{ "uniprot_canonical_ac": "P10109-1", "uniprot_ac": "P10109", "uniprot_id": "ADX_HUMAN", "mass": { "chemical_mass": 19393.0, "monoisotopic_mass": 19393.0 }, "refseq": { "ac": "NP_004100", "name": "adrenodoxin, mitochondrial precursor", "summary": "This gene encodes a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to mitochondrial cytochrome P450, involved in steroid, vitamin D, and bile acid metabolism. Pseudogenes of this functional gene are found on chromosomes 20 and 21. [provided by RefSeq, Aug 2011].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004100" }, "gene_names": [ { "name": "FDX1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P10109", "id": "P10109" }, { "name": "ADX; FDX; LOH11CR1D", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004100", "id": "NP_004100" }, { "name": "ADX", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/P10109", "id": "P10109" }, { "name": "FDX1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004100", "id": "NP_004100" } ], "protein_names": [ { "name": "Adrenodoxin, mitochondrial", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P10109" }, { "name": "Adrenal ferredoxin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10109" }, { "name": "Ferredoxin-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10109" }, { "name": "Hepatoredoxin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "P10109" }, { "name": "adrenodoxin, mitochondrial precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004100", "id": "NP_004100" }, { "name": "adrenodoxin, mitochondrial; mitochondrial adrenodoxin; hepatoredoxin; adrenal ferredoxin", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004100", "id": "NP_004100" } ], "function": [ { "annotation": "Essential for the synthesis of various steroid hormones (PubMed:20547883, PubMed:21636783). Participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis (PubMed:20547883, PubMed:21636783). Transfers electrons from adrenodoxin reductase to CYP11A1, a cytochrome P450 that catalyzes cholesterol side-chain cleavage (PubMed:20547883, PubMed:21636783). Does not form a ternary complex with adrenodoxin reductase and CYP11A1 but shuttles between the two enzymes to transfer electrons (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "P10109", "url": "https://www.uniprot.org/uniprot/P10109#function" }, { "database": "PubMed", "id": "20547883", "url": "https://glygen.org/publication/PubMed/20547883" }, { "database": "PubMed", "id": "21636783", "url": "https://glygen.org/publication/PubMed/21636783" }, { "database": "UniProtKB", "id": "P00257", "url": "https://www.uniprot.org/uniprot/P00257#function" } ] }, { "annotation": "FDX1 regulates cellular protein lipoylation through direct binding to LIAS.", "evidence": [ { "database": "RefSeq", "id": "NP_004100", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004100" }, { "database": "PubMed", "id": "37453661", "url": "https://glygen.org/publication/PubMed/37453661" } ] }, { "annotation": "Interactions of human mitochondrial Ferredoxin 1 (Adrenodoxin) by NMR; modulation by cytochrome P450 substrate and by truncation of the C-terminal tail.", "evidence": [ { "database": "RefSeq", "id": "NP_004100", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004100" }, { "database": "PubMed", "id": "37734220", "url": "https://glygen.org/publication/PubMed/37734220" } ] }, { "annotation": "Lipoylation is dependent on the ferredoxin FDX1 and dispensable under hypoxia in human cells.", "evidence": [ { "database": "RefSeq", "id": "NP_004100", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004100" }, { "database": "PubMed", "id": "37481209", "url": "https://glygen.org/publication/PubMed/37481209" } ] }, { "annotation": "METTL3 promotes non-small-cell lung cancer growth and metastasis by inhibiting FDX1 through copper death-associated pri-miR-21-5p maturation.", "evidence": [ { "database": "RefSeq", "id": "NP_004100", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004100" }, { "database": "PubMed", "id": "38126112", "url": "https://glygen.org/publication/PubMed/38126112" } ] }, { "annotation": "Systematic analysis based on the cuproptosis-related genes identifies ferredoxin 1 as an immune regulator and therapeutic target for glioblastoma. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_004100", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004100" }, { "database": "PubMed", "id": "38114959", "url": "https://glygen.org/publication/PubMed/38114959" } ] }, { "annotation": "This gene encodes a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to mitochondrial cytochrome P450, involved in steroid, vitamin D, and bile acid metabolism. Pseudogenes of this functional gene are found on chromosomes 20 and 21. [provided by RefSeq, Aug 2011].", "evidence": [ { "database": "RefSeq", "id": "NP_004100", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004100" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "84.49", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137714", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137714" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "84.17", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137714", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137714" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "77.7", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000137714", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137714" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000137714", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137714" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "79.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000137714", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137714" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "84.9", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137714", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137714" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "73.25", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000137714", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137714" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "80.7", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000137714", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137714" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "84.59", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137714", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137714" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "72.59", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000137714", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137714" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "89.01", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000137714", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137714" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "79.88", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000137714", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137714" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "77.73", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000137714", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137714" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P10109", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10109" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P10109", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10109" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P10109", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10109" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P10109", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10109" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P10109", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10109" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P10109", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10109" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P10109", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10109" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P10109", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10109" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P10109", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10109" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P10109", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10109" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P10109", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10109" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P10109", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P10109" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P10109", "url": "https://www.uniprot.org/uniprot/P10109" } ], "common_name": "Human" } ], "gene": [ { "name": "FDX1", "url": "https://www.uniprot.org/uniprot/P10109", "locus": { "chromosome": "11", "start_pos": 110464884, "end_pos": 110429948, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000137714", "url": "https://www.ensembl.org/id/ENSG00000137714" } ] } } ], "crossref": [ { "id": "ENSG00000137714", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000137714", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00207", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00207", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "FDX1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=FDX1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "2230", "url": "https://www.ncbi.nlm.nih.gov/gene/2230", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "3638", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=3638", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "P10109", "url": "https://www.ebi.ac.uk/intact/interactors/id:P10109*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001041", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001041", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001055", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001055", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012675", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012675", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018298", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018298", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036010", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036010", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:2230", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2230", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "103260", "url": "http://www.omim.org/entry/103260", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_P10109", "url": "https://www.nextprot.org/entry/NX_P10109", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "ICLKKFM", "url": "https://omabrowser.org/oma/group/ICLKKFM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "36668at2759", "url": "http://www.orthodb.org/?query=36668at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23426", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23426", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23426:SF26", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23426:SF26", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3N9Y", "url": "https://www.rcsb.org/structure/3N9Y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3N9Z", "url": "https://www.rcsb.org/structure/3N9Z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3NA0", "url": "https://www.rcsb.org/structure/3NA0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3NA1", "url": "https://www.rcsb.org/structure/3NA1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3P1M", "url": "https://www.rcsb.org/structure/3P1M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7M8I", "url": "https://www.rcsb.org/structure/7M8I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00111", "url": "http://pfam.xfam.org/family/PF00111", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "P10109", "url": "https://pharos.nih.gov/targets/P10109", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_P10109", "url": "http://purl.obolibrary.org/obo/PR_P10109", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-196108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196108", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2395516", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2395516", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5579026", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5579026", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_004100", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004100", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P10109", "url": "https://www.uniprot.org/uniprot/P10109", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P10109-1", "url": "https://www.uniprot.org/uniprot/P10109-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS", "length": 184, "header": "sp|P10109-1|ADX_HUMAN Isoform 1 of Adrenodoxin, mitochondrial OS=Homo sapiens OX=9606 GN=FDX1 PE=1 SV=1 CANONICAL=P10109-1" }, "isoforms": [ { "isoform_ac": "P10109-1", "url": "", "sequence": { "sequence": "MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS", "length": 184, "header": "sp|P10109-1|ADX_HUMAN Isoform 1 of Adrenodoxin, mitochondrial OS=Homo sapiens OX=9606 GN=FDX1 PE=1 SV=1 CANONICAL=P10109-1" }, "locus": { "chromosome": "11", "start_pos": 110462465, "end_pos": 110430121, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000260270.3", "url": "https://www.ensembl.org/id/ENST00000260270.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000260270.2", "url": "https://www.ensembl.org/id/ENSP00000260270.2" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 177, "end_pos": 177, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P10109", "url": "https://www.uniprot.org/uniprot/P10109" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "P10109", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10109" } ], "site_lbl": "Ser177" }, { "start_pos": 63, "end_pos": 63, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P10109", "url": "https://www.uniprot.org/uniprot/P10109" }, { "database": "iPTMnet", "id": "P10109", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10109" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "P10109", "url": "http://phospho.elm.eu.org/byAccession/P10109.html" } ], "site_lbl": "Ser63" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Structure and functions of human oxysterol 7alpha-hydroxylase cDNAs and gene CYP7B1.", "journal": "Journal of lipid research", "date": "1999", "authors": "Wu Z, Martin KO, Javitt NB, Chiang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "10588945", "url": "https://glygen.org/publication/PubMed/10588945" } ] }, { "title": "NifS-directed assembly of a transient [2Fe-2S] cluster within the NifU protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Yuvaniyama P, Agar JN, Cash VL, Johnson MK, Dean DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "10639125", "url": "https://glygen.org/publication/PubMed/10639125" } ] }, { "title": "Heterozygous mutation in the cholesterol side chain cleavage enzyme (p450scc) gene in a patient with 46,XY sex reversal and adrenal insufficiency.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2001", "authors": "Tajima T, Fujieda K, Kouda N, Nakae J, Miller WL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5579026", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5579026" } ], "reference": [ { "type": "PubMed", "id": "11502818", "url": "https://glygen.org/publication/PubMed/11502818" } ] }, { "title": "Role of human cytochrome P450 1A1, 1A2, 1B1, and 3A4 in the 2-, 4-, and 16alpha-hydroxylation of 17beta-estradiol.", "journal": "Metabolism: clinical and experimental", "date": "2001", "authors": "Badawi AF, Cavalieri EL, Rogan EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "11555828", "url": "https://glygen.org/publication/PubMed/11555828" } ] }, { "title": "Assembly and iron-binding properties of human frataxin, the protein deficient in Friedreich ataxia.", "journal": "Human molecular genetics", "date": "2002", "authors": "Cavadini P, O'Neill HA, Benada O, Isaya G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "11823441", "url": "https://glygen.org/publication/PubMed/11823441" } ] }, { "title": "Electrochemical behaviour of human adrenodoxin on a pyrolytic graphite electrode.", "journal": "Bioelectrochemistry", "date": "2003", "authors": "Johnson Daniel, Norman Shona, Tuckey Robert C, Martin Lisandra L", "evidence": [ { "database": "UniProtKB", "id": "P10109", "url": "https://www.uniprot.org/uniprot/P10109" } ], "reference": [ { "type": "PubMed", "id": "12699818", "url": "https://glygen.org/publication/PubMed/12699818" } ] }, { "title": "Iron-sulfur cluster biosynthesis. Characterization of frataxin as an iron donor for assembly of [2Fe-2S] clusters in ISU-type proteins.", "journal": "Journal of the American Chemical Society", "date": "2003", "authors": "Yoon T, Cowan JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "12785837", "url": "https://glygen.org/publication/PubMed/12785837" } ] }, { "title": "Subcellular compartmentalization of human Nfu, an iron-sulfur cluster scaffold protein, and its ability to assemble a [4Fe-4S] cluster.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Tong WH, Jameson GN, Huynh BH, Rouault TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "12886008", "url": "https://glygen.org/publication/PubMed/12886008" } ] }, { "title": "An interaction between frataxin and Isu1/Nfs1 that is crucial for Fe/S cluster synthesis on Isu1.", "journal": "EMBO reports", "date": "2003", "authors": "Gerber J, Muhlenhoff U, Lill R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "12947415", "url": "https://glygen.org/publication/PubMed/12947415" } ] }, { "title": "Components involved in assembly and dislocation of iron-sulfur clusters on the scaffold protein Isu1p.", "journal": "The EMBO journal", "date": "2003", "authors": "Muhlenhoff U, Gerber J, Richhardt N, Lill R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "12970193", "url": "https://glygen.org/publication/PubMed/12970193" } ] }, { "title": "Bietti crystalline corneoretinal dystrophy is caused by mutations in the novel gene CYP4V2.", "journal": "American journal of human genetics", "date": "2004", "authors": "Li A, Jiao X, Munier FL, Schorderet DF, Yao W, Iwata F, Hayakawa M, Kanai A, Shy Chen M, Alan Lewis R, Heckenlively J, Weleber RG, Traboulsi EI, Zhang Q, Xiao X, Kaiser-Kupfer M, Sergeev YV, Hejtmancik JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "15042513", "url": "https://glygen.org/publication/PubMed/15042513" } ] }, { "title": "Homozygous disruption of P450 side-chain cleavage (CYP11A1) is associated with prematurity, complete 46,XY sex reversal, and severe adrenal failure.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2005", "authors": "Hiort O, Holterhus PM, Werner R, Marschke C, Hoppe U, Partsch CJ, Riepe FG, Achermann JC, Struve D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5579026", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5579026" } ], "reference": [ { "type": "PubMed", "id": "15507506", "url": "https://glygen.org/publication/PubMed/15507506" } ] }, { "title": "Iron-sulfur protein maturation in human cells: evidence for a function of frataxin.", "journal": "Human molecular genetics", "date": "2004", "authors": "Stehling O, Elsasser HP, Bruckel B, Muhlenhoff U, Lill R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "15509595", "url": "https://glygen.org/publication/PubMed/15509595" } ] }, { "title": "Expression and characterization of human mitochondrial ferredoxin reductase in Escherichia coli.", "journal": "Archives of biochemistry and biophysics", "date": "1992", "authors": "Brandt ME, Vickery LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-2395516", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2395516" } ], "reference": [ { "type": "PubMed", "id": "1567230", "url": "https://glygen.org/publication/PubMed/1567230" } ] }, { "title": "Structure, function, and formation of biological iron-sulfur clusters.", "journal": "Annual review of biochemistry", "date": "2005", "authors": "Johnson DC, Dean DR, Smith AD, Johnson MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "15952888", "url": "https://glygen.org/publication/PubMed/15952888" } ] }, { "title": "Role of human mitochondrial Nfs1 in cytosolic iron-sulfur protein biogenesis and iron regulation.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Biederbick A, Stehling O, Rosser R, Niggemeyer B, Nakai Y, Elsasser HP, Lill R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "16847322", "url": "https://glygen.org/publication/PubMed/16847322" } ] }, { "title": "StAR search--what we know about how the steroidogenic acute regulatory protein mediates mitochondrial cholesterol import.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2007", "authors": "Miller WL", "evidence": [ { "database": "Reactome", "id": "R-HSA-196108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196108" } ], "reference": [ { "type": "PubMed", "id": "16973755", "url": "https://glygen.org/publication/PubMed/16973755" } ] }, { "title": "Characterization of human sterol 27-hydroxylase. A mitochondrial cytochrome P-450 that catalyzes multiple oxidation reaction in bile acid biosynthesis.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Cali JJ, Russell DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "1708392", "url": "https://glygen.org/publication/PubMed/1708392" } ] }, { "title": "Mitochondrial frataxin interacts with ISD11 of the NFS1/ISCU complex and multiple mitochondrial chaperones.", "journal": "Human molecular genetics", "date": "2007", "authors": "Shan Y, Napoli E, Cortopassi G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "17331979", "url": "https://glygen.org/publication/PubMed/17331979" } ] }, { "title": "Role of steroid 11 beta-hydroxylase and steroid 18-hydroxylase in the biosynthesis of glucocorticoids and mineralocorticoids in humans.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Kawamoto T, Mitsuuchi Y, Toda K, Yokoyama Y, Miyahara K, Miura S, Ohnishi T, Ichikawa Y, Nakao K, Imura H, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "1741400", "url": "https://glygen.org/publication/PubMed/1741400" } ] }, { "title": "Binding of yeast frataxin to the scaffold for Fe-S cluster biogenesis, Isu.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Wang T, Craig EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "18319250", "url": "https://glygen.org/publication/PubMed/18319250" } ] }, { "title": "A proposed role for the Azotobacter vinelandii NfuA protein as an intermediate iron-sulfur cluster carrier.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Bandyopadhyay S, Naik SG, O'Carroll IP, Huynh BH, Dean DR, Johnson MK, Dos Santos PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "18339629", "url": "https://glygen.org/publication/PubMed/18339629" } ] }, { "title": "Mapping iron binding sites on human frataxin: implications for cluster assembly on the ISU Fe-S cluster scaffold protein.", "journal": "Journal of biological inorganic chemistry : JBIC : a publication of the Society of Biological Inorganic Chemistry", "date": "2008", "authors": "Huang J, Dizin E, Cowan JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "18425540", "url": "https://glygen.org/publication/PubMed/18425540" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "P10109", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10109" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "1H NMR spectra of vertebrate [2Fe-2S] ferredoxins. Hyperfine resonances suggest different electron delocalization patterns from plant ferredoxins.", "journal": "Biochemistry", "date": "1991", "authors": "Skjeldal L, Markley J L, Coghlan V M, Vickery L E", "evidence": [ { "database": "UniProtKB", "id": "P10109", "url": "https://www.uniprot.org/uniprot/P10109" } ], "reference": [ { "type": "PubMed", "id": "1909889", "url": "https://glygen.org/publication/PubMed/1909889" } ] }, { "title": "Human ISD11 is essential for both iron-sulfur cluster assembly and maintenance of normal cellular iron homeostasis.", "journal": "Human molecular genetics", "date": "2009", "authors": "Shi Y, Ghosh MC, Tong WH, Rouault TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "19454487", "url": "https://glygen.org/publication/PubMed/19454487" } ] }, { "title": "Expression and characterization of CYP4V2 as a fatty acid omega-hydroxylase.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2009", "authors": "Nakano M, Kelly EJ, Rettie AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "19661213", "url": "https://glygen.org/publication/PubMed/19661213" } ] }, { "title": "Structural basis of human CYP51 inhibition by antifungal azoles.", "journal": "Journal of molecular biology", "date": "2010", "authors": "Strushkevich N, Usanov SA, Park HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "20149798", "url": "https://glygen.org/publication/PubMed/20149798" } ] }, { "title": "Frataxin and mitochondrial FeS cluster biogenesis.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Stemmler TL, Lesuisse E, Pain D, Dancis A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "20522547", "url": "https://glygen.org/publication/PubMed/20522547" } ] }, { "title": "Humans possess two mitochondrial ferredoxins, Fdx1 and Fdx2, with distinct roles in steroidogenesis, heme, and Fe/S cluster biosynthesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Sheftel AD, Stehling O, Pierik AJ, Elsasser HP, Muhlenhoff U, Webert H, Hobler A, Hannemann F, Bernhardt R, Lill R", "evidence": [ { "database": "UniProtKB", "id": "P10109", "url": "https://www.uniprot.org/uniprot/P10109" }, { "database": "Reactome", "id": "R-HSA-2395516", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2395516" } ], "reference": [ { "type": "PubMed", "id": "20547883", "url": "https://glygen.org/publication/PubMed/20547883" } ] }, { "title": "Characterization of the human HSC20, an unusual DnaJ type III protein, involved in iron-sulfur cluster biogenesis.", "journal": "Human molecular genetics", "date": "2010", "authors": "Uhrigshardt H, Singh A, Kovtunovych G, Ghosh M, Rouault TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "20668094", "url": "https://glygen.org/publication/PubMed/20668094" } ] }, { "title": "Human frataxin is an allosteric switch that activates the Fe-S cluster biosynthetic complex.", "journal": "Biochemistry", "date": "2010", "authors": "Tsai CL, Barondeau DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "20873749", "url": "https://glygen.org/publication/PubMed/20873749" } ] }, { "title": "Partial defect in the cholesterol side-chain cleavage enzyme P450scc (CYP11A1) resembling nonclassic congenital lipoid adrenal hyperplasia.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2011", "authors": "Sahakitrungruang T, Tee MK, Blackett PR, Miller WL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5579026", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5579026" } ], "reference": [ { "type": "PubMed", "id": "21159840", "url": "https://glygen.org/publication/PubMed/21159840" } ] }, { "title": "Mammalian frataxin: an essential function for cellular viability through an interaction with a preformed ISCU/NFS1/ISD11 iron-sulfur assembly complex.", "journal": "PloS one", "date": "2011", "authors": "Schmucker S, Martelli A, Colin F, Page A, Wattenhofer-Donze M, Reutenauer L, Puccio H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "21298097", "url": "https://glygen.org/publication/PubMed/21298097" } ] }, { "title": "Structural basis for pregnenolone biosynthesis by the mitochondrial monooxygenase system.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Strushkevich N, MacKenzie F, Cherkesova T, Grabovec I, Usanov S, Park HW", "evidence": [ { "database": "UniProtKB", "id": "P10109", "url": "https://www.uniprot.org/uniprot/P10109" }, { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "21636783", "url": "https://glygen.org/publication/PubMed/21636783" } ] }, { "title": "Structure-function analysis of Friedreich's ataxia mutants reveals determinants of frataxin binding and activation of the Fe-S assembly complex.", "journal": "Biochemistry", "date": "2011", "authors": "Bridwell-Rabb J, Winn AM, Barondeau DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "21776984", "url": "https://glygen.org/publication/PubMed/21776984" } ] }, { "title": "Mutations in iron-sulfur cluster scaffold genes NFU1 and BOLA3 cause a fatal deficiency of multiple respiratory chain and 2-oxoacid dehydrogenase enzymes.", "journal": "American journal of human genetics", "date": "2011", "authors": "Cameron JM, Janer A, Levandovskiy V, Mackay N, Rouault TA, Tong WH, Ogilvie I, Shoubridge EA, Robinson BH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "21944046", "url": "https://glygen.org/publication/PubMed/21944046" } ] }, { "title": "Specialized function of yeast Isa1 and Isa2 proteins in the maturation of mitochondrial [4Fe-4S] proteins.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Muhlenhoff U, Richter N, Pines O, Pierik AJ, Lill R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "21987576", "url": "https://glygen.org/publication/PubMed/21987576" } ] }, { "title": "A fatal mitochondrial disease is associated with defective NFU1 function in the maturation of a subset of mitochondrial Fe-S proteins.", "journal": "American journal of human genetics", "date": "2011", "authors": "Navarro-Sastre A, Tort F, Stehling O, Uzarska MA, Arranz JA, Del Toro M, Labayru MT, Landa J, Font A, Garcia-Villoria J, Merinero B, Ugarte M, Gutierrez-Solana LG, Campistol J, Garcia-Cazorla A, Vaquerizo J, Riudor E, Briones P, Elpeleg O, Ribes A, Lill R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "22077971", "url": "https://glygen.org/publication/PubMed/22077971" } ] }, { "title": "Both human ferredoxins 1 and 2 and ferredoxin reductase are important for iron-sulfur cluster biogenesis.", "journal": "Biochimica et biophysica acta", "date": "2012", "authors": "Shi Y, Ghosh M, Kovtunovych G, Crooks DR, Rouault TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "22101253", "url": "https://glygen.org/publication/PubMed/22101253" } ] }, { "title": "Interaction of J-protein co-chaperone Jac1 with Fe-S scaffold Isu is indispensable in vivo and conserved in evolution.", "journal": "Journal of molecular biology", "date": "2012", "authors": "Ciesielski SJ, Schilke BA, Osipiuk J, Bigelow L, Mulligan R, Majewska J, Joachimiak A, Marszalek J, Craig EA, Dutkiewicz R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "22306468", "url": "https://glygen.org/publication/PubMed/22306468" } ] }, { "title": "The human mitochondrial ISCA1, ISCA2, and IBA57 proteins are required for [4Fe-4S] protein maturation.", "journal": "Molecular biology of the cell", "date": "2012", "authors": "Sheftel AD, Wilbrecht C, Stehling O, Niggemeyer B, Elsasser HP, Muhlenhoff U, Lill R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "22323289", "url": "https://glygen.org/publication/PubMed/22323289" } ] }, { "title": "Effector role reversal during evolution: the case of frataxin in Fe-S cluster biosynthesis.", "journal": "Biochemistry", "date": "2012", "authors": "Bridwell-Rabb J, Iannuzzi C, Pastore A, Barondeau DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "22352884", "url": "https://glygen.org/publication/PubMed/22352884" } ] }, { "title": "(IscS-IscU)2 complex structures provide insights into Fe2S2 biogenesis and transfer.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2012", "authors": "Marinoni EN, de Oliveira JS, Nicolet Y, Raulfs EC, Amara P, Dean DR, Fontecilla-Camps JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "22511353", "url": "https://glygen.org/publication/PubMed/22511353" } ] }, { "title": "Cloning and expression of a cDNA for human cytochrome P-450aldo as related to primary aldosteronism.", "journal": "Biochemical and biophysical research communications", "date": "1990", "authors": "Kawainoto T, Mitsuuchi Y, Ohnishi T, Ichikawa Y, Yokoyama Y, Sumimoto H, Toda K, Miyahara K, Kuribayashi I, Nakao K, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "2256920", "url": "https://glygen.org/publication/PubMed/2256920" } ] }, { "title": "CYP4V2 in Bietti's crystalline dystrophy: ocular localization, metabolism of omega-3-polyunsaturated fatty acids, and functional deficit of the p.H331P variant.", "journal": "Molecular pharmacology", "date": "2012", "authors": "Nakano M, Kelly EJ, Wiek C, Hanenberg H, Rettie AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "22772592", "url": "https://glygen.org/publication/PubMed/22772592" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "P10109", "url": "https://www.uniprot.org/uniprot/P10109" }, { "database": "iPTMnet", "id": "P10109", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10109" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Structure, sequence, chromosomal location, and evolution of the human ferredoxin gene family.", "journal": "DNA Cell Biol.", "date": "1990", "authors": "Chang CY, Wu DA, Mohandas TK, Chung BC", "evidence": [ { "database": "UniProtKB", "id": "P10109", "url": "https://www.uniprot.org/uniprot/P10109" } ], "reference": [ { "type": "PubMed", "id": "2340092", "url": "https://glygen.org/publication/PubMed/2340092" } ] }, { "title": "[2Fe-2S] cluster transfer in iron-sulfur protein biogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Banci L, Brancaccio D, Ciofi-Baffoni S, Del Conte R, Gadepalli R, Mikolajczyk M, Neri S, Piccioli M, Winkelmann J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "24733926", "url": "https://glygen.org/publication/PubMed/24733926" } ] }, { "title": "Formation of [4Fe-4S] clusters in the mitochondrial iron-sulfur cluster assembly machinery.", "journal": "Journal of the American Chemical Society", "date": "2014", "authors": "Brancaccio D, Gallo A, Mikolajczyk M, Zovo K, Palumaa P, Novellino E, Piccioli M, Ciofi-Baffoni S, Banci L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "25347204", "url": "https://glygen.org/publication/PubMed/25347204" } ] }, { "title": "The binding site specificity of STARD4 subfamily: Breaking the cholesterol paradigm.", "journal": "Molecular and cellular endocrinology", "date": "2015", "authors": "Letourneau D, Lefebvre A, Lavigne P, LeHoux JG", "evidence": [ { "database": "Reactome", "id": "R-HSA-196108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196108" } ], "reference": [ { "type": "PubMed", "id": "25542846", "url": "https://glygen.org/publication/PubMed/25542846" } ] }, { "title": "Translocator protein-mediated pharmacology of cholesterol transport and steroidogenesis.", "journal": "Molecular and cellular endocrinology", "date": "2015", "authors": "Papadopoulos V, Aghazadeh Y, Fan J, Campioli E, Zirkin B, Midzak A", "evidence": [ { "database": "Reactome", "id": "R-HSA-196108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196108" } ], "reference": [ { "type": "PubMed", "id": "25818881", "url": "https://glygen.org/publication/PubMed/25818881" } ] }, { "title": "Characterization of two genes encoding human steroid 11 beta-hydroxylase (P-450(11) beta).", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Mornet E, Dupont J, Vitek A, White PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "2592361", "url": "https://glygen.org/publication/PubMed/2592361" } ] }, { "title": "The Human Iron-Sulfur Assembly Complex Catalyzes the Synthesis of [2Fe-2S] Clusters on ISCU2 That Can Be Transferred to Acceptor Molecules.", "journal": "Biochemistry", "date": "2015", "authors": "Fox NG, Chakrabarti M, McCormick SP, Lindahl PA, Barondeau DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "26016389", "url": "https://glygen.org/publication/PubMed/26016389" } ] }, { "title": "Frataxin Accelerates [2Fe-2S] Cluster Formation on the Human Fe-S Assembly Complex.", "journal": "Biochemistry", "date": "2015", "authors": "Fox NG, Das D, Chakrabarti M, Lindahl PA, Barondeau DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "26016518", "url": "https://glygen.org/publication/PubMed/26016518" } ] }, { "title": "[4Fe-4S] Cluster Assembly in Mitochondria and Its Impairment by Copper.", "journal": "Journal of the American Chemical Society", "date": "2017", "authors": "Brancaccio D, Gallo A, Piccioli M, Novellino E, Ciofi-Baffoni S, Banci L", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "27989128", "url": "https://glygen.org/publication/PubMed/27989128" } ] }, { "title": "Human Mitochondrial Ferredoxin 1 (FDX1) and Ferredoxin 2 (FDX2) Both Bind Cysteine Desulfurase and Donate Electrons for Iron-Sulfur Cluster Biosynthesis.", "journal": "Biochemistry", "date": "2017", "authors": "Cai K, Tonelli M, Frederick RO, Markley JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1362409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409" } ], "reference": [ { "type": "PubMed", "id": "28001042", "url": "https://glygen.org/publication/PubMed/28001042" } ] }, { "title": "Molecular cloning and sequence analysis of human placental ferredoxin.", "journal": "Arch. Biochem. Biophys.", "date": "1988", "authors": "Mittal S, Zhu Y Z, Vickery L E", "evidence": [ { "database": "UniProtKB", "id": "P10109", "url": "https://www.uniprot.org/uniprot/P10109" } ], "reference": [ { "type": "PubMed", "id": "2969697", "url": "https://glygen.org/publication/PubMed/2969697" } ] }, { "title": "Peripheral-type benzodiazepine receptors in endocrine organs: autoradiographic localization in rat pituitary, adrenal, and testis.", "journal": "Endocrinology", "date": "1985", "authors": "De Souza EB, Anholt RR, Murphy KM, Snyder SH, Kuhar MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-196108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196108" } ], "reference": [ { "type": "PubMed", "id": "2981667", "url": "https://glygen.org/publication/PubMed/2981667" } ] }, { "title": "The peripheral-type benzodiazepine receptor. Localization to the mitochondrial outer membrane.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Anholt RR, Pedersen PL, De Souza EB, Snyder SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-196108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196108" } ], "reference": [ { "type": "PubMed", "id": "3001071", "url": "https://glygen.org/publication/PubMed/3001071" } ] }, { "title": "Human cholesterol side-chain cleavage enzyme, P450scc: cDNA cloning, assignment of the gene to chromosome 15, and expression in the placenta.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986", "authors": "Chung BC, Matteson KJ, Voutilainen R, Mohandas TK, Miller WL", "evidence": [ { "database": "Reactome", "id": "R-HSA-196108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196108" } ], "reference": [ { "type": "PubMed", "id": "3024157", "url": "https://glygen.org/publication/PubMed/3024157" } ] }, { "title": "Molecular characterization of the HLA-linked steroid 21-hydroxylase B gene from an individual with congenital adrenal hyperplasia.", "journal": "The EMBO journal", "date": "1987", "authors": "Rodrigues NR, Dunham I, Yu CY, Carroll MC, Porter RR, Campbell RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "3038528", "url": "https://glygen.org/publication/PubMed/3038528" } ] }, { "title": "Cloning and structure of the human adrenodoxin gene.", "journal": "DNA", "date": "1988", "authors": "Chang C Y, Wu D A, Lai C C, Miller W L, Chung B C", "evidence": [ { "database": "UniProtKB", "id": "P10109", "url": "https://www.uniprot.org/uniprot/P10109" } ], "reference": [ { "type": "PubMed", "id": "3229285", "url": "https://glygen.org/publication/PubMed/3229285" } ] }, { "title": "Human adrenodoxin: cloning of three cDNAs and cycloheximide enhancement in JEG-3 cells.", "journal": "J. Biol. Chem.", "date": "1988", "authors": "Picado-Leonard J, Voutilainen R, Kao L C, Chung B C, Strauss J F, Miller W L", "evidence": [ { "database": "UniProtKB", "id": "P10109", "url": "https://www.uniprot.org/uniprot/P10109" } ], "reference": [ { "type": "PubMed", "id": "3343244", "url": "https://glygen.org/publication/PubMed/3343244" } ] }, { "title": "Structure of human steroid 21-hydroxylase genes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986", "authors": "White PC, New MI, Dupont B", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "3487786", "url": "https://glygen.org/publication/PubMed/3487786" } ] }, { "title": "FDX1 regulates cellular protein lipoylation through direct binding to LIAS.", "journal": "The Journal of biological chemistry", "date": "2023-09", "authors": "Dreishpoon Margaret B, Bick Nolan R, Petrova Boryana, Warui Douglas M, Cameron Alison, Booker Squire J, Kanarek Naama, Golub Todd R, Tsvetkov Peter", "evidence": [ { "database": "RefSeq", "id": "NP_004100", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004100" } ], "reference": [ { "type": "PubMed", "id": "37453661", "url": "https://glygen.org/publication/PubMed/37453661" } ] }, { "title": "Lipoylation is dependent on the ferredoxin FDX1 and dispensable under hypoxia in human cells.", "journal": "The Journal of biological chemistry", "date": "2023-09", "authors": "Joshi Pallavi R, Sadre Shayan, Guo Xiaoyan A, McCoy Jason G, Mootha Vamsi K", "evidence": [ { "database": "RefSeq", "id": "NP_004100", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004100" } ], "reference": [ { "type": "PubMed", "id": "37481209", "url": "https://glygen.org/publication/PubMed/37481209" } ] }, { "title": "Interactions of human mitochondrial Ferredoxin 1 (Adrenodoxin) by NMR; modulation by cytochrome P450 substrate and by truncation of the C-terminal tail.", "journal": "Journal of inorganic biochemistry", "date": "2023-12", "authors": "Jay Natalie, McGlohon Janie E, Estrada D Fernando", "evidence": [ { "database": "RefSeq", "id": "NP_004100", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004100" } ], "reference": [ { "type": "PubMed", "id": "37734220", "url": "https://glygen.org/publication/PubMed/37734220" } ] }, { "title": "Systematic analysis based on the cuproptosis-related genes identifies ferredoxin 1 as an immune regulator and therapeutic target for glioblastoma.", "journal": "BMC cancer", "date": "2023-12-19", "authors": "Dai Lirui, Zhou Peizhi, Lyu Liang, Jiang Shu", "evidence": [ { "database": "RefSeq", "id": "NP_004100", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004100" } ], "reference": [ { "type": "PubMed", "id": "38114959", "url": "https://glygen.org/publication/PubMed/38114959" } ] }, { "title": "METTL3 promotes non-small-cell\u00a0lung cancer growth and metastasis by inhibiting FDX1 through copper death-associated pri-miR-21-5p maturation.", "journal": "Epigenomics", "date": "2023-12", "authors": "Qian Shuai, Liu Jun, Liao Wenliang, Wang Fengping", "evidence": [ { "database": "RefSeq", "id": "NP_004100", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004100" } ], "reference": [ { "type": "PubMed", "id": "38126112", "url": "https://glygen.org/publication/PubMed/38126112" } ] }, { "title": "The human peripheral benzodiazepine receptor gene: cloning and characterization of alternative splicing in normal tissues and in a patient with congenital lipoid adrenal hyperplasia.", "journal": "Genomics", "date": "1993", "authors": "Lin D, Chang YJ, Strauss JF 3rd, Miller WL", "evidence": [ { "database": "Reactome", "id": "R-HSA-196108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196108" } ], "reference": [ { "type": "PubMed", "id": "8307574", "url": "https://glygen.org/publication/PubMed/8307574" } ] }, { "title": "The ubiquitously expressed human CYP51 encodes lanosterol 14 alpha-demethylase, a cytochrome P450 whose expression is regulated by oxysterols.", "journal": "Archives of biochemistry and biophysics", "date": "1996", "authors": "Stromstedt M, Rozman D, Waterman MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "8619637", "url": "https://glygen.org/publication/PubMed/8619637" } ] }, { "title": "Aldose reductase is a major reductase for isocaproaldehyde, a product of side-chain cleavage of cholesterol, in human and animal adrenal glands.", "journal": "Archives of biochemistry and biophysics", "date": "1996", "authors": "Matsuura K, Deyashiki Y, Bunai Y, Ohya I, Hara A", "evidence": [ { "database": "Reactome", "id": "R-HSA-196108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196108" } ], "reference": [ { "type": "PubMed", "id": "8645003", "url": "https://glygen.org/publication/PubMed/8645003" } ] }, { "title": "A critical review of the origin and control of adrenal androgens.", "journal": "Bailliere's clinical obstetrics and gynaecology", "date": "1997", "authors": "McKenna TJ, Fearon U, Clarke D, Cunningham SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976" } ], "reference": [ { "type": "PubMed", "id": "9536209", "url": "https://glygen.org/publication/PubMed/9536209" } ] }, { "title": "Expression of catalytically active human cytochrome p450scc in Escherichia coli and mutagenesis of isoleucine-462.", "journal": "Archives of biochemistry and biophysics", "date": "1998", "authors": "Woods ST, Sadleir J, Downs T, Triantopoulos T, Headlam MJ, Tuckey RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-196108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196108" } ], "reference": [ { "type": "PubMed", "id": "9578606", "url": "https://glygen.org/publication/PubMed/9578606" } ] }, { "title": "Cloning and characterization of PRAX-1. A new protein that specifically interacts with the peripheral benzodiazepine receptor.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Galiegue S, Jbilo O, Combes T, Bribes E, Carayon P, Le Fur G, Casellas P", "evidence": [ { "database": "Reactome", "id": "R-HSA-196108", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196108" } ], "reference": [ { "type": "PubMed", "id": "9915832", "url": "https://glygen.org/publication/PubMed/9915832" } ] } ], "pathway": [ { "id": "hsa:2230", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2230", "resource": "KEGG Pathway" }, { "id": "R-HSA-1362409", "name": "Mitochondrial iron-sulfur cluster biogenesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1362409", "resource": "Reactome", "description": "Mitochondrial iron-sulfur cluster biogenesis" }, { "id": "R-HSA-196108", "name": "Pregnenolone biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-196108", "resource": "Reactome", "description": "Pregnenolone biosynthesis" }, { "id": "R-HSA-211976", "name": "Endogenous sterols", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211976", "resource": "Reactome", "description": "Endogenous sterols" }, { "id": "R-HSA-2395516", "name": "Electron transport from NADPH to Ferredoxin", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2395516", "resource": "Reactome", "description": "Electron transport from NADPH to Ferredoxin" }, { "id": "R-HSA-5579026", "name": "Defective CYP11A1 causes AICSR", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5579026", "resource": "Reactome", "description": "Defective CYP11A1 causes AICSR" } ], "orthologs": [ { "uniprot_canonical_ac": "P00258-1", "protein_name": "Adrenodoxin, mitochondrial", "gene_name": "FDX1", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MAVRLLRVASAALGDTAVRWQPLVGPRAGNRGPGGSIWLGLGGRAAAARTLSLSARAWSSSEDKITVHFINRDGKTLTTQGKVGDSLLDVVIENNLDIDGFGACEGTLACSTCHLIFEDHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPEAVADARESIDLGKNSSKLE", "length": 186 }, "evidence": [ { "id": "P10109", "url": "https://omabrowser.org/oma/group/P10109/", "database": "OMA" } ], "common_name": "Pig" }, { "uniprot_canonical_ac": "P24483-1", "protein_name": "Adrenodoxin, mitochondrial", "gene_name": "Fdx1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAAAPGARLLRAACASVAFRGLDCRRLLVCGTRAGPAVPQWTPSPHTLAEAGPGRPLSVSARARSSSEDKVTVHFKNRDGETLTTKGKVGDSLLDVVIENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAFGLTNRSRLGCQVCLTKAMDNMTVRVPEAVADVRQSVDMSKNS", "length": 188 }, "evidence": [ { "id": "45921919", "url": "http://www.informatics.jax.org/homology/45921919", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P46656-1", "protein_name": "Adrenodoxin, mitochondrial", "gene_name": "Fdx1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAAAPGARLLRAACASVPFRGLDRCRLLVCGTGAGTAISPWTPSPRLHAEAGPGRPLSVSARARSSSEDKITVHFKNRDGETLTTKGKIGDSLLDVVIENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAFGLTDRSRLGCQVCLTKAMDNMTVRVPEAVADVRQSVDMSKNS", "length": 188 }, "evidence": [ { "id": "45921919", "url": "http://www.informatics.jax.org/homology/45921919", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "iron ion binding", "id": "GO:0005506", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005506", "evidence": [ { "database": "UniProtKB", "id": "P10109", "url": "https://www.uniprot.org/uniprot/P10109" } ], "pmid": "" }, { "name": "electron transfer activity", "id": "GO:0009055", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009055", "evidence": [ { "database": "UniProtKB", "id": "P10109", "url": "https://www.uniprot.org/uniprot/P10109" } ], "pmid": "" }, { "name": "2 iron, 2 sulfur cluster binding", "id": "GO:0051537", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051537", "evidence": [ { "database": "UniProtKB", "id": "P10109", "url": "https://www.uniprot.org/uniprot/P10109" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "P10109", "url": "https://www.uniprot.org/uniprot/P10109" } ], "pmid": "" }, { "name": "mitochondrial matrix", "id": "GO:0005759", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005759", "evidence": [ { "database": "UniProtKB", "id": "P10109", "url": "https://www.uniprot.org/uniprot/P10109" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "cholesterol metabolic process", "id": "GO:0008203", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008203", "evidence": [ { "database": "UniProtKB", "id": "P10109", "url": "https://www.uniprot.org/uniprot/P10109" } ], "pmid": "" }, { "name": "cellular response to cAMP", "id": "GO:0071320", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071320", "evidence": [ { "database": "UniProtKB", "id": "P10109", "url": "https://www.uniprot.org/uniprot/P10109" } ], "pmid": "" }, { "name": "cellular response to forskolin", "id": "GO:1904322", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904322", "evidence": [ { "database": "UniProtKB", "id": "P10109", "url": "https://www.uniprot.org/uniprot/P10109" } ], "pmid": "" }, { "name": "hormone biosynthetic process", "id": "GO:0042446", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042446", "evidence": [ { "database": "UniProtKB", "id": "P10109", "url": "https://www.uniprot.org/uniprot/P10109" } ], "pmid": "" }, { "name": "steroid biosynthetic process", "id": "GO:0006694", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006694", "evidence": [ { "database": "UniProtKB", "id": "P10109", "url": "https://www.uniprot.org/uniprot/P10109" } ], "pmid": "" }, { "name": "electron transport chain", "id": "GO:0022900", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022900", "evidence": [ { "database": "UniProtKB", "id": "P10109", "url": "https://www.uniprot.org/uniprot/P10109" } ], "pmid": "" }, { "name": "P450-containing electron transport chain", "id": "GO:0140647", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140647", "evidence": [ { "database": "UniProtKB", "id": "P10109", "url": "https://www.uniprot.org/uniprot/P10109" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 162, "end_pos": 164, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 63, 177 ], "sequon_annotation_sites": [ { "start_pos": 162, "end_pos": 164 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 76 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }