{ "uniprot_canonical_ac": "P0DX04-1", "uniprot_ac": "P0DX04", "uniprot_id": "TB15C_HUMAN", "mass": { "chemical_mass": 5229.0, "monoisotopic_mass": 5229.0 }, "refseq": { "ac": "NP_068832", "name": "thymosin beta-15A", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_068832" }, "gene_names": [ { "name": "TMSB15C", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/P0DX04", "id": "P0DX04" } ], "protein_names": [ { "name": "Thymosin beta-15C", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "P0DX04" }, { "name": "thymosin beta-15A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_068832", "id": "NP_068832" }, { "name": "thymosin-like 8; thymosin, beta, identified in neuroblastoma cells; Thymosin beta-15B; NB thymosin beta; thymosin-like protein 8", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_068832", "id": "NP_068832" } ], "function": [ { "annotation": "Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G-actin) and therefore inhibits actin polymerization.", "evidence": [ { "database": "UniProtKB", "id": "P0DX04", "url": "https://www.uniprot.org/uniprot/P0DX04#function" }, { "database": "UniProtKB", "id": "P62328", "url": "https://www.uniprot.org/uniprot/P62328#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DX04", "url": "https://www.uniprot.org/uniprot/P0DX04" } ], "common_name": "Human" } ], "gene": [ { "name": "TMSB15C", "url": "https://www.uniprot.org/uniprot/P0DX04", "locus": { "chromosome": "X", "start_pos": 104063871, "end_pos": 104076236, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000269226", "url": "https://www.ensembl.org/id/ENSG00000269226" } ] } } ], "crossref": [ { "id": "ENSG00000269226", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000269226", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd22059", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd22059", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "TMSB15C", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=TMSB15C", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "11013", "url": "https://www.ncbi.nlm.nih.gov/gene/11013", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "286527", "url": "https://www.ncbi.nlm.nih.gov/gene/286527", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "55173", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=55173", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR001152", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001152", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038386", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038386", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:11013", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:11013", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:286527", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:286527", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "P0DX04", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P0DX04", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "QRHDFGS", "url": "https://omabrowser.org/oma/group/QRHDFGS/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3059543at2759", "url": "http://www.orthodb.org/?query=3059543at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12021", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12021", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12021:SF11", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12021:SF11", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12021:SF21", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12021:SF21", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01290", "url": "http://pfam.xfam.org/family/PF01290", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_068832", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_068832", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A087X1C1", "url": "https://www.uniprot.org/uniprot/A0A087X1C1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087X1C1-1", "url": "https://www.uniprot.org/uniprot/A0A087X1C1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DX04", "url": "https://www.uniprot.org/uniprot/P0DX04", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P0DX04-1", "url": "https://www.uniprot.org/uniprot/P0DX04-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS", "length": 45, "header": "sp|P0DX04-1|TB15C_HUMAN Isoform 1 of Thymosin beta-15C OS=Homo sapiens OX=9606 GN=TMSB15C PE=3 SV=1 CANONICAL=P0DX04-1" }, "isoforms": [ { "isoform_ac": "A0A087X1C1-1", "url": "", "sequence": { "sequence": "MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKEKGVSLCRQAGVQRHDFGSLQTSLPEFKQFSCLSLPSSWDLRHITKPG", "length": 80, "header": "tr|A0A087X1C1-1|A0A087X1C1_HUMAN Computationally mapped isoform of Thymosin beta 15C OS=Homo sapiens OX=9606 GN=TMSB15C PE=3 SV=1 CANONICAL=P0DX04-1" }, "locus": { "chromosome": "X", "start_pos": 104074340, "end_pos": 104065845, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000620307.4", "url": "https://www.ensembl.org/id/ENST00000620307.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000484052.1", "url": "https://www.ensembl.org/id/ENSP00000484052.1" } ] } }, { "isoform_ac": "P0DX04-1", "url": "", "sequence": { "sequence": "MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS", "length": 45, "header": "sp|P0DX04-1|TB15C_HUMAN Isoform 1 of Thymosin beta-15C OS=Homo sapiens OX=9606 GN=TMSB15C PE=3 SV=1 CANONICAL=P0DX04-1" }, "locus": { "chromosome": "X", "start_pos": 104074340, "end_pos": 104073290, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000598087.4", "url": "https://www.ensembl.org/id/ENST00000598087.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000472749.1", "url": "https://www.ensembl.org/id/ENSP00000472749.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 21, "start_aa": "Thr", "end_pos": 21, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr21", "evidence": [ { "id": "P0DX04", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P0DX04" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 23, "start_aa": "Thr", "end_pos": 23, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr23", "evidence": [ { "id": "P0DX04", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P0DX04" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Next-generation unnatural monosaccharides reveal that ESRRB O-GlcNAcylation regulates pluripotency of mouse embryonic stem cells.", "journal": "Nature communications", "date": "2019", "authors": "Hao Y, Fan X, Shi Y, Zhang C, Sun DE, Qin K, Qin W, Zhou W, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "P0DX04", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P0DX04" } ], "reference": [ { "type": "PubMed", "id": "31492838", "url": "https://glygen.org/publication/PubMed/31492838" } ] } ], "pathway": [ { "id": "hsa:11013", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:11013", "resource": "KEGG Pathway" }, { "id": "hsa:286527", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:286527", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "actin monomer binding", "id": "GO:0003785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003785", "evidence": [ { "database": "UniProtKB", "id": "P0DX04", "url": "https://www.uniprot.org/uniprot/P0DX04" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "P0DX04", "url": "https://www.uniprot.org/uniprot/P0DX04" } ], "pmid": "" }, { "name": "cytoskeleton", "id": "GO:0005856", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005856", "evidence": [ { "database": "UniProtKB", "id": "P0DX04", "url": "https://www.uniprot.org/uniprot/P0DX04" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "actin filament organization", "id": "GO:0007015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007015", "evidence": [ { "database": "UniProtKB", "id": "P0DX04", "url": "https://www.uniprot.org/uniprot/P0DX04" } ], "pmid": "" }, { "name": "regulation of cell migration", "id": "GO:0030334", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030334", "evidence": [ { "database": "UniProtKB", "id": "P0DX04", "url": "https://www.uniprot.org/uniprot/P0DX04" } ], "pmid": "" }, { "name": "sequestering of actin monomers", "id": "GO:0042989", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042989", "evidence": [ { "database": "UniProtKB", "id": "P0DX04", "url": "https://www.uniprot.org/uniprot/P0DX04" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 21, 23 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }