "FEBS letters", "date": "2010", "authors": "Yates JA, Menon T, Thompson BA, Bochar DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "20085832", "url": "https://glygen.org/publication/PubMed/20085832" } ] }, { "title": "GPS2-dependent corepressor/SUMO pathways govern anti-inflammatory actions of LRH-1 and LXRbeta in the hepatic acute phase response.", "journal": "Genes & development", "date": "2010", "authors": "Venteclef N, Jakobsson T, Ehrlund A, Damdimopoulos A, Mikkonen L, Ellis E, Nilsson LM, Parini P, Janne OA, Gustafsson JA, Steffensen KR, Treuter E", "evidence": [ { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "20159957", "url": "https://glygen.org/publication/PubMed/20159957" } ] }, { "title": "Activity of retinoic acid receptor-alpha is directly regulated at its protein kinase A sites in response to follicle-stimulating hormone signaling.", "journal": "Endocrinology", "date": "2010", "authors": "Santos NC, Kim KH", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "Reactome", "id": "R-HSA-5362517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5362517" }, { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" } ], "reference": [ { "type": "PubMed", "id": "20215566", "url": "https://glygen.org/publication/PubMed/20215566" } ] }, { "title": "A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor.", "journal": "Nature structural & molecular biology", "date": "2010", "authors": "le Maire A, Teyssier C, Erb C, Grimaldi M, Alvarez S, de Lera AR, Balaguer P, Gronemeyer H, Royer CA, Germain P, Bourguet W", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "20543827", "url": "https://glygen.org/publication/PubMed/20543827" } ] }, { "title": "C/EBPepsilon participates in all-trans retinoic acid induction of PI3Kgamma in U937 cells via an intronic matrix attachment region sequence.", "journal": "Molecular biology reports", "date": "2010", "authors": "Cai R, Cai X, Chen B, Xu W, Lu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "20661648", "url": "https://glygen.org/publication/PubMed/20661648" } ] }, { "title": "Pregnane X receptor is SUMOylated to repress the inflammatory response.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2010", "authors": "Hu G, Xu C, Staudinger JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "20719936", "url": "https://glygen.org/publication/PubMed/20719936" } ] }, { "title": "Coactivation of SF-1-mediated transcription of steroidogenic enzymes by Ubc9 and PIAS1.", "journal": "Endocrinology", "date": "2011", "authors": "Suda N, Shibata H, Kurihara I, Ikeda Y, Kobayashi S, Yokota K, Murai-Takeda A, Nakagawa K, Oya M, Murai M, Rainey WE, Saruta T, Itoh H", "evidence": [ { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "21467194", "url": "https://glygen.org/publication/PubMed/21467194" } ] }, { "title": "Protein disulfide isomerase blocks CEBPA translation and is up-regulated during the unfolded protein response in AML.", "journal": "Blood", "date": "2011", "authors": "Haefliger S, Klebig C, Schaubitzer K, Schardt J, Timchenko N, Mueller BU, Pabst T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "21471526", "url": "https://glygen.org/publication/PubMed/21471526" } ] }, { "title": "The human fatty acid-binding protein family: evolutionary divergences and functions.", "journal": "Human genomics", "date": "2011", "authors": "Smathers RL, Petersen DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5362517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5362517" } ], "reference": [ { "type": "PubMed", "id": "21504868", "url": "https://glygen.org/publication/PubMed/21504868" } ] }, { "title": "Characterization of a functional promoter for the human retinoic acid receptor-alpha (hRAR-alpha).", "journal": "Nucleic Acids Res.", "date": "1990", "authors": "Brand N J, Petkovich M, Chambon P", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "2175878", "url": "https://glygen.org/publication/PubMed/2175878" } ] }, { "title": "The granulocyte-associated transcription factor Kruppel-like factor 5 is silenced by hypermethylation in acute myeloid leukemia.", "journal": "Leukemia research", "date": "2012", "authors": "Diakiw SM, Kok CH, To LB, Lewis ID, Brown AL, D'Andrea RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "21993314", "url": "https://glygen.org/publication/PubMed/21993314" } ] }, { "title": "Nuclear translocation of cellular retinoic acid-binding protein II is regulated by retinoic acid-controlled SUMOylation.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Majumdar A, Petrescu AD, Xiong Y, Noy N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5362517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5362517" } ], "reference": [ { "type": "PubMed", "id": "21998312", "url": "https://glygen.org/publication/PubMed/21998312" } ] }, { "title": "Retinoid-regulated FGF8f secretion by osteoblasts bypasses retinoid stimuli to mediate granulocytic differentiation of myeloid leukemia cells.", "journal": "Molecular cancer therapeutics", "date": "2012-02", "authors": "Chaudhry Parvesh, Yang Xiaochun, Wagner Michael, Jong Ambrose, Wu Lingtao", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" } ], "reference": [ { "type": "PubMed", "id": "22135230", "url": "https://glygen.org/publication/PubMed/22135230" } ] }, { "title": "Familial focal segmental glomerulosclerosis (FSGS)-linked alpha-actinin 4 (ACTN4) protein mutants lose ability to activate transcription by nuclear hormone receptors.", "journal": "J. Biol. Chem.", "date": "2012", "authors": "Khurana S, Chakraborty S, Lam M, Liu Y, Su YT, Zhao X, Saleem MA, Mathieson PW, Bruggeman LA, Kao HY", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "22351778", "url": "https://glygen.org/publication/PubMed/22351778" } ] }, { "title": "Overexpression of wild-type or mutants forms of CEBPA alter normal human hematopoiesis.", "journal": "Leukemia", "date": "2012", "authors": "Quintana-Bustamante O, Lan-Lan Smith S, Griessinger E, Reyal Y, Vargaftig J, Lister TA, Fitzgibbon J, Bonnet D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "22371011", "url": "https://glygen.org/publication/PubMed/22371011" } ] }, { "title": "C/EBPalpha and DEK coordinately regulate myeloid differentiation.", "journal": "Blood", "date": "2012", "authors": "Koleva RI, Ficarro SB, Radomska HS, Carrasco-Alfonso MJ, Alberta JA, Webber JT, Luckey CJ, Marcucci G, Tenen DG, Marto JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "22474248", "url": "https://glygen.org/publication/PubMed/22474248" } ] }, { "title": "Hydroxylation of 5-methylcytosine by TET2 maintains the active state of the mammalian HOXA cluster.", "journal": "Nature communications", "date": "2012", "authors": "Bocker MT, Tuorto F, Raddatz G, Musch T, Yang FC, Xu M, Lyko F, Breiling A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "22569366", "url": "https://glygen.org/publication/PubMed/22569366" } ] }, { "title": "miR-7 and miR-218 epigenetically control tumor suppressor genes RASSF1A and Claudin-6 by targeting HoxB3 in breast cancer.", "journal": "Biochemical and biophysical research communications", "date": "2012", "authors": "Li Q, Zhu F, Chen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "22705304", "url": "https://glygen.org/publication/PubMed/22705304" } ] }, { "title": "Induction of carnitine palmitoyl transferase 1 and fatty acid oxidation by retinoic acid in HepG2 cells.", "journal": "The international journal of biochemistry & cell biology", "date": "2012", "authors": "Amengual J, Petrov P, Bonet ML, Ribot J, Palou A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5362517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5362517" } ], "reference": [ { "type": "PubMed", "id": "22871568", "url": "https://glygen.org/publication/PubMed/22871568" } ] }, { "title": "Functional dissection of HOXD cluster genes in regulation of neuroblastoma cell proliferation and differentiation.", "journal": "PloS one", "date": "2012", "authors": "Zha Y, Ding E, Yang L, Mao L, Wang X, McCarthy BA, Huang S, Ding HF", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "22879880", "url": "https://glygen.org/publication/PubMed/22879880" } ] }, { "title": "Thyroid hormone receptor isoform-specific modification by small ubiquitin-like modifier (SUMO) modulates thyroid hormone-dependent gene regulation.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Liu YY, Kogai T, Schultz JJ, Mody K, Brent GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "22930759", "url": "https://glygen.org/publication/PubMed/22930759" } ] }, { "title": "Interactions among HCLS1, HAX1 and LEF-1 proteins are essential for G-CSF-triggered granulopoiesis.", "journal": "Nature medicine", "date": "2012", "authors": "Skokowa J, Klimiankou M, Klimenkova O, Lan D, Gupta K, Hussein K, Carrizosa E, Kusnetsova I, Li Z, Sustmann C, Ganser A, Zeidler C, Kreipe HH, Burkhardt J, Grosschedl R, Welte K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "23001182", "url": "https://glygen.org/publication/PubMed/23001182" } ] }, { "title": "HoxB3 promotes prostate cancer cell progression by transactivating CDCA3.", "journal": "Cancer letters", "date": "2013", "authors": "Chen J, Zhu S, Jiang N, Shang Z, Quan C, Niu Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "23219899", "url": "https://glygen.org/publication/PubMed/23219899" } ] }, { "title": "Let-7c inhibits NSCLC cell proliferation by targeting HOXA1.", "journal": "Asian Pacific journal of cancer prevention : APJCP", "date": "2013", "authors": "Zhan M, Qu Q, Wang G, Liu YZ, Tan SL, Lou XY, Yu J, Zhou HH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "23534758", "url": "https://glygen.org/publication/PubMed/23534758" } ] }, { "title": "SUMOylation of the farnesoid X receptor (FXR) regulates the expression of FXR target genes.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Balasubramaniyan N, Luo Y, Sun AQ, Suchy FJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "23546875", "url": "https://glygen.org/publication/PubMed/23546875" } ] }, { "title": "Identification of the transcription factor HOXB4 as a novel target of miR-23a.", "journal": "Genes, chromosomes & cancer", "date": "2013", "authors": "Koller K, Das S, Leuschner I, Korbelius M, Hoefler G, Guertl B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "23630040", "url": "https://glygen.org/publication/PubMed/23630040" } ] }, { "title": "The one-two punch: Retinoic acid suppresses obesity both by promoting energy expenditure and by inhibiting adipogenesis.", "journal": "Adipocyte", "date": "2013", "authors": "Noy N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5362517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5362517" } ], "reference": [ { "type": "PubMed", "id": "23991366", "url": "https://glygen.org/publication/PubMed/23991366" } ] }, { "title": "Hox in motion: tracking HoxA cluster conformation during differentiation.", "journal": "Nucleic acids research", "date": "2014", "authors": "Rousseau M, Crutchley JL, Miura H, Suderman M, Blanchette M, Dostie J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "24174538", "url": "https://glygen.org/publication/PubMed/24174538" } ] }, { "title": "MicroRNA-99 family members suppress Homeobox A1 expression in epithelial cells.", "journal": "PloS one", "date": "2013", "authors": "Chen D, Chen Z, Jin Y, Dragas D, Zhang L, Adjei BS, Wang A, Dai Y, Zhou X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "24312487", "url": "https://glygen.org/publication/PubMed/24312487" } ] }, { "title": "Enhancement of differentiation induction and upregulation of CCAAT/enhancer-binding proteins and PU.1 in NB4 cells treated with combination of ATRA and valproic acid.", "journal": "International journal of oncology", "date": "2014", "authors": "Iriyama N, Yuan B, Yoshino Y, Hatta Y, Horikoshi A, Aizawa S, Takei M, Takeuchi J, Takagi N, Toyoda H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "24379003", "url": "https://glygen.org/publication/PubMed/24379003" } ] }, { "title": "CEBPA-dependent HK3 and KLF5 expression in primary AML and during AML differentiation.", "journal": "Scientific reports", "date": "2014", "authors": "Federzoni EA, Humbert M, Torbett BE, Behre G, Fey MF, Tschan MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "24584857", "url": "https://glygen.org/publication/PubMed/24584857" } ] }, { "title": "miR-100 induces epithelial-mesenchymal transition but suppresses tumorigenesis, migration and invasion.", "journal": "PLoS genetics", "date": "2014", "authors": "Chen D, Sun Y, Yuan Y, Han Z, Zhang P, Zhang J, You MJ, Teruya-Feldstein J, Wang M, Gupta S, Hung MC, Liang H, Ma L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "24586203", "url": "https://glygen.org/publication/PubMed/24586203" } ] }, { "title": "KDM6 demethylase independent loss of histone H3 lysine 27 trimethylation during early embryonic development.", "journal": "PLoS genetics", "date": "2014", "authors": "Shpargel KB, Starmer J, Yee D, Pohlers M, Magnuson T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "25101834", "url": "https://glygen.org/publication/PubMed/25101834" } ] }, { "title": "Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Impens F, Radoshevich L, Cossart P, Ribet D", "evidence": [ { "database": "Reactome", "id": "R-HSA-4090294", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294" } ], "reference": [ { "type": "PubMed", "id": "25114211", "url": "https://glygen.org/publication/PubMed/25114211" } ] }, { "title": "CTCF controls HOXA cluster silencing and mediates PRC2-repressive higher-order chromatin structure in NT2/D1 cells.", "journal": "Molecular and cellular biology", "date": "2014", "authors": "Xu M, Zhao GN, Lv X, Liu G, Wang LY, Hao DL, Wang J, Liu DP, Liang CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "25135475", "url": "https://glygen.org/publication/PubMed/25135475" } ] }, { "title": "E1A-dependent trans-activation of the human MYC promoter is mediated by the E2F factor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Hiebert SW, Lipp M, Nevins JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "2524830", "url": "https://glygen.org/publication/PubMed/2524830" } ] }, { "title": "Differential expression of human HOX-2 genes along the anterior-posterior axis in embryonic central nervous system.", "journal": "Differentiation; research in biological diversity", "date": "1989", "authors": "Giampaolo A, Acampora D, Zappavigna V, Pannese M, D'Esposito M, Care A, Faiella A, Stornaiuolo A, Russo G, Simeone A, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "2570724", "url": "https://glygen.org/publication/PubMed/2570724" } ] }, { "title": "miR-191 promotes tumorigenesis of human colorectal cancer through targeting C/EBPbeta.", "journal": "Oncotarget", "date": "2015", "authors": "Zhang XF, Li KK, Gao L, Li SZ, Chen K, Zhang JB, Wang D, Tu RF, Zhang JX, Tao KX, Wang G, Zhang XD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "25784653", "url": "https://glygen.org/publication/PubMed/25784653" } ] }, { "title": "Structure, function and evolution of topologically associating domains (TADs) at HOX loci.", "journal": "FEBS letters", "date": "2015", "authors": "Lonfat N, Duboule D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "25913784", "url": "https://glygen.org/publication/PubMed/25913784" } ] }, { "title": "Evaluating frequency of PML-RARA mutations and conferring resistance to arsenic trioxide-based therapy in relapsed acute promyelocytic leukemia patients.", "journal": "Annals of hematology", "date": "2015", "authors": "Lou Y, Ma Y, Sun J, Ye X, Pan H, Wang Y, Qian W, Meng H, Mai W, He J, Tong H, Jin J", "evidence": [ { "database": "Entrez", "id": "5914", "url": "https://www.ncbi.nlm.nih.gov/gene/5914" } ], "reference": [ { "type": "PubMed", "id": "26294332", "url": "https://glygen.org/publication/PubMed/26294332" } ] }, { "title": "Retinoid X receptor activation reverses age-related deficiencies in myelin debris phagocytosis and remyelination.", "journal": "Brain", "date": "2015", "authors": "Natrajan Muktha S, de la Fuente Alerie G, Crawford Abbe H, Linehan Eimear, Nu\u00f1ez Vanessa, Johnson Kory R, Wu Tianxia, Fitzgerald Denise C, Ricote Mercedes, Bielekova Bibiana, Franklin Robin J M", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "26463675", "url": "https://glygen.org/publication/PubMed/26463675" } ] }, { "title": "Nuclear factor E2F mediates basic transcription and trans-activation by E1a of the human MYC promoter.", "journal": "Genes & development", "date": "1989", "authors": "Thalmeier K, Synovzik H, Mertz R, Winnacker EL, Lipp M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "2721961", "url": "https://glygen.org/publication/PubMed/2721961" } ] }, { "title": "MicroRNA-10a is crucial for endothelial response to different flow patterns via interaction of retinoid acid receptors and histone deacetylases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2017", "authors": "Lee DY, Lin TE, Lee CI, Zhou J, Huang YH, Lee PL, Shih YT, Chien S, Chiu JJ", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "28167758", "url": "https://glygen.org/publication/PubMed/28167758" } ] }, { "title": "A human retinoic acid receptor which belongs to the family of nuclear receptors.", "journal": "Nature", "date": "1987", "authors": "Petkovich M, Brand N J, Krust A, Chambon P", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "2825025", "url": "https://glygen.org/publication/PubMed/2825025" } ] }, { "title": "Identification of a receptor for the morphogen retinoic acid.", "journal": "Nature", "date": "1987", "authors": "Giguere V, Ong E S, Segui P, Evans R M", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "2825036", "url": "https://glygen.org/publication/PubMed/2825036" } ] }, { "title": "C/EBPalpha overrides epigenetic reprogramming by oncogenic transcription factors in acute myeloid leukemia.", "journal": "Blood advances", "date": "2018", "authors": "Loke J, Chin PS, Keane P, Pickin A, Assi SA, Ptasinska A, Imperato MR, Cockerill PN, Bonifer C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "29431622", "url": "https://glygen.org/publication/PubMed/29431622" } ] }, { "title": "Nuclear hormone receptors: Ancient 9aaTAD and evolutionally gained NCoA activation pathways.", "journal": "J. Steroid Biochem. Mol. Biol.", "date": "2019", "authors": "Piskacek Martin, Havelka Marek, Jendruchova Kristina, Knight Andrea", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "30468856", "url": "https://glygen.org/publication/PubMed/30468856" } ] }, { "title": "Inhibition of retinoic acid receptor alpha phosphorylation represses the progression of triple-negative breast cancer via transactivating miR-3074-5p to target DHRS3.", "journal": "Journal of experimental & clinical cancer research : CR", "date": "2021", "authors": "Lou S, Gao H, Hong H, Zhu Z, Zhao H", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" } ], "reference": [ { "type": "PubMed", "id": "33902658", "url": "https://glygen.org/publication/PubMed/33902658" } ] }, { "title": "Hyperthermia promotes degradation of the acute promyelocytic leukemia driver oncoprotein ZBTB16/RAR\u03b1.", "journal": "Acta pharmacologica Sinica", "date": "2022-10-10", "authors": "Wang Qian-Qian, Hussain Liaqat, Yu Pei-Han, Yang Chang, Zhu Chen-Ying, Ma Ya-Fang, Wang Si-Chun, Yang Tao, Kang Yuan-Yuan, Yu Wen-Juan, Maimaitiyiming Yasen, Naranmandura Hua", "evidence": [ { "database": "RefSeq", "id": "NP_000955", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000955" } ], "reference": [ { "type": "PubMed", "id": "36216898", "url": "https://glygen.org/publication/PubMed/36216898" } ] }, { "title": "Multi-omics and machine learning reveal context-specific gene regulatory activities of PML::RARA in acute promyelocytic leukemia.", "journal": "Nature communications", "date": "2023-02-09", "authors": "Villiers William, Kelly Audrey, He Xiaohan, Kaufman-Cook James, Elbasir Abdurrahman, Bensmail Halima, Lavender Paul, Dillon Richard, Mifsud Borb\u00e1la, Osborne Cameron S", "evidence": [ { "database": "RefSeq", "id": "NP_000955", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_000955" } ], "reference": [ { "type": "PubMed", "id": "36759620", "url": "https://glygen.org/publication/PubMed/36759620" } ] }, { "title": "Retinoic acid induces three newly cloned HOXA1 transcripts in MCF7 breast cancer cells.", "journal": "Biochemical and biophysical research communications", "date": "1995", "authors": "Chariot A, Moreau L, Senterre G, Sobel ME, Castronovo V", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7488013", "url": "https://glygen.org/publication/PubMed/7488013" } ] }, { "title": "Up-regulation of HOXC6, HOXD1, and HOXD8 homeobox gene expression in human neuroblastoma cells following chemical induction of differentiation.", "journal": "Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine", "date": "1996", "authors": "Manohar CF, Salwen HR, Furtado MR, Cohn SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7501971", "url": "https://glygen.org/publication/PubMed/7501971" } ] }, { "title": "Crystal structures of cellular retinoic acid binding proteins I and II in complex with all-trans-retinoic acid and a synthetic retinoid.", "journal": "Structure (London, England : 1993)", "date": "1994", "authors": "Kleywegt GJ, Bergfors T, Senn H, Le Motte P, Gsell B, Shudo K, Jones TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5362517", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5362517" } ], "reference": [ { "type": "PubMed", "id": "7704533", "url": "https://glygen.org/publication/PubMed/7704533" } ] }, { "title": "A retinoic acid-triggered cascade of HOXB1 gene activation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Ogura T, Evans RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7831296", "url": "https://glygen.org/publication/PubMed/7831296" } ] }, { "title": "Autoregulation of the human C/EBP alpha gene by stimulation of upstream stimulatory factor binding.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Timchenko N, Wilson DR, Taylor LR, Abdelsayed S, Wilde M, Sawadogo M, Darlington GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "7862113", "url": "https://glygen.org/publication/PubMed/7862113" } ] }, { "title": "The 87-kD A gamma-globin enhancer-binding protein is a product of the HOXB2(HOX2H) locus.", "journal": "Blood", "date": "1994", "authors": "Sengupta PK, Lavelle DE, DeSimone J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7906964", "url": "https://glygen.org/publication/PubMed/7906964" } ] }, { "title": "Regulation of the human HOXD4 gene by retinoids.", "journal": "Mechanisms of development", "date": "1993", "authors": "Moroni MC, Vigano MA, Mavilio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7908827", "url": "https://glygen.org/publication/PubMed/7908827" } ] }, { "title": "PLZF-RAR alpha fusion proteins generated from the variant t(11;17)(q23;q21) translocation in acute promyelocytic leukemia inhibit ligand-dependent transactivation of wild-type retinoic acid receptors.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1994", "authors": "Chen Z, Guidez F, Rousselot P, Agadir A, Chen SJ, Wang ZY, Degos L, Zelent A, Waxman S, Chomienne C", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "8302850", "url": "https://glygen.org/publication/PubMed/8302850" } ] }, { "title": "The t(5;17) variant of acute promyelocytic leukemia expresses a nucleophosmin-retinoic acid receptor fusion.", "journal": "Blood", "date": "1996", "authors": "Redner R L, Rush E A, Faas S, Rudert W A, Corey S J", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "8562957", "url": "https://glygen.org/publication/PubMed/8562957" } ] }, { "title": "In vitro and transgenic analysis of a human HOXD4 retinoid-responsive enhancer.", "journal": "Development (Cambridge, England)", "date": "1996", "authors": "Morrison A, Moroni MC, Ariza-McNaughton L, Krumlauf R, Mavilio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "8674428", "url": "https://glygen.org/publication/PubMed/8674428" } ] }, { "title": "PU.1 (Spi-1) and C/EBP alpha regulate the granulocyte colony-stimulating factor receptor promoter in myeloid cells.", "journal": "Blood", "date": "1996", "authors": "Smith LT, Hohaus S, Gonzalez DA, Dziennis SE, Tenen DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "8695841", "url": "https://glygen.org/publication/PubMed/8695841" } ] }, { "title": "Functional interaction between a RARE and an AP-2 binding site in the regulation of the human HOX A4 gene promoter.", "journal": "Nucleic acids research", "date": "1996", "authors": "Doerksen LF, Bhattacharya A, Kannan P, Pratt D, Tainsky MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "8759021", "url": "https://glygen.org/publication/PubMed/8759021" } ] }, { "title": "CCAAT/enhancer-binding protein alpha (C/EBP alpha) inhibits cell proliferation through the p21 (WAF-1/CIP-1/SDI-1) protein.", "journal": "Genes & development", "date": "1996", "authors": "Timchenko NA, Wilde M, Nakanishi M, Smith JR, Darlington GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "8846917", "url": "https://glygen.org/publication/PubMed/8846917" } ] }, { "title": "CCAAT/enhancer binding protein epsilon is preferentially up-regulated during granulocytic differentiation and its functional versatility is determined by alternative use of promoters and differential splicing.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Yamanaka R, Kim GD, Radomska HS, Lekstrom-Himes J, Smith LT, Antonson P, Tenen DG, Xanthopoulos KG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9616222", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222" } ], "reference": [ { "type": "PubMed", "id": "9177240", "url": "https://glygen.org/publication/PubMed/9177240" } ] }, { "title": "Functional dissection of a transcriptionally active, target-specific Hox-Pbx complex.", "journal": "The EMBO journal", "date": "1997", "authors": "Di Rocco G, Mavilio F, Zappavigna V", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "9218805", "url": "https://glygen.org/publication/PubMed/9218805" } ] }, { "title": "Stimulation of RAR alpha activation function AF-1 through binding to the general transcription factor TFIIH and phosphorylation by CDK7.", "journal": "Cell", "date": "1997", "authors": "Rochette-Egly C, Adam S, Rossignol M, Egly JM, Chambon P", "evidence": [ { "database": "iPTMnet", "id": "P10276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10276" } ], "reference": [ { "type": "PubMed", "id": "9230306", "url": "https://glygen.org/publication/PubMed/9230306" } ] }, { "title": "Nuclear receptor coactivator ACTR is a novel histone acetyltransferase and forms a multimeric activation complex with P/CAF and CBP/p300.", "journal": "Cell", "date": "1997-08-08", "authors": "Chen H, Lin R J, Schiltz R L, Chakravarti D, Nash A, Nagy L, Privalsky M L, Nakatani Y, Evans R M", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "reference": [ { "type": "PubMed", "id": "9267036", "url": "https://glygen.org/publication/PubMed/9267036" } ] }, { "title": "HOXD4 and regulation of the group 4 paralog genes.", "journal": "Development (Cambridge, England)", "date": "1997", "authors": "Morrison A, Ariza-McNaughton L, Gould A, Featherstone M, Krumlauf R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "9272954", "url": "https://glygen.org/publication/PubMed/9272954" } ] }, { "title": "The novel homeoprotein Prep1 modulates Pbx-Hox protein cooperativity.", "journal": "The EMBO journal", "date": "1998", "authors": "Berthelsen J, Zappavigna V, Ferretti E, Mavilio F, Blasi F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "9482740", "url": "https://glygen.org/publication/PubMed/9482740" } ] }, { "title": "The TRAP220 component of a thyroid hormone receptor- associated protein (TRAP) coactivator complex interacts directly with nuclear receptors in a ligand-dependent fashion.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Yuan CX, Ito M, Fondell JD, Fu ZY, Roeder RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-383280", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-383280" } ], "reference": [ { "type": "PubMed", "id": "9653119", "url": "https://glygen.org/publication/PubMed/9653119" } ] } ], "pathway": [ { "id": "hsa:5914", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5914", "resource": "KEGG Pathway" }, { "id": "R-HSA-383280", "name": "Nuclear Receptor transcription pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-383280", "resource": "Reactome", "description": "Nuclear Receptor transcription pathway" }, { "id": "R-HSA-4090294", "name": "SUMOylation of intracellular receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4090294", "resource": "Reactome", "description": "SUMOylation of intracellular receptors" }, { "id": "R-HSA-5362517", "name": "Signaling by Retinoic Acid", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5362517", "resource": "Reactome", "description": "Signaling by Retinoic Acid" }, { "id": "R-HSA-5617472", "name": "Activation of anterior HOX genes in hindbrain development during early embryogenesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472", "resource": "Reactome", "description": "Activation of anterior HOX genes in hindbrain development during early embryogenesis" }, { "id": "R-HSA-9616222", "name": "Transcriptional regulation of granulopoiesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9616222", "resource": "Reactome", "description": "Transcriptional regulation of granulopoiesis" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0G2JW78-1", "protein_name": "Retinoic acid receptor, alpha", "gene_name": "Rara", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTSLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDKVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQSGGGTRDGGGLAPPPGSCSPSLSPSSHRSSPATQSP", "length": 462 }, "evidence": [ { "id": "45917633", "url": "http://www.informatics.jax.org/homology/45917633", "database": "MGI" }, { "id": "P10276", "url": "https://omabrowser.org/oma/group/P10276/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P11416-1", "protein_name": "Retinoic acid receptor alpha", "gene_name": "Rara", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTSLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFDVGMSKESVRNDRNKKKKEAPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDKVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQSGGGTRDGGGLAPPPGSCSPSLSPSSHRSSPATQSP", "length": 462 }, "evidence": [ { "id": "45917633", "url": "http://www.informatics.jax.org/homology/45917633", "database": "MGI" }, { "id": "P10276", "url": "https://omabrowser.org/oma/group/P10276/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 13, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "actin cytoskeleton", "id": "GO:0015629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015629", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "dendrite", "id": "GO:0030425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030425", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "transcription regulator complex", "id": "GO:0005667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005667", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "RNA polymerase II transcription regulator complex", "id": "GO:0090575", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090575", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 24, "go_terms": [ { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "sequence-specific DNA binding", "id": "GO:0043565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043565", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "nuclear receptor activity", "id": "GO:0004879", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004879", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "mRNA regulatory element binding translation repressor activity", "id": "GO:0000900", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000900", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "chromatin binding", "id": "GO:0003682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003682", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity", "id": "GO:0003700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003700", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "signaling receptor binding", "id": "GO:0005102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005102", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "protein domain specific binding", "id": "GO:0019904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019904", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "histone deacetylase binding", "id": "GO:0042826", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042826", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "alpha-actinin binding", "id": "GO:0051393", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051393", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "RNA polymerase II transcription regulatory region sequence-specific DNA binding", "id": "GO:0000977", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000977", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "chromatin DNA binding", "id": "GO:0031490", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031490", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "protein kinase A binding", "id": "GO:0051018", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051018", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "transcription coactivator binding", "id": "GO:0001223", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001223", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "protein kinase B binding", "id": "GO:0043422", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043422", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "retinoic acid-responsive element binding", "id": "GO:0044323", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044323", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "retinoic acid binding", "id": "GO:0001972", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001972", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "mRNA 5'-UTR binding", "id": "GO:0048027", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048027", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "sequence-specific double-stranded DNA binding", "id": "GO:1990837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990837", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "heterocyclic compound binding", "id": "GO:1901363", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901363", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "DNA-binding transcription repressor activity", "id": "GO:0001217", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001217", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 53, "go_terms": [ { "name": "retinoic acid receptor signaling pathway", "id": "GO:0048384", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048384", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "positive regulation of interleukin-13 production", "id": "GO:0032736", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032736", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "positive regulation of interleukin-5 production", "id": "GO:0032754", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032754", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "regulation of hematopoietic progenitor cell differentiation", "id": "GO:1901532", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901532", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "glandular epithelial cell development", "id": "GO:0002068", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002068", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "Sertoli cell fate commitment", "id": "GO:0060010", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060010", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "trachea cartilage development", "id": "GO:0060534", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060534", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "liver development", "id": "GO:0001889", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001889", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "protein phosphorylation", "id": "GO:0006468", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006468", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "negative regulation of cell population proliferation", "id": "GO:0008285", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008285", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "cell differentiation", "id": "GO:0030154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030154", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "response to ethanol", "id": "GO:0045471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045471", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "positive regulation of neuron differentiation", "id": "GO:0045666", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045666", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "cellular response to retinoic acid", "id": "GO:0071300", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071300", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "hippocampus development", "id": "GO:0021766", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021766", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "negative regulation of type II interferon production", "id": "GO:0032689", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032689", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "negative regulation of tumor necrosis factor production", "id": "GO:0032720", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032720", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "negative regulation of DNA-templated transcription", "id": "GO:0045892", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045892", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "regulation of synaptic plasticity", "id": "GO:0048167", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048167", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "multicellular organism growth", "id": "GO:0035264", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035264", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "cellular response to lipopolysaccharide", "id": "GO:0071222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071222", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "female pregnancy", "id": "GO:0007565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007565", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "response to retinoic acid", "id": "GO:0032526", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032526", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "neural tube closure", "id": "GO:0001843", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001843", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "hormone-mediated signaling pathway", "id": "GO:0009755", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009755", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "embryonic camera-type eye development", "id": "GO:0031076", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031076", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "response to estradiol", "id": "GO:0032355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032355", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "response to vitamin A", "id": "GO:0033189", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033189", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "response to cytokine", "id": "GO:0034097", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034097", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "face development", "id": "GO:0060324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060324", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "regulation of apoptotic process", "id": "GO:0042981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042981", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "positive regulation of cell cycle", "id": "GO:0045787", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045787", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "limb development", "id": "GO:0060173", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060173", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "germ cell development", "id": "GO:0007281", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007281", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "prostate gland development", "id": "GO:0030850", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030850", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "apoptotic cell clearance", "id": "GO:0043277", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043277", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "negative regulation of granulocyte differentiation", "id": "GO:0030853", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030853", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "regulation of myelination", "id": "GO:0031641", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031641", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "cellular response to estrogen stimulus", "id": "GO:0071391", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071391", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "ureteric bud development", "id": "GO:0001657", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001657", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "mRNA transcription by RNA polymerase II", "id": "GO:0042789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042789", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "positive regulation of binding", "id": "GO:0051099", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051099", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "positive regulation of interleukin-4 production", "id": "GO:0032753", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032753", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "positive regulation of T-helper 2 cell differentiation", "id": "GO:0045630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045630", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "chondroblast differentiation", "id": "GO:0060591", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060591", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "negative regulation of cartilage development", "id": "GO:0061037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061037", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "growth plate cartilage development", "id": "GO:0003417", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003417", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "ventricular cardiac muscle cell differentiation", "id": "GO:0055012", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055012", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" }, { "name": "negative regulation of miRNA transcription", "id": "GO:1902894", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902894", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 211, "end_pos": 213, "annotation": "n_glycosylation_sequon" }, { "start_pos": 212, "end_pos": 214, "annotation": "n_glycosylation_sequon" }, { "start_pos": 293, "end_pos": 295, "annotation": "n_glycosylation_sequon" }, { "start_pos": 453, "end_pos": 455, "annotation": "n_glycosylation_sequon" }, { "start_pos": 4, "end_pos": 6, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Acetylated; acetylation is increased upon pulsatile shear stress and decreased upon oscillatory shear stress.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "PubMed", "id": "28167758", "url": "https://glygen.org/publication/PubMed/28167758" } ] }, { "annotation": "Phosphorylated on serine and threonine residues. Phosphorylation does not change during cell cycle. Phosphorylation on Ser-77 is crucial for transcriptional activity (By similarity). Phosphorylation by AKT1 is required for the repressor activity but has no effect on DNA binding, protein stability nor subcellular localization. Phosphorylated by PKA in vitro. This phosphorylation on Ser-219 and Ser-369 is critical for ligand binding, nuclear localization and transcriptional activity in response to FSH signaling.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "PubMed", "id": "20215566", "url": "https://glygen.org/publication/PubMed/20215566" }, { "database": "PubMed", "id": "16417524", "url": "https://glygen.org/publication/PubMed/16417524" } ] }, { "annotation": "Sumoylated with SUMO2, mainly on Lys-399 which is also required for SENP6 binding. On all-trans retinoic acid (ATRA) binding, a confromational change may occur that allows sumoylation on two additional site, Lys-166 and Lys-171. Probably desumoylated by SENP6. Sumoylation levels determine nuclear localization and regulate ATRA-mediated transcriptional activity.", "evidence": [ { "database": "UniProtKB", "id": "P10276", "url": "https://www.uniprot.org/uniprot/P10276" }, { "database": "PubMed", "id": "15809060", "url": "https://glygen.org/publication/PubMed/15809060" }, { "database": "PubMed", "id": "19850744", "url": "https://glygen.org/publication/PubMed/19850744" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 77, 96, 157, 181, 210, 219, 369, 445, 461 ], "sequon_annotation_sites": [ { "start_pos": 211, "end_pos": 213 }, { "start_pos": 212, "end_pos": 214 }, { "start_pos": 293, "end_pos": 295 }, { "start_pos": 453, "end_pos": 455 }, { "start_pos": 4, "end_pos": 6 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 15 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 163 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }