{ "uniprot_canonical_ac": "P10266-1", "uniprot_ac": "P10266", "uniprot_id": "POK10_HUMAN", "mass": { "chemical_mass": 114827.0, "monoisotopic_mass": 114827.0 }, "refseq": {}, "gene_names": [ { "name": "ERVK-10", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P10266", "id": "P10266" } ], "protein_names": [ { "name": "Endogenous retrovirus group K member 10 Pol protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P10266" }, { "name": "HERV-K10 Pol protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10266" }, { "name": "HERV-K107 Pol protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10266" }, { "name": "HERV-K_5q33.3 provirus ancestral Pol protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10266" } ], "function": [ { "annotation": "Early post-infection, the reverse transcriptase converts the viral RNA genome into double-stranded viral DNA. The RNase H domain of the reverse transcriptase performs two functions. It degrades the RNA template and specifically removes the RNA primer from the RNA/DNA hybrid. Following nuclear import, the integrase catalyzes the insertion of the linear, double-stranded viral DNA into the host cell chromosome. Endogenous Pol proteins may have kept, lost or modified their original function during evolution.", "evidence": [ { "database": "UniProtKB", "id": "P10266", "url": "https://www.uniprot.org/uniprot/P10266#function" } ] }, { "annotation": "May possess a function in tumorigenesis.", "evidence": [ { "database": "UniProtKB", "id": "P61580", "url": "https://www.uniprot.org/uniprot/P61580#function" } ] }, { "annotation": "Retroviral proteases have roles in processing of the primary translation products and the maturation of the viral particle. Endogenous Pro proteins may have kept, lost or modified their original function during evolution. This endogenous protein has retained most of the characteristics of retroviral proteases.", "evidence": [ { "database": "UniProtKB", "id": "P10265", "url": "https://www.uniprot.org/uniprot/P10265#function" } ] }, { "annotation": "The products of the Gag polyproteins of infectious retroviruses perform highly complex orchestrated tasks during the assembly, budding, maturation, and infection stages of the viral replication cycle. During viral assembly, the proteins form membrane associations and self-associations that ultimately result in budding of an immature virion from the infected cell. Gag precursors also function during viral assembly to selectively bind and package two plus strands of genomic RNA. Endogenous Gag proteins may have kept, lost or modified their original function during evolution.", "evidence": [ { "database": "UniProtKB", "id": "P87889", "url": "https://www.uniprot.org/uniprot/P87889#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 26, "end_pos": 26, "sequence_org": "L", "sequence_mut": "M", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "P10265", "url": "https://www.uniprot.org/uniprot/P10265" }, { "database": "PubMed", "id": "9860826", "url": "https://glygen.org/publication/PubMed/9860826" }, { "database": "PubMed", "id": "11278433", "url": "https://glygen.org/publication/PubMed/11278433" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10266", "url": "https://www.uniprot.org/uniprot/P10266" } ], "common_name": "Human" } ], "gene": [ { "name": "ERVK-10", "url": "https://www.uniprot.org/uniprot/P10266", "locus": {} } ], "crossref": [ { "id": "3.4.23.50", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.4.23.50&UniProtAcc=P10266", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd01645", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01645", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd05482", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05482", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd09273", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd09273", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "ERVK-10", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ERVK-10", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "39004", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=39004", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P10266", "url": "https://www.ebi.ac.uk/intact/interactors/id:P10266*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000467", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000467", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000477", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000477", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001037", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001037", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001584", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001584", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001878", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001878", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001969", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001969", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001995", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001995", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002156", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002156", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003308", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003308", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003322", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003322", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008916", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008916", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008919", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008919", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR010661", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010661", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR010999", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010999", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012337", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012337", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017856", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017856", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018061", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018061", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR021109", "url": "https://www.ebi.ac.uk/interpro/entry/IPR021109", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029104", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029104", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034170", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034170", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036397", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036397", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036862", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036862", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036875", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036875", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038124", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038124", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043128", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043128", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043502", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043502", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045345", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045345", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "NX_P10265", "url": "https://www.nextprot.org/entry/NX_P10265", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "NX_P10266", "url": "https://www.nextprot.org/entry/NX_P10266", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "NX_P61580", "url": "https://www.nextprot.org/entry/NX_P61580", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "NX_P87889", "url": "https://www.nextprot.org/entry/NX_P87889", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "PTHR19422", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19422", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19422:SF123", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19422:SF123", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR40389", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR40389", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR40389:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR40389:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR41694", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR41694", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR41694:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR41694:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00075", "url": "http://pfam.xfam.org/family/PF00075", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00077", "url": "http://pfam.xfam.org/family/PF00077", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00078", "url": "http://pfam.xfam.org/family/PF00078", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00098", "url": "http://pfam.xfam.org/family/PF00098", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00552", "url": "http://pfam.xfam.org/family/PF00552", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00607", "url": "http://pfam.xfam.org/family/PF00607", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00665", "url": "http://pfam.xfam.org/family/PF00665", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01585", "url": "http://pfam.xfam.org/family/PF01585", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02022", "url": "http://pfam.xfam.org/family/PF02022", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02337", "url": "http://pfam.xfam.org/family/PF02337", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF06817", "url": "http://pfam.xfam.org/family/PF06817", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13804", "url": "http://pfam.xfam.org/family/PF13804", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF14787", "url": "http://pfam.xfam.org/family/PF14787", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF19317", "url": "http://pfam.xfam.org/family/PF19317", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P10265", "url": "https://pharos.nih.gov/targets/P10265", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "P10266", "url": "https://pharos.nih.gov/targets/P10266", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "P61580", "url": "https://pharos.nih.gov/targets/P61580", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "P87889", "url": "https://pharos.nih.gov/targets/P87889", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "22508", "url": "https://www.rhea-db.org/rhea/22508", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "P10265", "url": "https://www.uniprot.org/uniprot/P10265", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10265-1", "url": "https://www.uniprot.org/uniprot/P10265-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10266", "url": "https://www.uniprot.org/uniprot/P10266", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10266-1", "url": "https://www.uniprot.org/uniprot/P10266-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P61580", "url": "https://www.uniprot.org/uniprot/P61580", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P61580-1", "url": "https://www.uniprot.org/uniprot/P61580-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P87889", "url": "https://www.uniprot.org/uniprot/P87889", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P87889-1", "url": "https://www.uniprot.org/uniprot/P87889-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "NKSRKRRNRVSFLGAVTVEPPKPIPLTWKTEKPVWVNQWPLPKQKLEALHLLANEQLEKGHIEPSFSPWNSPVFVIQKKSGKWHTLTDLRAVNAVIQPMGPLQPGLPSPAMIPKDWPLIIIDLKDCFFTIPLAEQDCEKFAFTIPAINNKEPATRFQWKVLPQGMLNSPTICQTFVGRALQPVREKFSDCYIIHYIDDILCAAETKDKLIDCYTFLQAEVANAGLAIASDKIQTSTPFHYLGMQIENRKIKPQKIEIRKDTLKTLNDFQKLLGDINWIRPTLGIPTYAMSNLFSILRGDSDLNSQRILTPEATKEIKLVEEKIQSAQINRIDPLAPLQLLIFATAHSPTGIIIQNTDLVEWSFLPHSTVKTFTLYLDQIATLIGQTRLRITKLCGNDPDKIVVPLTKEQVRQAFINSGAWQIGLANFVGLIDNHYPKTKIFQFLKLTTWILPKITRREPLENALTVFTDGSSNGKAAYTGPKERVIKTPYQSAQRDELVAVITVLQDFDQPINIISDSAYVVQATRDVETALIKYSMDDQLNQLFNLLQQTVRKRNFPFYITYIRAHTNLPGPLTKANEQADLLVSSALIKAQELHALTHVNAAGLKNKFDVTWKQAKDIVQHCTQCQVLHLPTQEAGVNPRGLCPNALWQMDVTHVPSFGRLSYVHVTVDTYSHFIWATCQTGESTSHVKKHLLSCFAVMGVPEKIKTDNGPGYCSKAFQKFLSQWKISHTTGIPYNSQGQAIVERTNRTLKTQLVKQKEGGDSKECTTPQMQLNLALYTLNFLNIYRNQTTTSAEQHLTGKKNSPHEGKLIWWKDNKNKTWEIGKVITWGRGFACVSPGENQLPVWLPTRHLKFYNEPIGDAKKRASTEMVTPVTWMDNPIEVYVNDSIWVPGPIDDRCPAKPEEEGMMINISIGYRYPPICLGRAPGCLMPAVQNWLVEVPTVSPISRFTYHMVSGMSLRPRVNYLQDFSYQRSLKFRPKGKPCPKEIPKESKNTEVLVWEECVANSAVIL", "length": 1014, "header": "sp|P10266-1|POK10_HUMAN Isoform 1 of Endogenous retrovirus group K member 10 Pol protein OS=Homo sapiens OX=9606 GN=ERVK-10 PE=3 SV=2 CANONICAL=P10266-1" }, "isoforms": [ { "isoform_ac": "P10265-1", "url": "", "sequence": { "sequence": "WASQVSENRPVCKAIIQGKQFEGLVDTGADVSIIALNQWPKNWPKQKAVTGLVGIGTASEVYQSMEILHCLGPDNQESTVQPMITSIPLNLWGRDLLQQWGAEITMPAPLYSPTSQKIMTKMGYIPGKGLGKNEDGIKVPVEAKINQEREGIGYPF", "length": 156, "header": "sp|P10265-1|VPK10_HUMAN Computationally mapped isoform of Endogenous retrovirus group K member 10 Pro protein OS=Homo sapiens OX=9606 GN=ERVK-10 PE=1 SV=2 CANONICAL=P10266-1" }, "locus": {} }, { "isoform_ac": "P10266-1", "url": "", "sequence": { "sequence": "NKSRKRRNRVSFLGAVTVEPPKPIPLTWKTEKPVWVNQWPLPKQKLEALHLLANEQLEKGHIEPSFSPWNSPVFVIQKKSGKWHTLTDLRAVNAVIQPMGPLQPGLPSPAMIPKDWPLIIIDLKDCFFTIPLAEQDCEKFAFTIPAINNKEPATRFQWKVLPQGMLNSPTICQTFVGRALQPVREKFSDCYIIHYIDDILCAAETKDKLIDCYTFLQAEVANAGLAIASDKIQTSTPFHYLGMQIENRKIKPQKIEIRKDTLKTLNDFQKLLGDINWIRPTLGIPTYAMSNLFSILRGDSDLNSQRILTPEATKEIKLVEEKIQSAQINRIDPLAPLQLLIFATAHSPTGIIIQNTDLVEWSFLPHSTVKTFTLYLDQIATLIGQTRLRITKLCGNDPDKIVVPLTKEQVRQAFINSGAWQIGLANFVGLIDNHYPKTKIFQFLKLTTWILPKITRREPLENALTVFTDGSSNGKAAYTGPKERVIKTPYQSAQRDELVAVITVLQDFDQPINIISDSAYVVQATRDVETALIKYSMDDQLNQLFNLLQQTVRKRNFPFYITYIRAHTNLPGPLTKANEQADLLVSSALIKAQELHALTHVNAAGLKNKFDVTWKQAKDIVQHCTQCQVLHLPTQEAGVNPRGLCPNALWQMDVTHVPSFGRLSYVHVTVDTYSHFIWATCQTGESTSHVKKHLLSCFAVMGVPEKIKTDNGPGYCSKAFQKFLSQWKISHTTGIPYNSQGQAIVERTNRTLKTQLVKQKEGGDSKECTTPQMQLNLALYTLNFLNIYRNQTTTSAEQHLTGKKNSPHEGKLIWWKDNKNKTWEIGKVITWGRGFACVSPGENQLPVWLPTRHLKFYNEPIGDAKKRASTEMVTPVTWMDNPIEVYVNDSIWVPGPIDDRCPAKPEEEGMMINISIGYRYPPICLGRAPGCLMPAVQNWLVEVPTVSPISRFTYHMVSGMSLRPRVNYLQDFSYQRSLKFRPKGKPCPKEIPKESKNTEVLVWEECVANSAVIL", "length": 1014, "header": "sp|P10266-1|POK10_HUMAN Isoform 1 of Endogenous retrovirus group K member 10 Pol protein OS=Homo sapiens OX=9606 GN=ERVK-10 PE=3 SV=2 CANONICAL=P10266-1" }, "locus": {} }, { "isoform_ac": "P61580-1", "url": "", "sequence": { "sequence": "MNPSEMQRKGPPRRWCLQVYPTAPKRQRPSRTGHDDDGGFVEKKRGKCGEKQERSNCYCVCVERSRHRRLHFVMC", "length": 75, "header": "sp|P61580-1|NP10_HUMAN Computationally mapped isoform of Endogenous retrovirus group K member 10 Np9 protein OS=Homo sapiens OX=9606 GN=ERVK-10 PE=1 SV=1 CANONICAL=P10266-1" }, "locus": {} }, { "isoform_ac": "P87889-1", "url": "", "sequence": { "sequence": "MGQTKSKIKSKYASYLSFIKILLKRGGVKVSTKNLIKLFQIIEQFCPWFPEQGTSDLKDWKRIGKELKQAGRKGNIIPLTVWNDWAIIKAALEPFQTEEDSISVSDAPGSCLIDCNENTRKKSQKETESLHCEYVAEPVMAQSTQNVDYNQLQEVIYPETLKLEGKGPELMGPSESKPRGTSPLPAGQVLVRLQPQKQVKENKTQPQVAYQYWPLAELQYRPPPESQYGYPGMPPAPQGRAPYHQPPTRRLNPMAPPSRQGSELHEIIDKSRKEGDTEAWQFPVTLEPMPPGEGAQEGEPPTVEARYKSFSIKMLKDMKEGVKQYGPNSPYMRTLLDSIAYGHRLIPYDWEILAKSSLSPSQFLQFKTWWIDGVQEQVRRNRAANPPVNIDADQLLGIGQNWSTISQQALMQNEAIEQVRAICLRAWEKIQDPGSTCPSFNTVRQGSKEPYPDFVARLQDVAQKSIADEKAGKVIVELMAYENANPECQSAIKPLKGKVPAGSDVISEYVKACDGIGGAMHKAMLMAQAITGVVLGGQVRTFGGKCYNCGQIGHLKKNCPVLNKQNITIQATTTGREPPDLCPRCKKGKHWASQCRSKFDKNGQPLSGNEQRGQPQAPQQTGAFPIQPFVPQGFQGQQPPLSQVFQGISQLPQYNNCPSPQAAVQQ", "length": 666, "header": "sp|P87889-1|GAK10_HUMAN Computationally mapped isoform of Endogenous retrovirus group K member 10 Gag polyprotein OS=Homo sapiens OX=9606 GN=ERVK-10 PE=1 SV=4 CANONICAL=P10266-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Many human endogenous retrovirus K (HERV-K) proviruses are unique to humans.", "journal": "Curr. Biol.", "date": "1999", "authors": "Barbulescu M, Turner G, Seaman M I, Deinard A S, Kidd K K, Lenz J", "evidence": [ { "database": "UniProtKB", "id": "P10266", "url": "https://www.uniprot.org/uniprot/P10266" } ], "reference": [ { "type": "PubMed", "id": "10469592", "url": "https://glygen.org/publication/PubMed/10469592" } ] }, { "title": "Inhibition of human endogenous retrovirus-K10 protease in cell-free and cell-based assays.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Kuhelj R, Rizzo CJ, Chang CH, Jadhav PK, Towler EM, Korant BD", "evidence": [ { "database": "UniProtKB", "id": "P10266", "url": "https://www.uniprot.org/uniprot/P10266" } ], "reference": [ { "type": "PubMed", "id": "11278433", "url": "https://glygen.org/publication/PubMed/11278433" } ] }, { "title": "A novel gene from the human endogenous retrovirus K expressed in transformed cells.", "journal": "Clin. Cancer Res.", "date": "2002", "authors": "Armbruester Vivienne, Sauter Marlies, Krautkraemer Ellen, Meese Eckart, Kleiman Anya, Best Barbara, Roemer Klaus, Mueller-Lantzsch Nikolaus", "evidence": [ { "database": "UniProtKB", "id": "P61580", "url": "https://www.uniprot.org/uniprot/P61580" } ], "reference": [ { "type": "PubMed", "id": "12060620", "url": "https://glygen.org/publication/PubMed/12060620" } ] }, { "title": "Nucleotide sequence of human endogenous retrovirus genome related to the mouse mammary tumor virus genome.", "journal": "J. Virol.", "date": "1986", "authors": "Ono M, Yasunaga T, Miyata T, Ushikubo H", "evidence": [ { "database": "UniProtKB", "id": "P10266", "url": "https://www.uniprot.org/uniprot/P10266" } ], "reference": [ { "type": "PubMed", "id": "3021993", "url": "https://glygen.org/publication/PubMed/3021993" } ] }, { "title": "Human endogenous retrovirus K10: expression of Gag protein and detection of antibodies in patients with seminomas.", "journal": "J. Virol.", "date": "1995", "authors": "Sauter M, Schommer S, Kremmer E, Remberger K, D\u00f6lken G, Lemm I, Buck M, Best B, Neumann-Haefelin D, Mueller-Lantzsch N", "evidence": [ { "database": "UniProtKB", "id": "P87889", "url": "https://www.uniprot.org/uniprot/P87889" } ], "reference": [ { "type": "PubMed", "id": "7983737", "url": "https://glygen.org/publication/PubMed/7983737" } ] }, { "title": "Identification of human endogenous retroviruses with complex mRNA expression and particle formation.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1993", "authors": "L\u00f6wer R, Boller K, Hasenmaier B, Korbmacher C, M\u00fcller-Lantzsch N, L\u00f6wer J, Kurth R", "evidence": [ { "database": "UniProtKB", "id": "P87889", "url": "https://www.uniprot.org/uniprot/P87889" } ], "reference": [ { "type": "PubMed", "id": "8506289", "url": "https://glygen.org/publication/PubMed/8506289" } ] }, { "title": "Characterization of the human endogenous retrovirus K proteinase.", "journal": "J. Gen. Virol.", "date": "1996", "authors": "Schommer S, Sauter M, Kr\u00e4usslich H G, Best B, Mueller-Lantzsch N", "evidence": [ { "database": "UniProtKB", "id": "P10265", "url": "https://www.uniprot.org/uniprot/P10265" } ], "reference": [ { "type": "PubMed", "id": "8627242", "url": "https://glygen.org/publication/PubMed/8627242" } ] }, { "title": "Characterization of human endogenous retrovirus type K (HERV-K) virus-like particles generated from recombinant baculoviruses.", "journal": "Virology", "date": "1997", "authors": "T\u00f6njes R R, Boller K, Limbach C, Lugert R, Kurth R", "evidence": [ { "database": "UniProtKB", "id": "P10266", "url": "https://www.uniprot.org/uniprot/P10266" } ], "reference": [ { "type": "PubMed", "id": "9217052", "url": "https://glygen.org/publication/PubMed/9217052" } ] }, { "title": "Functional characterization of the protease of human endogenous retrovirus, K10: can it complement HIV-1 protease?", "journal": "Biochemistry", "date": "1998", "authors": "Towler EM, Gulnik SV, Bhat TN, Xie D, Gustschina E, Sumpter TR, Robertson N, Jones C, Sauter M, Mueller-Lantzsch N, Debouck C, Erickson JW", "evidence": [ { "database": "UniProtKB", "id": "P10266", "url": "https://www.uniprot.org/uniprot/P10266" } ], "reference": [ { "type": "PubMed", "id": "9860826", "url": "https://glygen.org/publication/PubMed/9860826" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "P10266", "url": "https://www.uniprot.org/uniprot/P10266" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "P10266", "url": "https://www.uniprot.org/uniprot/P10266" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 8, "go_terms": [ { "name": "RNA-directed DNA polymerase activity", "id": "GO:0003964", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003964", "evidence": [ { "database": "UniProtKB", "id": "P10266", "url": "https://www.uniprot.org/uniprot/P10266" } ], "pmid": "" }, { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "P10266", "url": "https://www.uniprot.org/uniprot/P10266" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "P10266", "url": "https://www.uniprot.org/uniprot/P10266" } ], "pmid": "" }, { "name": "RNA-DNA hybrid ribonuclease activity", "id": "GO:0004523", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004523", "evidence": [ { "database": "UniProtKB", "id": "P10266", "url": "https://www.uniprot.org/uniprot/P10266" } ], "pmid": "" }, { "name": "RNA stem-loop binding", "id": "GO:0035613", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035613", "evidence": [ { "database": "UniProtKB", "id": "P10266", "url": "https://www.uniprot.org/uniprot/P10266" } ], "pmid": "" }, { "name": "nucleic acid binding", "id": "GO:0003676", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003676", "evidence": [ { "database": "UniProtKB", "id": "P10266", "url": "https://www.uniprot.org/uniprot/P10266" } ], "pmid": "" }, { "name": "aspartic-type endopeptidase activity", "id": "GO:0004190", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004190", "evidence": [ { "database": "UniProtKB", "id": "P10266", "url": "https://www.uniprot.org/uniprot/P10266" } ], "pmid": "" }, { "name": "structural molecule activity", "id": "GO:0005198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005198", "evidence": [ { "database": "UniProtKB", "id": "P10266", "url": "https://www.uniprot.org/uniprot/P10266" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "DNA repair", "id": "GO:0006281", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006281", "evidence": [ { "database": "UniProtKB", "id": "P10266", "url": "https://www.uniprot.org/uniprot/P10266" } ], "pmid": "" }, { "name": "DNA recombination", "id": "GO:0006310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006310", "evidence": [ { "database": "UniProtKB", "id": "P10266", "url": "https://www.uniprot.org/uniprot/P10266" } ], "pmid": "" }, { "name": "DNA integration", "id": "GO:0015074", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015074", "evidence": [ { "database": "UniProtKB", "id": "P10266", "url": "https://www.uniprot.org/uniprot/P10266" } ], "pmid": "" }, { "name": "proteolysis", "id": "GO:0006508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508", "evidence": [ { "database": "UniProtKB", "id": "P10266", "url": "https://www.uniprot.org/uniprot/P10266" } ], "pmid": "" }, { "name": "viral process", "id": "GO:0016032", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016032", "evidence": [ { "database": "UniProtKB", "id": "P10266", "url": "https://www.uniprot.org/uniprot/P10266" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 1, "end_pos": 3, "annotation": "n_glycosylation_sequon" }, { "start_pos": 749, "end_pos": 751, "annotation": "n_glycosylation_sequon" }, { "start_pos": 790, "end_pos": 792, "annotation": "n_glycosylation_sequon" }, { "start_pos": 820, "end_pos": 822, "annotation": "n_glycosylation_sequon" }, { "start_pos": 888, "end_pos": 890, "annotation": "n_glycosylation_sequon" }, { "start_pos": 913, "end_pos": 915, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "22508", "name": "", "equation": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q673L6-1", "Q5RKI3-1", "O54747-1", "O89042-1", "P06766-1", "Q9QYV8-1", "D3Z8X4-1", "E9PT58-1", "F1M8G6-1", "F7F6Z7-1", "Q07864-1", "P28340-1", "P06746-1", "Q9UGP5-1", "P54098-1", "Q9NP87-1", "P09884-1", "Q7Z5Q5-1", "O75417-1", "O00370-1", "Q9WJR5-1", "Q9UBT6-1", "O60673-1", "Q9UNA4-1", "Q9Y253-1", "P63135-1", "P10266-1", "P63132-1", "P63133-1", "P63136-1", "Q9UQG0-1", "Q9QC07-1", "P63128-1", "Q9BXR3-1", "P04053-1", "O14746-1", "P10400-1", "P11369-1", "P52431-1", "Q7TQ07-1", "Q9JIW4-1", "P54099-1", "Q8K409-1", "P33609-1", "Q9WVF7-1", "Q9QXE2-1", "Q8CGS6-1", "Q61493-1", "O70372-1", "P09838-2", "Q6R3M4-1", "Q9JJN0-1", "Q9QUG2-1", "P13382-1", "P14284-1", "P15436-1", "P15801-1", "P21951-1", "P25384-1", "P25615-1", "P46957-1", "Q04049-1", "Q06163-1", "A0A0B7P3V8-1", "O13527-1", "O13535-1", "P0C2I2-1", "P0C2I3-1", "P0C2I5-1", "P0C2I6-1", "P0C2I9-1", "P0C2J0-1", "P0C2J1-1", "P0C2J3-1", "P0C2J7-1", "P0CX63-1", "P0CX64-1", "Q99231-1", "P39985-1", "P47024-1", "P47098-1", "P47100-1", "Q12472-1", "Q03434-1", "Q03494-1", "Q03612-1", "Q03619-1", "Q03855-1", "Q04214-1", "Q04670-1", "Q04711-1", "Q07791-1", "Q07793-1", "Q12088-1", "Q12112-1", "Q12113-1", "Q12141-1", "Q12193-1", "Q12269-1", "Q12273-1", "Q12316-1", "Q12414-1", "Q12490-1", "Q12491-1", "Q12501-1", "Q7LHG5-1", "Q92393-1", "Q99315-1", "Q99337-1", "Q55AZ3-1", "Q1ZXF2-1", "Q54B44-1", "Q54N97-1", "Q54RD4-1", "Q54SV8-1", "Q9GSR1-1", "Q9VHV1-1", "Q9VNX1-1", "Q9VCN1-1", "P26019-1", "P54358-1", "Q27607-1", "O18475-1" ], "evidence": [ { "id": "22508", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/22508" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0B7P3V8", "gene_name": "TY4B-P", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "A0A0B7P3V8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B7P3V8" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "A0A0B7P3V8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B7P3V8" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "A0A0B7P3V8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B7P3V8" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "A0A0B7P3V8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B7P3V8" } ] } ] }, { "uniprot_ac": "D3Z8X4", "gene_name": "Pole", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "D3Z8X4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z8X4" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "D3Z8X4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z8X4" } ] } ] }, { "uniprot_ac": "E9PT58", "gene_name": "Dntt", "activity": [ { "ec_number": "2.7.7.31", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "E9PT58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PT58" } ] }, { "ec_number": "2.7.7.31", "activity": "", "evidence": [ { "id": "E9PT58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PT58" } ] } ] }, { "uniprot_ac": "F1M8G6", "gene_name": "Rev3l", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "F1M8G6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M8G6" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "F1M8G6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M8G6" } ] } ] }, { "uniprot_ac": "F7F6Z7", "gene_name": "Polm", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "F7F6Z7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F7F6Z7" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "F7F6Z7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F7F6Z7" } ] } ] }, { "uniprot_ac": "O00370", "gene_name": "", "activity": [ { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O00370", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00370" } ] }, { "ec_number": "3.1.21.-", "activity": "", "evidence": [ { "id": "O00370", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00370" } ] } ] }, { "uniprot_ac": "O13527", "gene_name": "TY1B-A", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O13527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O13527" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "O13527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O13527" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O13527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O13527" } ] } ] }, { "uniprot_ac": "O13535", "gene_name": "TY1B-H", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "O13535", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O13535" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O13535", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O13535" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "O13535", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O13535" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O13535", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O13535" } ] } ] }, { "uniprot_ac": "O14746", "gene_name": "TERT", "activity": [ { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O14746", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14746" } ] }, { "ec_number": "2.7.7.49", "activity": "", "evidence": [ { "id": "O14746", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14746" } ] } ] }, { "uniprot_ac": "O18475", "gene_name": "PolQ", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O18475", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O18475" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "O18475", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O18475" } ] } ] }, { "uniprot_ac": "O54747", "gene_name": "Pold1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O54747", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54747" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "O54747", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54747" } ] }, { "ec_number": "3.1.11.-", "activity": "", "evidence": [ { "id": "O54747", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54747" } ] } ] }, { "uniprot_ac": "O60673", "gene_name": "REV3L", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O60673", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60673" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "O60673", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60673" } ] } ] }, { "uniprot_ac": "O70372", "gene_name": "Tert", "activity": [ { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O70372", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70372" } ] }, { "ec_number": "2.7.7.49", "activity": "", "evidence": [ { "id": "O70372", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70372" } ] } ] }, { "uniprot_ac": "O75417", "gene_name": "POLQ", "activity": [ { "ec_number": "3.6.4.12", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "O75417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75417" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O75417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75417" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O75417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75417" } ] } ] }, { "uniprot_ac": "O89042", "gene_name": "Pola1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O89042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O89042" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "O89042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O89042" } ] } ] }, { "uniprot_ac": "P04053", "gene_name": "DNTT", "activity": [ { "ec_number": "2.7.7.31", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P04053", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04053" } ] }, { "ec_number": "2.7.7.31", "activity": "", "evidence": [ { "id": "P04053", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04053" } ] } ] }, { "uniprot_ac": "P06746", "gene_name": "POLB", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P06746", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06746" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P06746", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06746" } ] }, { "ec_number": "4.2.99.18", "activity": "2'-deoxyribonucleotide-(2'-deoxyribose 5'-phosphate)-2'-deoxyribonucleotide-DNA = a 3'-end 2'-deoxyribonucleotide-(2,3-dehydro-2,3-deoxyribose 5'-phosphate)-DNA + a 5'-end 5'-monophospho-2'-deoxyribonucleoside-DNA + H(+).", "evidence": [ { "id": "P06746", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06746" } ] }, { "ec_number": "4.2.99.-", "activity": "", "evidence": [ { "id": "P06746", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06746" } ] } ] }, { "uniprot_ac": "P06766", "gene_name": "Polb", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P06766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06766" } ] }, { "ec_number": "4.2.99.18", "activity": "2'-deoxyribonucleotide-(2'-deoxyribose 5'-phosphate)-2'-deoxyribonucleotide-DNA = a 3'-end 2'-deoxyribonucleotide-(2,3-dehydro-2,3-deoxyribose 5'-phosphate)-DNA + a 5'-end 5'-monophospho-2'-deoxyribonucleoside-DNA + H(+).", "evidence": [ { "id": "P06766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06766" } ] }, { "ec_number": "4.2.99.-", "activity": "", "evidence": [ { "id": "P06766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06766" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P06766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06766" } ] } ] }, { "uniprot_ac": "P09838", "gene_name": "Dntt", "activity": [ { "ec_number": "3.1.11.-", "activity": "", "evidence": [ { "id": "P09838", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09838" } ] }, { "ec_number": "2.7.7.31", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P09838", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09838" } ] }, { "ec_number": "2.7.7.31", "activity": "", "evidence": [ { "id": "P09838", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09838" } ] } ] }, { "uniprot_ac": "P09884", "gene_name": "POLA1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P09884", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09884" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P09884", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09884" } ] } ] }, { "uniprot_ac": "P0C2I2", "gene_name": "TY1B-DR5", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2I2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I2" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P0C2I2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I2" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2I2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I2" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P0C2I2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I2" } ] } ] }, { "uniprot_ac": "P0C2I3", "gene_name": "TY1B-DR6", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P0C2I3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I3" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2I3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I3" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P0C2I3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I3" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2I3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I3" } ] } ] }, { "uniprot_ac": "P0C2I5", "gene_name": "TY1B-LR2", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P0C2I5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I5" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2I5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I5" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P0C2I5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I5" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2I5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I5" } ] } ] }, { "uniprot_ac": "P0C2I6", "gene_name": "TY1B-LR3", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P0C2I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I6" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I6" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P0C2I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I6" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I6" } ] } ] }, { "uniprot_ac": "P0C2I9", "gene_name": "TY1B-PR1", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P0C2I9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I9" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2I9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I9" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P0C2I9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I9" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2I9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I9" } ] } ] }, { "uniprot_ac": "P0C2J0", "gene_name": "TY1B-PR2", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P0C2J0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J0" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2J0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J0" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P0C2J0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J0" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2J0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J0" } ] } ] }, { "uniprot_ac": "P0C2J1", "gene_name": "TY1B-PR3", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P0C2J1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J1" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2J1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J1" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P0C2J1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J1" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2J1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J1" } ] } ] }, { "uniprot_ac": "P0C2J3", "gene_name": "TY2B-LR1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2J3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J3" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P0C2J3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J3" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2J3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J3" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P0C2J3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J3" } ] } ] }, { "uniprot_ac": "P0C2J7", "gene_name": "TY4B-H", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2J7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J7" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P0C2J7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J7" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2J7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J7" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P0C2J7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J7" } ] } ] }, { "uniprot_ac": "P0CX63", "gene_name": "TY2B-F", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0CX63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CX63" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P0CX63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CX63" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0CX63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CX63" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P0CX63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CX63" } ] } ] }, { "uniprot_ac": "P0CX64", "gene_name": "TY2B-GR2", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0CX64", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CX64" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P0CX64", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CX64" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0CX64", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CX64" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P0CX64", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CX64" } ] } ] }, { "uniprot_ac": "P10266", "gene_name": "ERVK-10", "activity": [ { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P10266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10266" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P10266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10266" } ] }, { "ec_number": "3.4.23.50", "activity": "Processing at the authentic HIV-1 PR recognition site and release of the mature p17 matrix and the p24 capsid protein, as a result of the cleavage of the -SQNY-|-PIVQ- cleavage site.", "evidence": [ { "id": "P10266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10266" } ] } ] }, { "uniprot_ac": "P10400", "gene_name": "Pol", "activity": [ { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P10400", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10400" } ] } ] }, { "uniprot_ac": "P11369", "gene_name": "Pol", "activity": [ { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P11369", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11369" } ] }, { "ec_number": "3.1.21.-", "activity": "", "evidence": [ { "id": "P11369", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11369" } ] } ] }, { "uniprot_ac": "P13382", "gene_name": "POL1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P13382", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13382" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P13382", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13382" } ] } ] }, { "uniprot_ac": "P14284", "gene_name": "REV3", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P14284", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14284" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P14284", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14284" } ] } ] }, { "uniprot_ac": "P15436", "gene_name": "POL3", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P15436", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15436" } ] }, { "ec_number": "3.1.11.-", "activity": "", "evidence": [ { "id": "P15436", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15436" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P15436", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15436" } ] } ] }, { "uniprot_ac": "P15801", "gene_name": "MIP1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P15801", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15801" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P15801", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15801" } ] } ] }, { "uniprot_ac": "P21951", "gene_name": "POL2", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P21951", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21951" } ] }, { "ec_number": "3.1.11.-", "activity": "", "evidence": [ { "id": "P21951", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21951" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P21951", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21951" } ] } ] }, { "uniprot_ac": "P25384", "gene_name": "TY2B-C", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P25384", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25384" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P25384", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25384" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P25384", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25384" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P25384", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25384" } ] } ] }, { "uniprot_ac": "P25615", "gene_name": "POL4", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P25615", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25615" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P25615", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25615" } ] } ] }, { "uniprot_ac": "P26019", "gene_name": "PolA1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P26019", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26019" } ] }, { "ec_number": "3.1.11.-", "activity": "", "evidence": [ { "id": "P26019", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26019" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P26019", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26019" } ] } ] }, { "uniprot_ac": "P28340", "gene_name": "POLD1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P28340", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28340" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P28340", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28340" } ] }, { "ec_number": "3.1.11.-", "activity": "", "evidence": [ { "id": "P28340", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28340" } ] } ] }, { "uniprot_ac": "P33609", "gene_name": "Pola1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P33609", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33609" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P33609", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33609" } ] } ] }, { "uniprot_ac": "P39985", "gene_name": "POL5", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P39985", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39985" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P39985", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39985" } ] } ] }, { "uniprot_ac": "P46957", "gene_name": "POL31", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P46957", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46957" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P46957", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46957" } ] } ] }, { "uniprot_ac": "P47024", "gene_name": "TY4B-J", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P47024", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47024" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P47024", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47024" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P47024", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47024" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P47024", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47024" } ] } ] }, { "uniprot_ac": "P47098", "gene_name": "TY1B-JR1", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P47098", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47098" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P47098", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47098" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P47098", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47098" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P47098", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47098" } ] } ] }, { "uniprot_ac": "P47100", "gene_name": "TY1B-JR2", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P47100", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47100" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P47100", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47100" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P47100", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47100" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P47100", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47100" } ] } ] }, { "uniprot_ac": "P52431", "gene_name": "Pold1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P52431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52431" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P52431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52431" } ] }, { "ec_number": "3.1.11.-", "activity": "", "evidence": [ { "id": "P52431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52431" } ] } ] }, { "uniprot_ac": "P54098", "gene_name": "POLG", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P54098", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54098" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P54098", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54098" } ] } ] }, { "uniprot_ac": "P54099", "gene_name": "Polg", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P54099", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54099" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P54099", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54099" } ] } ] }, { "uniprot_ac": "P54358", "gene_name": "PolD1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P54358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54358" } ] }, { "ec_number": "3.1.11.-", "activity": "", "evidence": [ { "id": "P54358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54358" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P54358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54358" } ] } ] }, { "uniprot_ac": "P63128", "gene_name": "ERVK-9", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P63128", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63128" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P63128", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63128" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P63128", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63128" } ] }, { "ec_number": "3.4.23.50", "activity": "Processing at the authentic HIV-1 PR recognition site and release of the mature p17 matrix and the p24 capsid protein, as a result of the cleavage of the -SQNY-|-PIVQ- cleavage site.", "evidence": [ { "id": "P63128", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63128" } ] } ] }, { "uniprot_ac": "P63132", "gene_name": "HERVK_113", "activity": [ { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P63132", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63132" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P63132", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63132" } ] } ] }, { "uniprot_ac": "P63133", "gene_name": "ERVK-8", "activity": [ { "ec_number": "3.4.23.50", "activity": "Processing at the authentic HIV-1 PR recognition site and release of the mature p17 matrix and the p24 capsid protein, as a result of the cleavage of the -SQNY-|-PIVQ- cleavage site.", "evidence": [ { "id": "P63133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63133" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P63133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63133" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P63133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63133" } ] } ] }, { "uniprot_ac": "P63135", "gene_name": "ERVK-7", "activity": [ { "ec_number": "3.4.23.50", "activity": "Processing at the authentic HIV-1 PR recognition site and release of the mature p17 matrix and the p24 capsid protein, as a result of the cleavage of the -SQNY-|-PIVQ- cleavage site.", "evidence": [ { "id": "P63135", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63135" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P63135", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63135" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P63135", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63135" } ] } ] }, { "uniprot_ac": "P63136", "gene_name": "ERVK-25", "activity": [ { "ec_number": "3.4.23.50", "activity": "Processing at the authentic HIV-1 PR recognition site and release of the mature p17 matrix and the p24 capsid protein, as a result of the cleavage of the -SQNY-|-PIVQ- cleavage site.", "evidence": [ { "id": "P63136", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63136" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P63136", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63136" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P63136", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63136" } ] } ] }, { "uniprot_ac": "Q03434", "gene_name": "TY1B-ML2", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q03434", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03434" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q03434", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03434" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q03434", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03434" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q03434", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03434" } ] } ] }, { "uniprot_ac": "Q03494", "gene_name": "TY2B-DR2", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q03494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03494" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q03494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03494" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q03494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03494" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q03494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03494" } ] } ] }, { "uniprot_ac": "Q03612", "gene_name": "TY1B-ER1", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q03612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03612" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q03612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03612" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q03612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03612" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q03612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03612" } ] } ] }, { "uniprot_ac": "Q03619", "gene_name": "TY1B-ER2", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q03619", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03619" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q03619", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03619" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q03619", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03619" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q03619", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03619" } ] } ] }, { "uniprot_ac": "Q03855", "gene_name": "TY1B-DR1", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q03855", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03855" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q03855", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03855" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q03855", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03855" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q03855", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03855" } ] } ] }, { "uniprot_ac": "Q04049", "gene_name": "RAD30", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q04049", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04049" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q04049", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04049" } ] } ] }, { "uniprot_ac": "Q04214", "gene_name": "TY1B-MR1", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q04214", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04214" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q04214", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04214" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q04214", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04214" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q04214", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04214" } ] } ] }, { "uniprot_ac": "Q04670", "gene_name": "TY1B-MR2", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q04670", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04670" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q04670", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04670" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q04670", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04670" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q04670", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04670" } ] } ] }, { "uniprot_ac": "Q04711", "gene_name": "TY1B-ML1", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q04711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04711" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q04711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04711" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q04711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04711" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q04711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04711" } ] } ] }, { "uniprot_ac": "Q06163", "gene_name": "EST2", "activity": [ { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q06163", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06163" } ] }, { "ec_number": "2.7.7.49", "activity": "", "evidence": [ { "id": "Q06163", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06163" } ] } ] }, { "uniprot_ac": "Q07791", "gene_name": "TY2B-DR3", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q07791", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07791" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q07791", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07791" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q07791", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07791" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q07791", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07791" } ] } ] }, { "uniprot_ac": "Q07793", "gene_name": "TY1B-DR4", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q07793", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07793" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q07793", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07793" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q07793", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07793" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q07793", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07793" } ] } ] }, { "uniprot_ac": "Q07864", "gene_name": "POLE", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q07864", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07864" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q07864", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07864" } ] }, { "ec_number": "3.1.11.-", "activity": "", "evidence": [ { "id": "Q07864", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07864" } ] } ] }, { "uniprot_ac": "Q12088", "gene_name": "TY1B-LR1", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q12088", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12088" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12088", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12088" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q12088", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12088" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12088", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12088" } ] } ] }, { "uniprot_ac": "Q12112", "gene_name": "TY1B-NL1", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q12112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12112" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12112" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q12112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12112" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12112" } ] } ] }, { "uniprot_ac": "Q12113", "gene_name": "TY2B-OR1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12113" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q12113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12113" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12113" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q12113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12113" } ] } ] }, { "uniprot_ac": "Q12141", "gene_name": "TY1B-GR1", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q12141", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12141" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12141", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12141" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q12141", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12141" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12141", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12141" } ] } ] }, { "uniprot_ac": "Q12193", "gene_name": "TY1B-BR", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q12193", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12193" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12193", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12193" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q12193", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12193" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12193", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12193" } ] } ] }, { "uniprot_ac": "Q12269", "gene_name": "TY1B-GR2", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q12269", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12269" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12269", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12269" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q12269", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12269" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12269", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12269" } ] } ] }, { "uniprot_ac": "Q12273", "gene_name": "TY1B-OL", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q12273", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12273" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12273", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12273" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q12273", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12273" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12273", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12273" } ] } ] }, { "uniprot_ac": "Q12316", "gene_name": "TY1B-GR3", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q12316", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12316" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12316", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12316" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q12316", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12316" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12316", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12316" } ] } ] }, { "uniprot_ac": "Q12414", "gene_name": "TY1B-PL", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q12414", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12414" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12414", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12414" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q12414", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12414" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12414", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12414" } ] } ] }, { "uniprot_ac": "Q12472", "gene_name": "TY2B-DR1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12472", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12472" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q12472", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12472" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12472", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12472" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q12472", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12472" } ] } ] }, { "uniprot_ac": "Q12490", "gene_name": "TY1B-BL", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q12490", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12490" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12490", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12490" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q12490", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12490" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12490", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12490" } ] } ] }, { "uniprot_ac": "Q12491", "gene_name": "TY2B-B", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12491" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q12491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12491" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12491" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q12491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12491" } ] } ] }, { "uniprot_ac": "Q12501", "gene_name": "TY2B-OR2", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12501", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12501" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q12501", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12501" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12501", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12501" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q12501", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12501" } ] } ] }, { "uniprot_ac": "Q1ZXF2", "gene_name": "polB", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q1ZXF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1ZXF2" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q1ZXF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1ZXF2" } ] } ] }, { "uniprot_ac": "Q27607", "gene_name": "PolG1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q27607", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q27607" } ] }, { "ec_number": "3.1.11.-", "activity": "", "evidence": [ { "id": "Q27607", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q27607" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q27607", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q27607" } ] } ] }, { "uniprot_ac": "Q54B44", "gene_name": "", "activity": [ { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q54B44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54B44" } ] }, { "ec_number": "2.7.7.49", "activity": "", "evidence": [ { "id": "Q54B44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54B44" } ] } ] }, { "uniprot_ac": "Q54N97", "gene_name": "pold1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q54N97", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54N97" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q54N97", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54N97" } ] } ] }, { "uniprot_ac": "Q54RD4", "gene_name": "pole", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q54RD4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RD4" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q54RD4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RD4" } ] } ] }, { "uniprot_ac": "Q54SV8", "gene_name": "pola1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q54SV8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54SV8" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q54SV8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54SV8" } ] } ] }, { "uniprot_ac": "Q55AZ3", "gene_name": "polZ", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q55AZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55AZ3" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q55AZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55AZ3" } ] } ] }, { "uniprot_ac": "Q5RKI3", "gene_name": "Poll", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q5RKI3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5RKI3" } ] }, { "ec_number": "4.2.99.-", "activity": "", "evidence": [ { "id": "Q5RKI3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5RKI3" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q5RKI3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5RKI3" } ] } ] }, { "uniprot_ac": "Q61493", "gene_name": "Rev3l", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q61493", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61493" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q61493", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61493" } ] } ] }, { "uniprot_ac": "Q673L6", "gene_name": "Tert", "activity": [ { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q673L6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q673L6" } ] }, { "ec_number": "2.7.7.49", "activity": "", "evidence": [ { "id": "Q673L6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q673L6" } ] } ] }, { "uniprot_ac": "Q6R3M4", "gene_name": "Poli", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q6R3M4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6R3M4" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q6R3M4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6R3M4" } ] } ] }, { "uniprot_ac": "Q7LHG5", "gene_name": "TY3B-I", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q7LHG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7LHG5" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q7LHG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7LHG5" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q7LHG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7LHG5" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q7LHG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7LHG5" } ] } ] }, { "uniprot_ac": "Q7TQ07", "gene_name": "Poln", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q7TQ07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TQ07" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q7TQ07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TQ07" } ] } ] }, { "uniprot_ac": "Q7Z5Q5", "gene_name": "POLN", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q7Z5Q5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z5Q5" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q7Z5Q5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z5Q5" } ] } ] }, { "uniprot_ac": "Q8CGS6", "gene_name": "Polq", "activity": [ { "ec_number": "3.6.4.12", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "Q8CGS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CGS6" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q8CGS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CGS6" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q8CGS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CGS6" } ] } ] }, { "uniprot_ac": "Q8K409", "gene_name": "Polb", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q8K409", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K409" } ] }, { "ec_number": "4.2.99.18", "activity": "2'-deoxyribonucleotide-(2'-deoxyribose 5'-phosphate)-2'-deoxyribonucleotide-DNA = a 3'-end 2'-deoxyribonucleotide-(2,3-dehydro-2,3-deoxyribose 5'-phosphate)-DNA + a 5'-end 5'-monophospho-2'-deoxyribonucleoside-DNA + H(+).", "evidence": [ { "id": "Q8K409", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K409" } ] }, { "ec_number": "4.2.99.-", "activity": "", "evidence": [ { "id": "Q8K409", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K409" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q8K409", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K409" } ] } ] }, { "uniprot_ac": "Q92393", "gene_name": "TY1B-OR", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q92393", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92393" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q92393", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92393" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q92393", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92393" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q92393", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92393" } ] } ] }, { "uniprot_ac": "Q99231", "gene_name": "TY1B-DR3", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q99231", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99231" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q99231", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99231" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q99231", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99231" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q99231", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99231" } ] } ] }, { "uniprot_ac": "Q99315", "gene_name": "TY3B-G", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q99315", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99315" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q99315", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99315" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q99315", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99315" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q99315", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99315" } ] } ] }, { "uniprot_ac": "Q99337", "gene_name": "TY1B-NL2", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q99337", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99337" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q99337", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99337" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q99337", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99337" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q99337", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99337" } ] } ] }, { "uniprot_ac": "Q9BXR3", "gene_name": "ERVK-6", "activity": [ { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9BXR3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BXR3" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q9BXR3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BXR3" } ] }, { "ec_number": "3.4.23.50", "activity": "Processing at the authentic HIV-1 PR recognition site and release of the mature p17 matrix and the p24 capsid protein, as a result of the cleavage of the -SQNY-|-PIVQ- cleavage site.", "evidence": [ { "id": "Q9BXR3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BXR3" } ] } ] }, { "uniprot_ac": "Q9GSR1", "gene_name": "PolZ1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9GSR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9GSR1" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9GSR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9GSR1" } ] } ] }, { "uniprot_ac": "Q9JIW4", "gene_name": "Polm", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9JIW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIW4" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9JIW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIW4" } ] } ] }, { "uniprot_ac": "Q9JJN0", "gene_name": "Polh", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9JJN0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJN0" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9JJN0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJN0" } ] } ] }, { "uniprot_ac": "Q9NP87", "gene_name": "POLM", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9NP87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NP87" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9NP87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NP87" } ] } ] }, { "uniprot_ac": "Q9QC07", "gene_name": "ERVK-18", "activity": [ { "ec_number": "3.4.23.50", "activity": "Processing at the authentic HIV-1 PR recognition site and release of the mature p17 matrix and the p24 capsid protein, as a result of the cleavage of the -SQNY-|-PIVQ- cleavage site.", "evidence": [ { "id": "Q9QC07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QC07" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9QC07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QC07" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q9QC07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QC07" } ] } ] }, { "uniprot_ac": "Q9QUG2", "gene_name": "Polk", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9QUG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUG2" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9QUG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUG2" } ] } ] }, { "uniprot_ac": "Q9QXE2", "gene_name": "Poll", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9QXE2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXE2" } ] }, { "ec_number": "4.2.99.-", "activity": "", "evidence": [ { "id": "Q9QXE2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXE2" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9QXE2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXE2" } ] } ] }, { "uniprot_ac": "Q9QYV8", "gene_name": "Polg", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9QYV8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYV8" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9QYV8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYV8" } ] } ] }, { "uniprot_ac": "Q9UBT6", "gene_name": "POLK", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9UBT6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UBT6" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9UBT6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UBT6" } ] } ] }, { "uniprot_ac": "Q9UGP5", "gene_name": "POLL", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9UGP5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UGP5" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9UGP5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UGP5" } ] }, { "ec_number": "4.2.99.-", "activity": "", "evidence": [ { "id": "Q9UGP5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UGP5" } ] } ] }, { "uniprot_ac": "Q9UNA4", "gene_name": "POLI", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9UNA4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UNA4" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9UNA4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UNA4" } ] } ] }, { "uniprot_ac": "Q9UQG0", "gene_name": "ERVK-11", "activity": [ { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9UQG0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UQG0" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q9UQG0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UQG0" } ] } ] }, { "uniprot_ac": "Q9VCN1", "gene_name": "PolE1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9VCN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCN1" } ] }, { "ec_number": "3.1.11.-", "activity": "", "evidence": [ { "id": "Q9VCN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCN1" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9VCN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCN1" } ] } ] }, { "uniprot_ac": "Q9VHV1", "gene_name": "PolI", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9VHV1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHV1" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9VHV1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHV1" } ] } ] }, { "uniprot_ac": "Q9VNX1", "gene_name": "PolH", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9VNX1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VNX1" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9VNX1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VNX1" } ] } ] }, { "uniprot_ac": "Q9WJR5", "gene_name": "ERVK-19", "activity": [ { "ec_number": "3.4.23.50", "activity": "Processing at the authentic HIV-1 PR recognition site and release of the mature p17 matrix and the p24 capsid protein, as a result of the cleavage of the -SQNY-|-PIVQ- cleavage site.", "evidence": [ { "id": "Q9WJR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WJR5" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9WJR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WJR5" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q9WJR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WJR5" } ] } ] }, { "uniprot_ac": "Q9WVF7", "gene_name": "Pole", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9WVF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVF7" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9WVF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVF7" } ] }, { "ec_number": "3.1.11.-", "activity": "", "evidence": [ { "id": "Q9WVF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVF7" } ] } ] }, { "uniprot_ac": "Q9Y253", "gene_name": "POLH", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9Y253", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y253" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9Y253", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y253" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 1, "end_pos": 3 }, { "start_pos": 749, "end_pos": 751 }, { "start_pos": 790, "end_pos": 792 }, { "start_pos": 820, "end_pos": 822 }, { "start_pos": 888, "end_pos": 890 }, { "start_pos": 913, "end_pos": 915 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }